Psyllid ID: psy903


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------74
SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGSLSSPSDDSSSHLCSQGKKSGVHAKTQTGDTALTYACENGHTDVADLLLSYGANLRNRT
cHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccc
cHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHccHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHHHccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccc
slvqacsdgdVKTVKKLLTEgrsvhettdeGESLLSLACSAGYYELAQVLLAMHANvedrgikgectplmeaassgfgklatgdgkladpeVLRRLTSSVSCALDEAAAALTRMrnenprpqnerslvqacsdgdVKTVKKLLTEgrsvhettdeGESLLSLACSAGYYELAQVLLAMHANvedrgikgectplmeaaSSGFIEIVRLLINhgadvngqsssgntplMYACAGGHEAVVRVLLECganvedhnenghtplmeaasAGHVGVAKILLEYgaginthsneFKESALTLACYKGHLDMVRFLLSagadqehktDEMHTALMEASMDGHVEVAKLLLDSGAqsvsayarhdffpndkcerpssisytysrslvqacsdgdVKTVKKLLTEgrsvhettdeGESLLSLACSAGYYELAQVLLAMHANvedrgikgectplmeaassgrqcnlnesvsayarhdffpndksvnglqasvilipgakinahteeTQETALTLACCGGFLDVADFLLknganielgastplmEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDfprsvhaktqtgdtaLTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDfprsviggslsspsddssshlcsqgkksgvhaktqtgdtALTYACENGHTDVADLLLSYganlrnrt
slvqacsdgdvktvkklltegrsvhettdegESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTrmrnenprpqnerslvqacsdgdVKTVKKLLtegrsvhettdegESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAyarhdffpndkcerpsSISYTYSRSLVQACSDGDVKTVKKLLtegrsvhettdegESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGSLSSPSDDSSSHLCSQGKKSGVHAKTQTGDTALTYACENGHTDVADLLLsyganlrnrt
SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHteetqetaltlaCCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGslsspsddssshlcsQGKKSGVHAKTQTGDTALTYACENGHTDVADLLLSYGANLRNRT
********************************SLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEA****F***************L********C*******************************************************SLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNG*****NTPLMYACAGGHEAVVRVLLECGANVEDHN***HTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSA***********************************************************YTYSRSLVQACSDGDVKTVKKLLT************ESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLM********CNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVI********************************TALTYACENGHTDVADLLLSYGA******
SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGSLSSPSDDSSSHLCSQGKKSGVHAKTQTGDTALTYACENGHTDVADLLLSYGAN*****
SLVQACSDGDVKTVKKLLTEGRS*********SLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRN*********SLVQACSDGDVKTVKKLLTEGRS*********SLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRS*********SLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGS************************TQTGDTALTYACENGHTDVADLLLSYGANLRNRT
SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGSLSSPSDDSSSHLCSQGKKSGVHAKTQTGDTALTYACENGHTDVADLLLSYG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGSLSSPSDDSSSHLCSQGKKSGVHAKTQTGDTALTYACENGHTDVADLLLSYGANLRNRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query739 2.2.26 [Sep-21-2011]
Q99NH0 2603 Ankyrin repeat domain-con no N/A 0.711 0.202 0.562 1e-158
Q8IWZ3 2542 Ankyrin repeat and KH dom no N/A 0.684 0.199 0.559 1e-158
O75179 2603 Ankyrin repeat domain-con no N/A 0.711 0.202 0.560 1e-158
Q9VCA8 4001 Ankyrin repeat and KH dom yes N/A 0.645 0.119 0.518 1e-134
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.736 0.380 0.305 2e-51
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.878 0.348 0.296 1e-47
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.902 0.168 0.293 3e-47
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.902 0.171 0.293 9e-47
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.876 0.344 0.292 1e-45
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.894 0.337 0.283 2e-43
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function desciption
 Score =  559 bits (1440), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 333/592 (56%), Positives = 402/592 (67%), Gaps = 66/592 (11%)

Query: 69  LMEAASSGFGKLATGDGK-LADPEVLRRLTSSVSCALDEAAAALTRMRNE---NPRPQNE 124
           L+EAA  G GKL+T DGK  ADPEVLRRLTSSVSCALDEAAAALTRMR E   N    + 
Sbjct: 174 LLEAA--GIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDN 231

Query: 125 RSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVED 184
           RSL +ACS+GDV  V+KLL EGRSV+E T+EGESLL LACSAGYYELAQVLLAMHANVED
Sbjct: 232 RSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVED 291

Query: 185 RGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLE 244
           RGIKG+ TPLM AA+ G ++IV+LL+ H ADVN QSS+GNT L YACAGG+  VV+VLLE
Sbjct: 292 RGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLE 351

Query: 245 CGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLD 304
            GA++EDHNENGHTPLMEA SAGHV VA++LLE GAGINTHSNEFKESALTLACYKGHL+
Sbjct: 352 SGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLE 411

Query: 305 MVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQ------------SVSA 352
           MVRFLL AGADQEHKTDEMHTALMEA MDGHVEVA+LLLDSGAQ            +++A
Sbjct: 412 MVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAA 471

Query: 353 YARHDFFPNDKCERPSSIS------YTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDE 406
              H        ER +S+       YT    L++A  +G  + V  LL +G +++  T+E
Sbjct: 472 CGGHVELAALLIERGASLEEVNDEGYT---PLMEAAREGHEEMVALLLGQGANINAQTEE 528

Query: 407 -GESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYA 465
             E+ L+LAC  G+ E+A  L+   A++E     G  TPLMEAA  G     +  +  Y 
Sbjct: 529 TQETALTLACCGGFLEVADFLIKAGADIE----LGCSTPLMEAAQEG-----HLELVKY- 578

Query: 466 RHDFFPNDKSVNGLQASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANI 525
                             +L  GA ++A T  T +TALT AC  G  DVAD LL+ GA++
Sbjct: 579 ------------------LLAAGANVHA-TTATGDTALTYACENGHTDVADVLLQAGADL 619

Query: 526 E---LGASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGD-TALTYACENGHTDVADLL 581
           E    G  TPLM+AA+ GH+  V++L+  GA V+  T   D T L+ AC  GH  V +LL
Sbjct: 620 EHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELL 679

Query: 582 LSYGANL-----DNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALT 628
           L++GA+      D STMLIEAAKGGH +VV  LLD+P ++ A      T LT
Sbjct: 680 LAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLAAPPPDVTQLT 731




Earliest specific in situ marker of hepatic differentiation during embryogenesis, useful for characterization of inductive events involved in hepatic specification.
Mus musculus (taxid: 10090)
>sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 Back     alignment and function description
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query739
332234642 2542 PREDICTED: ankyrin repeat and KH domain- 0.745 0.216 0.578 0.0
270002082 2691 hypothetical protein TcasGA2_TC001033 [T 0.714 0.196 0.565 1e-177
328790111 3136 PREDICTED: hypothetical protein LOC40998 0.690 0.162 0.596 1e-174
350419534 3091 PREDICTED: hypothetical protein LOC10074 0.690 0.164 0.594 1e-174
307212336 2982 Ankyrin repeat domain-containing protein 0.684 0.169 0.597 1e-173
242019742 2803 multiple ankyrin repeats single kh domai 0.686 0.180 0.597 1e-173
307186886 2898 Ankyrin repeat domain-containing protein 0.698 0.178 0.591 1e-173
332022374 3049 Ankyrin repeat and KH domain-containing 0.698 0.169 0.59 1e-173
189234573 2677 PREDICTED: similar to Ankyrin repeat dom 0.702 0.193 0.58 1e-172
126330668 2360 PREDICTED: ankyrin repeat domain-contain 0.845 0.264 0.496 1e-162
>gi|332234642|ref|XP_003266514.1| PREDICTED: ankyrin repeat and KH domain-containing protein 1 isoform 1 [Nomascus leucogenys] Back     alignment and taxonomy information
 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/643 (57%), Positives = 435/643 (67%), Gaps = 92/643 (14%)

Query: 69  LMEAASSGFGKLATGDGK-LADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNE--- 124
           L+EAA  G GKL+T DGK  ADPEVLRRLTSSVSCALDEAAAALTRM+ EN     +   
Sbjct: 142 LLEAA--GIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMKAENSHNAGQVDT 199

Query: 125 RSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVED 184
           RSL +ACSDGDV  V+KLL EGRSV+E T+EGESLL LACSAGYYELAQVLLAMHANVED
Sbjct: 200 RSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVED 259

Query: 185 RGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLE 244
           RG KG+ TPLM A+S G+++IV+LL+ H ADVN QS++GNT L YACAGG   +V+VLL 
Sbjct: 260 RGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLN 319

Query: 245 CGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLD 304
            GAN+EDHNENGHTPLMEAASAGHV VA++LL++GAGINTHSNEFKESALTLACYKGHLD
Sbjct: 320 EGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLD 379

Query: 305 MVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKC 364
           MVRFLL AGADQEHKTDEMHTALMEA MDGHVEVA+LLLDSGAQ                
Sbjct: 380 MVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQ---------------- 423

Query: 365 ERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQ 424
                                              V+   D  ES L+LA   G+ ELA 
Sbjct: 424 -----------------------------------VNMPADSFESPLTLAACGGHVELAA 448

Query: 425 VLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVI 484
           +L+   AN+E+   +G  TPLMEAA  G +    E V+           K+V  L    +
Sbjct: 449 LLIERGANLEEVNDEG-YTPLMEAAREGHE----EMVAL-----LLAQGKAVLLLLEKSV 498

Query: 485 LIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLEL 544
              G  +       + TALTLACCGGF +VADFL+K GA+IELG STPLMEA+QEGHLEL
Sbjct: 499 FF-GCFV-------KYTALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLEL 550

Query: 545 VRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNS-----TMLIEAAK 599
           V+YLL SGA VHA T TGDTALTYACENGHTDVAD+LL  GA+L++      T L++AA+
Sbjct: 551 VKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAAR 610

Query: 600 GGHANVVQLLLDFPRSVHAKTQTGD-TALTYACENGHTDVADLLLSYGANL-----DNST 653
            GH   VQ L+    +V+  T   D T ++ AC  GH  V +LLL++GA+      D ST
Sbjct: 611 AGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGST 670

Query: 654 MLIEAAKGGHANVVQLLLDFPRSVIG------GSLSSPSDDSS 690
           MLIEAAKGGH NVV  LLD+P +V+         L  PS D S
Sbjct: 671 MLIEAAKGGHTNVVSYLLDYPNNVLSVPTTDVSQLPPPSQDQS 713




Source: Nomascus leucogenys

Species: Nomascus leucogenys

Genus: Nomascus

Family: Hylobatidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|270002082|gb|EEZ98529.1| hypothetical protein TcasGA2_TC001033 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328790111|ref|XP_393472.4| PREDICTED: hypothetical protein LOC409983 [Apis mellifera] Back     alignment and taxonomy information
>gi|350419534|ref|XP_003492217.1| PREDICTED: hypothetical protein LOC100740063 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307212336|gb|EFN88140.1| Ankyrin repeat domain-containing protein 17 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242019742|ref|XP_002430318.1| multiple ankyrin repeats single kh domain protein, putative [Pediculus humanus corporis] gi|212515433|gb|EEB17580.1| multiple ankyrin repeats single kh domain protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307186886|gb|EFN72287.1| Ankyrin repeat domain-containing protein 17 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332022374|gb|EGI62686.1| Ankyrin repeat and KH domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189234573|ref|XP_974489.2| PREDICTED: similar to Ankyrin repeat domain-containing protein 17 (Gene trap ankyrin repeat protein) (Serologically defined breast cancer antigen NY-BR-16) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|126330668|ref|XP_001364787.1| PREDICTED: ankyrin repeat domain-containing protein 17 isoform 2 [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query739
UNIPROTKB|E1BVC6 1330 Gga.53476 "Uncharacterized pro 0.763 0.424 0.535 7.1e-154
UNIPROTKB|E9PDP5 1565 ANKHD1 "Ankyrin repeat and KH 0.543 0.256 0.596 1.6e-151
UNIPROTKB|F6XJV3 2539 ANKHD1 "Uncharacterized protei 0.769 0.224 0.534 5.3e-151
UNIPROTKB|E2QVL1 2616 ANKHD1 "Uncharacterized protei 0.769 0.217 0.534 6.7e-151
UNIPROTKB|F1RGE8 2540 ANKHD1 "Uncharacterized protei 0.763 0.222 0.538 1.1e-150
UNIPROTKB|F1LRM8 2341 Ankrd17 "Protein Ankrd17" [Rat 0.763 0.240 0.537 1.5e-150
UNIPROTKB|D4A0B4 2358 Ankrd17 "Similar to ankyrin re 0.763 0.239 0.537 1.6e-150
UNIPROTKB|I3LSK0 2222 ANKRD17 "Uncharacterized prote 0.763 0.253 0.535 1.8e-150
UNIPROTKB|G5E964 2352 ANKRD17 "Ankyrin repeat domain 0.763 0.239 0.535 3.4e-150
UNIPROTKB|F1LQP1 2592 Ankrd17 "Protein Ankrd17" [Rat 0.763 0.217 0.537 3.6e-150
UNIPROTKB|E1BVC6 Gga.53476 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1392 (495.1 bits), Expect = 7.1e-154, Sum P(2) = 7.1e-154
 Identities = 323/603 (53%), Positives = 396/603 (65%)

Query:    47 AQVLLAMHANVED-RGIKGECTPLMEAA--SSGFGKLATGDGK-LADPEVLRRLTSSVSC 102
             +++LL+  A+  D R +  E    +EA   ++G GKL+T DGK  ADPEVLRRLTSSVSC
Sbjct:     6 SKLLLSSTADGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSC 65

Query:   103 ALDEAAAALTRMRNE---NPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESL 159
             ALDEAAAALTRMR E   N    + RSL +ACS+GDV  V+KLL EGRSV+E T+EGESL
Sbjct:    66 ALDEAAAALTRMRAESTANAGQTDNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESL 125

Query:   160 LSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQ 219
             L LACSAGYYELAQVLLAMHANVEDRGIKG+ TPLM AA+ G ++IV+LL+ HGADVN Q
Sbjct:   126 LCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHGADVNAQ 185

Query:   220 SSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYG 279
             SS+GNT L YACAGG+  VV+VLLE GA++EDHNENGHTPLMEA SAGHV VA++LLE G
Sbjct:   186 SSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARVLLENG 245

Query:   280 AGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVA 339
             AGINTHSNEFKESALTLACYKGHL+MVRFLL AGADQEHKTDEMHTALMEA MDGHVEVA
Sbjct:   246 AGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVA 305

Query:   340 KLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRS 399
             +LLLDSGAQ V+        P D  E P +++         AC  G V+    L+  G +
Sbjct:   306 RLLLDSGAQ-VN-------MPADSFESPLTLA---------ACG-GHVELAALLIERGAN 347

Query:   400 VHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNE 459
             + E  DEG + L  A   G+ E+  +LL   AN+  +  + + T L  A   G     + 
Sbjct:   348 LEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADF 407

Query:   460 SVSAYARHDFFPNDKSVNGLQAS----VILIPGAKINAHXXXXXXXXXXXXCC-GGFLDV 514
              + A A  +   +   +   Q      V  +  A  N H             C  G  DV
Sbjct:   408 LIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDV 467

Query:   515 ADFLLKNGANIEL---GASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGD-TALTYAC 570
             AD LL+ GA++E    G  TPLM+AA+ GH+  V++L+  GA V+  T   D T L+ AC
Sbjct:   468 ADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLAC 527

Query:   571 ENGHTDVADLLLSYGAN-----LDNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDT 625
               GH  V +LLL++GA+      D STMLIEAAKGGH +VV  LLD+P ++ +      T
Sbjct:   528 AGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLSAPPPDAT 587

Query:   626 ALT 628
              LT
Sbjct:   588 QLT 590


GO:0001955 "blood vessel maturation" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0051151 "negative regulation of smooth muscle cell differentiation" evidence=IEA
UNIPROTKB|E9PDP5 ANKHD1 "Ankyrin repeat and KH domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6XJV3 ANKHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVL1 ANKHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGE8 ANKHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRM8 Ankrd17 "Protein Ankrd17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A0B4 Ankrd17 "Similar to ankyrin repeat domain protein 17 isoform b (Predicted), isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSK0 ANKRD17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5E964 ANKRD17 "Ankyrin repeat domain 17, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQP1 Ankrd17 "Protein Ankrd17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VCA8ANKHM_DROMENo assigned EC number0.51850.64540.1192yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query739
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-34
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-33
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-27
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-26
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-19
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-19
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-19
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-18
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-18
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-18
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-16
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-16
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-16
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-16
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-15
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-14
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-14
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-13
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-12
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-12
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 9e-12
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-11
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-11
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-11
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-11
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-10
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-10
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-10
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 5e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-09
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-08
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-07
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 1e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-06
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 3e-06
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 9e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-05
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-05
smart0024830 smart00248, ANK, ankyrin repeats 7e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-04
smart0024830 smart00248, ANK, ankyrin repeats 4e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 4e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-04
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 5e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 6e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 8e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.004
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 0.004
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  127 bits (322), Expect = 1e-34
 Identities = 54/127 (42%), Positives = 76/127 (59%), Gaps = 1/127 (0%)

Query: 217 NGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILL 276
           N +   G TPL  A + GH  VV++LLE GA+V   + +G TPL  AA  GH+ + K+LL
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 277 EYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHV 336
           E GA +N   ++   + L LA   G+LD+V+ LL  GAD   +  +  T L  A+ +GH+
Sbjct: 61  EKGADVN-ARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHL 119

Query: 337 EVAKLLL 343
           EV KLLL
Sbjct: 120 EVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 739
KOG4177|consensus 1143 100.0
KOG4177|consensus 1143 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG0509|consensus600 100.0
KOG0509|consensus600 100.0
KOG4369|consensus 2131 100.0
KOG4369|consensus 2131 99.97
PHA02795437 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
KOG0502|consensus296 99.94
KOG0507|consensus 854 99.93
TIGR00870743 trp transient-receptor-potential calcium channel p 99.93
KOG0502|consensus296 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
TIGR00870743 trp transient-receptor-potential calcium channel p 99.9
KOG0507|consensus 854 99.9
KOG0505|consensus527 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
KOG0514|consensus452 99.86
KOG0514|consensus452 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.84
KOG0505|consensus527 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.82
PHA02741169 hypothetical protein; Provisional 99.82
PHA02741169 hypothetical protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
KOG0512|consensus228 99.79
KOG0512|consensus228 99.79
KOG0195|consensus448 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
KOG3676|consensus782 99.73
KOG3676|consensus782 99.7
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.69
KOG0195|consensus448 99.68
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.65
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.6
KOG4214|consensus117 99.56
KOG4214|consensus117 99.53
KOG1710|consensus396 99.51
KOG1710|consensus396 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.44
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.42
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.39
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.39
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.37
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.37
KOG0515|consensus752 99.35
KOG0515|consensus752 99.32
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.25
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.23
PF1360630 Ank_3: Ankyrin repeat 99.01
PF1360630 Ank_3: Ankyrin repeat 99.0
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.87
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.84
KOG0511|consensus516 98.67
KOG0783|consensus 1267 98.67
KOG0782|consensus1004 98.67
KOG0782|consensus1004 98.64
KOG0506|consensus622 98.63
KOG0783|consensus 1267 98.62
KOG0506|consensus622 98.61
KOG0818|consensus669 98.6
KOG0818|consensus669 98.59
KOG3609|consensus 822 98.45
KOG3609|consensus 822 98.43
KOG0511|consensus516 98.35
KOG0705|consensus749 98.32
KOG0522|consensus560 98.27
KOG0705|consensus749 98.24
KOG2384|consensus223 98.22
KOG0522|consensus560 98.19
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.77
KOG0521|consensus785 97.76
KOG2384|consensus223 97.7
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.64
KOG0521|consensus785 97.52
KOG0520|consensus975 97.37
KOG0520|consensus975 97.16
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.13
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.12
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.77
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.74
KOG2505|consensus591 96.74
KOG2505|consensus591 96.59
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 94.1
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.46
PLN03077857 Protein ECB2; Provisional 89.58
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 89.15
PLN032181060 maturation of RBCL 1; Provisional 88.45
PLN032181060 maturation of RBCL 1; Provisional 87.76
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 83.8
PLN03077 857 Protein ECB2; Provisional 83.59
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-63  Score=517.19  Aligned_cols=594  Identities=32%  Similarity=0.409  Sum_probs=496.1

Q ss_pred             ChhhhhhcCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHhcCcHHHHHHHHHccccccccCCCCCcchhHHHhhcccccc
Q psy903            1 SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKL   80 (739)
Q Consensus         1 ~L~~A~~~g~~~~v~~ll~~g~~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~ga~~~~~~~~~~~t~l~~a~~~~~~~~   80 (739)
                      .|+.|++.||.+.++.|++.....+.....|.||||+|+-+|+.+++++|++.|+.++.....+. ||||.|+..|    
T Consensus        24 ~l~~a~r~~~~~~~~~l~~~e~~~~~~sk~~~~pl~~aa~~~~~~v~~~ll~~~a~v~~~~~~~~-~plh~a~~~~----   98 (1143)
T KOG4177|consen   24 ALHIAARNDDTNAAKLLLQNEHNADVDSKSGFTPLHIAAHYGNENVAELLLNRGAIVNATARNGI-TPLHVASKRG----   98 (1143)
T ss_pred             HHHHHHhccchhhcccccccccccchhcccccCHHHHHhhhhhhhhhhhhhccccccCcccccCc-cHHHHHHhhc----
Confidence            48999999999999999997666665666899999999999999999999999999998887775 9999999999    


Q ss_pred             ccCCCCCCCHHHHHhhhhhhhchHHHHHHHHHhhhcCCCCCCCchHHHHHHHcCCHHHHHHHHhcCCCCCcCCCCCCcHH
Q psy903           81 ATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLL  160 (739)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~A~~~~~~~~~~~ll~~~~~~~~~~~~g~t~L  160 (739)
                              +.++++.+......             ....+..+.|+||.|+..|+.+++..|++.+++++.++..|.||+
T Consensus        99 --------~a~~v~~ll~~ga~-------------~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~~~k~~~g~t~l  157 (1143)
T KOG4177|consen   99 --------DAEMVKLLLCRGAQ-------------IDARDRDGLTPLHCAARKGHVQVIELLLQHGAPINIKTKNGLSPL  157 (1143)
T ss_pred             --------chhHHHHHHhccCc-------------hhhcccCCCcchhhhcccccHHHHHHHHHccCCCcccccCCCCch
Confidence                    55555555444322             223456788999999999999999999999999999999999999


Q ss_pred             HHHHHcCcHHHHHHHHhCCCCccccCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCCCCCCCCCcHHHHHHhcCcHHHHH
Q psy903          161 SLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVR  240 (739)
Q Consensus       161 ~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~L~~A~~~~~~~~v~  240 (739)
                      ++|+.   ...++++.++..      ..  +-+++.|...++.++++.++...++++..+.++.||+|.|+..+..++++
T Consensus       158 ~~a~~---~~~~~ll~~~~~------~d--~l~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~nri~~~e  226 (1143)
T KOG4177|consen  158 HMAAQ---VACARLLLEYKA------PD--YLRLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKKNRIKVVE  226 (1143)
T ss_pred             hhhcc---hhhhHHhhhccc------ch--hhhhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccccccceee
Confidence            99998   777777777765      11  12779999999999999999999999999999999999999999999999


Q ss_pred             HHHHCCCCCCCCCCCCCcHHHHHHhcCChHHHHHHHHcCCCCcccCcCccCCHHHHHHHcCCHHHHHHHHHcCCCCCCCC
Q psy903          241 VLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKT  320 (739)
Q Consensus       241 ~Ll~~~~~~~~~~~~~~t~L~~A~~~~~~~ii~~Ll~~~~~~~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~  320 (739)
                      +++.+|+++...|..|.||+|.|+..|+++++.+++.+|+..+.. +..+.||+|.|+..+..+++++|+++|+++....
T Consensus       227 Lll~~gadv~a~d~~gl~~lh~a~~~g~~~i~~~l~~~ga~~~~~-~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~~  305 (1143)
T KOG4177|consen  227 LLLKHGADVSAKDESGLTPLHVAAFMGHLDIVKLLLQHGASVNVS-TVRGETPLHMAARAGQVEVCKLLLQNGADVLAKA  305 (1143)
T ss_pred             eeeeccCcCCcccccCccHHHHHHhccchhHHHHHHhcccccCcc-cccccCcchhhhccchhhhHhhhhccCccccccc
Confidence            999999999999999999999999999999999999999998875 4458999999999999999999999999999999


Q ss_pred             CcCCcHHHHHHhCCchHHHHHHHHcCCCchhhhcccCCCCCCCCCCCCCcccccchHHHHHHhcCCHHHHHHHHHCCCCC
Q psy903          321 DEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSV  400 (739)
Q Consensus       321 ~~~~~~l~~a~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~  400 (739)
                      ....++++.+...++.++++++++.++.+.                  .......++++.++..+..++..++...+..-
T Consensus       306 ~~~kt~l~~a~~~g~~~i~~~~l~~~~~~~------------------aar~~g~t~lHlaa~~~~~~~~~~l~~~~~~~  367 (1143)
T KOG4177|consen  306 RDDQTPLHIASRLGHEEIVHLLLQAGATPN------------------AARTAGYTPLHLAAKEGQVEVAGALLEHGAQR  367 (1143)
T ss_pred             ccccChhhhhcccchHHHHHHHhhccCCcc------------------ccCcCCcccccHhhhhhhHHHHHHhhcccccc
Confidence            999999999999999999999999877643                  23344556788888888888888888888877


Q ss_pred             ccCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCcccccCCCCCcHHHHHHHcCCccchhhHHHhhhccCCCCCCcccccch
Q psy903          401 HETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQ  480 (739)
Q Consensus       401 ~~~~~~~~t~l~~a~~~~~~~~v~~Ll~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (739)
                      ....+.+.+|++.|+..++.++++.++..|++++.....                                         
T Consensus       368 ~~a~~k~~~pl~la~~~g~~~~v~Lll~~ga~~~~~gk~-----------------------------------------  406 (1143)
T KOG4177|consen  368 RQAEEKGFTPLHLAVKSGRVSVVELLLEAGADPNSAGKN-----------------------------------------  406 (1143)
T ss_pred             CcccccCCcchhhhcccCchhHHHhhhhccCCcccCCCC-----------------------------------------
Confidence            778888999999999999999999999988885555433                                         


Q ss_pred             hhhhhccCccccccCcCCCCCHHHHHHhcCCHHHHHHHHHcCCCCCC---CCCcHHHHHHHcC-cHHHHHHHHHCCCCCC
Q psy903          481 ASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIEL---GASTPLMEAAQEG-HLELVRYLLDSGAQVH  556 (739)
Q Consensus       481 ~~~l~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~~~~~~~---~~~t~L~~A~~~~-~~~~v~~Ll~~g~~~~  556 (739)
                                        +.||||.++..++..+++.++++|++++.   .|.||+|+|+..| ..++...+++.|.+++
T Consensus       407 ------------------gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~g~~~n  468 (1143)
T KOG4177|consen  407 ------------------GVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQYGADPN  468 (1143)
T ss_pred             ------------------CcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhhHhhcCCCcc
Confidence                              34666666666777777777777777643   5778888888887 7777777778888888


Q ss_pred             CCCCCCCcHHHHHHHcCcHHHHHHHHhCCCCC-----CCCcHHHHHHHcCCHHHHHHHhhCCCCCCcCCCCCCcHHHHHH
Q psy903          557 AKTQTGDTALTYACENGHTDVADLLLSYGANL-----DNSTMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYAC  631 (739)
Q Consensus       557 ~~d~~g~t~l~~A~~~~~~~iv~~Ll~~~~~~-----~~~~~l~~A~~~~~~~~v~~L~~~~~~~~~~~~~g~t~l~~A~  631 (739)
                      ..-..|.||||+|+..|+.++++.|++.++..     .+-+++|.|...+...+++.+++.|++++.++..|.||||.|+
T Consensus       469 ~~s~~G~T~Lhlaaq~Gh~~~~~llle~~~~~~~~~~~~l~~lhla~~~~~v~~~~~l~~~ga~v~~~~~r~~TpLh~A~  548 (1143)
T KOG4177|consen  469 AVSKQGFTPLHLAAQEGHTEVVQLLLEGGANDNLDAKKGLTPLHLAADEDTVKVAKILLEHGANVDLRTGRGYTPLHVAV  548 (1143)
T ss_pred             hhccccCcchhhhhccCCchHHHHhhhcCCccCccchhccchhhhhhhhhhHHHHHHHhhcCCceehhcccccchHHHHH
Confidence            88888888888888888888888888877433     2667888888888888888888888888888888888888888


Q ss_pred             HcCCHHHHHHHHHcCCC-----CCCchHHHHHHhCCChhHHHHHhcCCCcccCCCCCCCCCCCchhhhccCCCcccccCC
Q psy903          632 ENGHTDVADLLLSYGAN-----LDNSTMLIEAAKGGHANVVQLLLDFPRSVIGGSLSSPSDDSSSHLCSQGKKSGVHAKT  706 (739)
Q Consensus       632 ~~~~~~~v~~L~~~~~~-----~~~~~~L~~A~~~g~~~~v~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  706 (739)
                      ..|+.++|++|+++|++     ..|.||||.|+..|+.+++..|+++++++                         |..|
T Consensus       549 ~~g~v~~VkfLLe~gAdv~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~GA~v-------------------------na~d  603 (1143)
T KOG4177|consen  549 HYGNVDLVKFLLEHGADVNAKDKLGYTPLHQAAQQGHNDIAELLLKHGASV-------------------------NAAD  603 (1143)
T ss_pred             hcCCchHHHHhhhCCccccccCCCCCChhhHHHHcChHHHHHHHHHcCCCC-------------------------Cccc
Confidence            88888888888888876     45778888888888888888888877665                         7788


Q ss_pred             CCCchHHHHHHHcCcHHHHHHHHHcCCC
Q psy903          707 QTGDTALTYACENGHTDVADLLLSYGAN  734 (739)
Q Consensus       707 ~~g~t~l~~A~~~~~~~i~~~L~~~ga~  734 (739)
                      .+|.|||++|+..|+++++++|+..|++
T Consensus       604 ~~g~TpL~iA~~lg~~~~~k~l~~~~~~  631 (1143)
T KOG4177|consen  604 LDGFTPLHIAVRLGYLSVVKLLKVVTAT  631 (1143)
T ss_pred             ccCcchhHHHHHhcccchhhHHHhccCc
Confidence            8888888888888888888888888877



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query739
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-27
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-25
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-19
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-10
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-23
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-21
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-19
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-11
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-21
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-21
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-18
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-12
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-21
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-16
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-21
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-21
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-20
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-21
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-19
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-21
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-19
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-12
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-20
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-06
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-20
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-17
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-14
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-20
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-19
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-20
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-16
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-20
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-16
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-20
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-17
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-15
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 6e-20
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-16
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-19
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-19
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-15
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-19
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-13
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-19
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-19
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-19
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-18
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-13
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-19
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-14
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-19
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-17
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-14
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 8e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-18
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-05
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-18
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-12
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-18
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-17
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-13
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-17
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-14
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-17
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-13
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-17
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 4e-17
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-11
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-07
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 9e-17
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-07
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 4e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-16
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-11
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-16
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-11
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-16
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-11
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-16
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-14
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-09
1uoh_A226 Human Gankyrin Length = 226 3e-16
1uoh_A226 Human Gankyrin Length = 226 4e-14
1uoh_A226 Human Gankyrin Length = 226 2e-09
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-16
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-11
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 9e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 9e-16
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-13
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-15
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-12
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-15
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-09
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-15
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-11
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 4e-15
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 8e-12
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-05
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 8e-15
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-11
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-14
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 9e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-14
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-11
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-14
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-14
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 9e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-13
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-10
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 4e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-13
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-13
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-13
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 4e-13
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-11
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-08
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-13
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-11
3so8_A162 Crystal Structure Of Ankra Length = 162 3e-08
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-13
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-11
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 3e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 5e-13
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-10
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 3e-05
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-12
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 7e-12
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-09
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-07
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 5e-11
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-09
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 6e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 8e-11
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-09
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 5e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 4e-10
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 3e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 3e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-10
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-09
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-10
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-09
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 5e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-09
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-06
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-09
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-07
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 6e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 4e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 6e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 4e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 7e-09
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-08
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-07
2xen_A91 Structural Determinants For Improved Thermal Stabil 7e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-07
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-08
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 3e-06
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-08
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 3e-08
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 2e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-08
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 7e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 7e-08
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-05
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 9e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 7e-08
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 9e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 3e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-07
1ycs_B239 P53-53bp2 Complex Length = 239 1e-06
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 2e-06
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-06
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-06
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 2e-06
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 3e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 1e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 9e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-05
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 3e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 3e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 3e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 5e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 3e-04
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 3e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 4e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 4e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 122 bits (305), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 127/427 (29%), Positives = 188/427 (44%), Gaps = 53/427 (12%) Query: 191 CTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVE 250 TPL A+ G + IV+ L+ GA N + TPL A GH V + LL+ A V Sbjct: 15 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN 74 Query: 251 DHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLL 310 ++ TPL AA GH + K+LLE A N + + L +A +GH++ V LL Sbjct: 75 AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL-ATTAGHTPLHIAAREGHVETVLALL 133 Query: 311 SAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSI 370 A Q T + T L A+ G V VA+LLL+ A +A ++ P Sbjct: 134 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHP-NAAGKNGLTP---------- 182 Query: 371 SYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMH 430 L A ++ VK LL G S H G + L +A E+A+ LL Sbjct: 183 -------LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYG 235 Query: 431 ANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAK 490 + ++G TPL AA G + +S A + +KS GL ++ Sbjct: 236 GSANAESVQG-VTPLHLAAQEGHAEMVALLLSKQANGNL--GNKS--GLTPLHLV----- 285 Query: 491 INAHXXXXXXXXXXXXCCGGFLDVADFLLKNGANIELGAS---TPLMEAAQEGHLELVRY 547 G + VAD L+K+G ++ TPL A+ G+++LV++ Sbjct: 286 ----------------AQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKF 329 Query: 548 LLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANL-----DNSTMLIEAAKGGH 602 LL A V+AKT+ G + L A + GHTD+ LLL GA+ D +T L A + G+ Sbjct: 330 LLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGY 389 Query: 603 ANVVQLL 609 +V +L Sbjct: 390 ISVTDVL 396
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query739
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-119
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-116
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-115
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-104
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-88
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-85
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-75
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-62
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-53
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-77
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-75
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-69
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-61
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-59
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-58
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-50
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-48
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-71
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-62
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-59
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-56
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-55
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-41
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-71
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-70
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-62
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-59
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-57
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-46
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-70
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-62
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-62
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-58
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-57
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-57
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-54
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-54
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-52
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-51
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-21
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-68
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-61
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-59
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-58
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-57
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-54
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-43
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-40
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-32
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-65
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-56
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-56
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-52
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-50
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-47
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-47
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-35
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-62
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-61
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-56
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-52
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-51
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-49
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-59
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-58
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-56
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-56
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-48
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-48
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-45
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-42
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-59
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-57
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-56
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-50
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-48
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-47
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-44
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-32
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-57
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-51
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-47
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-43
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-36
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-29
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-14
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 2e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-56
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-55
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-55
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-54
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-52
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-52
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-52
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-50
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-46
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-42
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 8e-26
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-56
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-52
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-47
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-46
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-37
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-35
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-29
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-16
3v30_A 172 DNA-binding protein rfxank; structural genomics co 3e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-56
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-49
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-46
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-40
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-39
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-27
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-26
3hra_A 201 Ankyrin repeat family protein; structural protein; 3e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-55
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-53
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-50
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-47
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-46
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-45
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-41
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-33
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-54
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-53
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-53
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-50
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-49
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-48
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-46
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-45
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-54
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-52
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-51
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-49
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-47
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-44
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-42
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-38
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-54
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-52
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-51
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-45
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-44
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-43
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-37
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-37
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-43
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-42
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-41
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-39
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-33
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-29
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-52
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-45
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-43
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-37
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-35
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-24
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-51
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-46
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-43
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-42
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-37
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-35
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-28
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-22
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-50
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-44
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-43
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-40
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-37
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-50
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-44
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-41
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-28
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-28
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-42
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-41
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-38
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-33
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-33
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-32
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-28
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-48
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-46
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-46
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-43
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-43
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-42
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-36
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-32
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-27
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-48
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-46
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-44
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-43
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-43
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-35
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-33
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-29
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-48
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-43
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-39
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-37
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-29
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-47
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-44
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-42
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-25
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-46
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-39
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-38
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-33
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-32
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-45
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-32
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-32
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-32
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-44
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-38
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-35
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-34
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-23
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-44
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-41
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-32
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-23
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-44
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-42
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-38
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-29
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-29
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-43
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-40
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-33
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-33
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-25
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-43
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-37
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-34
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-31
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-42
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-41
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-38
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-29
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-27
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-26
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-42
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-41
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-39
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-32
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-31
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-25
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-20
2rfa_A232 Transient receptor potential cation channel subfa 3e-40
2rfa_A232 Transient receptor potential cation channel subfa 8e-40
2rfa_A232 Transient receptor potential cation channel subfa 1e-37
2rfa_A232 Transient receptor potential cation channel subfa 3e-32
2rfa_A232 Transient receptor potential cation channel subfa 3e-29
2rfa_A232 Transient receptor potential cation channel subfa 9e-27
2rfa_A232 Transient receptor potential cation channel subfa 9e-27
2rfa_A232 Transient receptor potential cation channel subfa 2e-20
2rfa_A 232 Transient receptor potential cation channel subfa 7e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-37
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-36
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-27
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-05
2etb_A256 Transient receptor potential cation channel subfam 7e-38
2etb_A256 Transient receptor potential cation channel subfam 6e-31
2etb_A256 Transient receptor potential cation channel subfam 2e-28
2etb_A256 Transient receptor potential cation channel subfam 5e-25
2etb_A256 Transient receptor potential cation channel subfam 2e-23
2etb_A256 Transient receptor potential cation channel subfam 4e-21
2etb_A 256 Transient receptor potential cation channel subfam 8e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-37
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-37
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-37
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-37
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-36
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-31
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-36
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-36
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-31
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-29
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-33
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-32
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-30
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-29
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-32
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-32
2pnn_A273 Transient receptor potential cation channel subfa 9e-30
2pnn_A273 Transient receptor potential cation channel subfa 2e-29
2pnn_A273 Transient receptor potential cation channel subfa 4e-28
2pnn_A273 Transient receptor potential cation channel subfa 3e-26
2pnn_A273 Transient receptor potential cation channel subfa 4e-26
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-30
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-27
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-28
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-27
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-23
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-22
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-20
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-15
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-14
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-08
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  363 bits (935), Expect = e-119
 Identities = 128/501 (25%), Positives = 185/501 (36%), Gaps = 88/501 (17%)

Query: 180 ANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVV 239
            +    G  G  TPL  A+  G + IV+ L+  GA  N  +    TPL  A   GH  V 
Sbjct: 5   ISGGGGGESG-LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVA 63

Query: 240 RVLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACY 299
           + LL+  A V    ++  TPL  AA  GH  + K+LLE  A  N  +     + L +A  
Sbjct: 64  KYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTA-GHTPLHIAAR 122

Query: 300 KGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFF 359
           +GH++ V  LL   A Q   T +  T L  A+  G V VA+LLL+  A            
Sbjct: 123 EGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH----------- 171

Query: 360 PNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGY 419
                                                    +     G + L +A     
Sbjct: 172 ----------------------------------------PNAAGKNGLTPLHVAVHHNN 191

Query: 420 YELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGL 479
            ++ ++LL    +       G  TPL  AA           V                  
Sbjct: 192 LDIVKLLLPRGGSPHSPAWNG-YTPLHIAAKQN-----QVEV------------------ 227

Query: 480 QASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGAS---TPLMEA 536
            A  +L  G   NA + +   T L LA   G  ++   LL   AN  LG     TPL   
Sbjct: 228 -ARSLLQYGGSANAESVQ-GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLV 285

Query: 537 AQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANL-----DNS 591
           AQEGH+ +   L+  G  V A T+ G T L  A   G+  +   LL + A++        
Sbjct: 286 AQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGY 345

Query: 592 TMLIEAAKGGHANVVQLLLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDN 651
           + L +AA+ GH ++V LLL    S +  +  G T L  A   G+  V D+L         
Sbjct: 346 SPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSF 405

Query: 652 STMLIEAAKGGHANVVQLLLD 672
              + +  +      V  +LD
Sbjct: 406 VL-VSDKHRMSFPETVDEILD 425


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query739
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.64
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-60  Score=493.96  Aligned_cols=395  Identities=28%  Similarity=0.335  Sum_probs=340.0

Q ss_pred             cCCCCcccCCCCCcHHHHHHhcCcHHHHHHHHHccccccccCCCCCcchhHHHhhccccccccCCCCCCCHHHHHhhhhh
Q psy903           20 EGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKLATGDGKLADPEVLRRLTSS   99 (739)
Q Consensus        20 ~g~~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~ga~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~   99 (739)
                      .|++++..+..|+||||+|+..|+.++|++|+++|++++..+..+. ||||+|+..                        
T Consensus         3 ~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~-t~L~~A~~~------------------------   57 (437)
T 1n11_A            3 PGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVE-TPLHMAARA------------------------   57 (437)
T ss_dssp             ------------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCC-CHHHHHHHH------------------------
T ss_pred             CCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCC-CHHHHHHHc------------------------
Confidence            5889999999999999999999999999999999999988776664 666666654                        


Q ss_pred             hhchHHHHHHHHHhhhcCCCCCCCchHHHHHHHcCCHHHHHHHHhcCCCCCcCCCCCCcHHHHHHHcCcHHHHHHHHhCC
Q psy903          100 VSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMH  179 (739)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~A~~~~~~~~~~~ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~  179 (739)
                                                        |+.+++++|++.|++++..+..|.||||+|+..|+.+++++|+++|
T Consensus        58 ----------------------------------g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g  103 (437)
T 1n11_A           58 ----------------------------------GHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENN  103 (437)
T ss_dssp             ----------------------------------TCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHT
T ss_pred             ----------------------------------CCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCC
Confidence                                              5799999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCCCCCCCCCcHHHHHHhcCcHHHHHHHHHCCCCCCCCCCCCCcH
Q psy903          180 ANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVEDHNENGHTP  259 (739)
Q Consensus       180 ~~~~~~~~~~~~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~t~  259 (739)
                      ++++..+.. |.||||+|+..|+.+++++|++++++++..+..|.||||+|+..|+.+++++|+++|++++..+..|.||
T Consensus       104 a~~~~~~~~-g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~  182 (437)
T 1n11_A          104 ANPNLATTA-GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTP  182 (437)
T ss_dssp             CCTTCCCTT-CCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCH
T ss_pred             CCCCCCCCC-CCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCH
Confidence            998877655 5699999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCChHHHHHHHHcCCCCcccCcCccCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCcCCcHHHHHHhCCchHHH
Q psy903          260 LMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKTDEMHTALMEASMDGHVEVA  339 (739)
Q Consensus       260 L~~A~~~~~~~ii~~Ll~~~~~~~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~l~~a~~~~~~~~~  339 (739)
                      ||+|+..|+.+++++|+++|.++... +..+.|||++|+..++.+++++|++.|++++..+..|.|||++|+..++.+++
T Consensus       183 L~~A~~~~~~~~v~~Ll~~g~~~~~~-~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v  261 (437)
T 1n11_A          183 LHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMV  261 (437)
T ss_dssp             HHHHHHTTCHHHHHHHGGGTCCSCCC-CTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHH
T ss_pred             HHHHHHcCCHHHHHHHHhCCCCCCCc-CCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHCCCHHHH
Confidence            99999999999999999999988764 44589999999999999999999999999999999999999999998888888


Q ss_pred             HHHHHcCCCchhhhcccCCCCCCCCCCCCCcccccchHHHHHHhcCCHHHHHHHHHCCCCCccCCCCCCCHHHHHHHcCc
Q psy903          340 KLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGY  419 (739)
Q Consensus       340 ~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~l~~a~~~~~  419 (739)
                      ++|++++++                                                   ++..+..|.||||.|+..++
T Consensus       262 ~~Ll~~~~~---------------------------------------------------~~~~~~~g~t~L~~A~~~~~  290 (437)
T 1n11_A          262 ALLLSKQAN---------------------------------------------------GNLGNKSGLTPLHLVAQEGH  290 (437)
T ss_dssp             HHHHTTTCC---------------------------------------------------TTCCCTTCCCHHHHHHHHTC
T ss_pred             HHHHhcCCC---------------------------------------------------CCCCCCCCCCHHHHHHHcCC
Confidence            887765543                                                   55677889999999999999


Q ss_pred             HHHHHHHHHcCCCcccccCCCCCcHHHHHHHcCCccchhhHHHhhhccCCCCCCcccccchhhhhhccCccccccCcCCC
Q psy903          420 YELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKINAHTEETQ  499 (739)
Q Consensus       420 ~~~v~~Ll~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~  499 (739)
                      .+++++|++++.+++..+..                                                           +
T Consensus       291 ~~~~~~Ll~~g~~~~~~~~~-----------------------------------------------------------g  311 (437)
T 1n11_A          291 VPVADVLIKHGVMVDATTRM-----------------------------------------------------------G  311 (437)
T ss_dssp             HHHHHHHHHHTCCTTCCCSS-----------------------------------------------------------C
T ss_pred             HHHHHHHHhCCccCCCCCCC-----------------------------------------------------------C
Confidence            99999999988877655432                                                           4


Q ss_pred             CCHHHHHHhcCCHHHHHHHHHcCCCCCC---CCCcHHHHHHHcCcHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCcHH
Q psy903          500 ETALTLACCGGFLDVADFLLKNGANIEL---GASTPLMEAAQEGHLELVRYLLDSGAQVHAKTQTGDTALTYACENGHTD  576 (739)
Q Consensus       500 ~~~l~~a~~~~~~~~v~~Ll~~~~~~~~---~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~d~~g~t~l~~A~~~~~~~  576 (739)
                      .||||+|+..|+.+++++|+++|++++.   .|.||||+|+..|+.+++++|+++|++++.+|.+|.||+++|.+.|+.+
T Consensus       312 ~t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~  391 (437)
T 1n11_A          312 YTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYIS  391 (437)
T ss_dssp             CCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHH
T ss_pred             CCHHHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHH
Confidence            5777777777888888888888887743   5788999999999999999999999999888888999999998888888


Q ss_pred             HHHHHHhCC
Q psy903          577 VADLLLSYG  585 (739)
Q Consensus       577 iv~~Ll~~~  585 (739)
                      ++++|....
T Consensus       392 ~~~~l~~~~  400 (437)
T 1n11_A          392 VTDVLKVVT  400 (437)
T ss_dssp             HHHHHHHHC
T ss_pred             HHHHHHhcc
Confidence            888876543



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 739
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-67
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-57
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-49
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-45
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-44
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-30
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-24
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-34
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-31
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-30
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-29
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-19
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-33
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-30
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-28
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-26
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-32
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-23
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-23
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-23
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-22
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-21
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-21
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-16
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-22
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-19
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-18
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-21
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-15
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-15
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-16
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.004
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-17
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-12
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-09
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-16
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-12
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-10
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 6e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-15
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-14
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-12
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-14
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-06
d1ihba_ 156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-11
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-10
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-08
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 1e-06
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 4e-06
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 3e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 5e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  224 bits (572), Expect = 6e-67
 Identities = 129/457 (28%), Positives = 185/457 (40%), Gaps = 76/457 (16%)

Query: 192 TPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVRVLLECGANVED 251
           TPL  A+  G + IV+ L+  GA  N  +    TPL  A   GH  V + LL+  A V  
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 252 HNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLS 311
             ++  TPL  AA  GH  + K+LLE  A  N  +       L +A  +GH++ V  LL 
Sbjct: 62  KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHT-PLHIAAREGHVETVLALLE 120

Query: 312 AGADQEHKTDEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSIS 371
             A Q   T +  T L  A+  G V VA+LLL+  A   +A  ++   P           
Sbjct: 121 KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTP----------- 168

Query: 372 YTYSRSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHA 431
                 L  A    ++  VK LL  G S H     G + L +A      E+A+ LL    
Sbjct: 169 ------LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGG 222

Query: 432 NVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQASVILIPGAKI 491
           +     ++G  TPL  AA    Q    E V+         N  + +G             
Sbjct: 223 SANAESVQG-VTPLHLAA----QEGHAEMVALLLSKQANGNLGNKSG------------- 264

Query: 492 NAHTEETQETALTLACCGGFLDVADFLLKNGANIELGAS---TPLMEAAQEGHLELVRYL 548
                    T L L    G + VAD L+K+G  ++       TPL  A+  G+++LV++L
Sbjct: 265 --------LTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL 316

Query: 549 LDSGAQVHAKTQTGDTALTYACENGHTDVADLLLSYGANLDNSTMLIEAAKGGHANVVQL 608
           L   A V+AKT+ G + L  A + GHTD+  LLL  GA+                     
Sbjct: 317 LQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS--------------------- 355

Query: 609 LLDFPRSVHAKTQTGDTALTYACENGHTDVADLLLSY 645
                   +  +  G T L  A   G+  V D+L   
Sbjct: 356 -------PNEVSSDGTTPLAIAKRLGYISVTDVLKVV 385


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query739
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.8e-49  Score=404.04  Aligned_cols=377  Identities=32%  Similarity=0.391  Sum_probs=208.8

Q ss_pred             ChhhhhhcCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHhcCcHHHHHHHHHccccccccCCCCCcchhHHHhhcccccc
Q psy903            1 SLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFGKL   80 (739)
Q Consensus         1 ~L~~A~~~g~~~~v~~ll~~g~~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~ga~~~~~~~~~~~t~l~~a~~~~~~~~   80 (739)
                      |||.||..|++++|++|++.|+++|.+|..|+||||+|+..|+.++|++|+++|++++..+..|. ||||+|+..|    
T Consensus         3 pL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~-t~L~~A~~~g----   77 (408)
T d1n11a_           3 PLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ-TPLHCAARIG----   77 (408)
T ss_dssp             HHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSC-CHHHHHHHHT----
T ss_pred             hHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCC-CHHHHHHHcC----
Confidence            45555555555555555555555555555555555555555555555555555555555444332 4444333322    


Q ss_pred             ccCCCCCCCHHHHHhhhhhhhchHHHHHHHHHhhhcCCCCCCCchHHHHHHHcCCHHHHHHHHhcCCCCCcCCCCCCcHH
Q psy903           81 ATGDGKLADPEVLRRLTSSVSCALDEAAAALTRMRNENPRPQNERSLVQACSDGDVKTVKKLLTEGRSVHETTDEGESLL  160 (739)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~A~~~~~~~~~~~ll~~~~~~~~~~~~g~t~L  160 (739)
                                                                            +.+++++|++.+.+.........+++
T Consensus        78 ------------------------------------------------------~~~~~~~Ll~~~~~~~~~~~~~~~~~  103 (408)
T d1n11a_          78 ------------------------------------------------------HTNMVKLLLENNANPNLATTAGHTPL  103 (408)
T ss_dssp             ------------------------------------------------------CHHHHHHHHHHTCCTTCCCTTCCCHH
T ss_pred             ------------------------------------------------------CHHHHHHHHHhhhccccccccccchh
Confidence                                                                  34445555554444444444444555


Q ss_pred             HHHHHcCcHHHHHHHHhCCCCccccCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCCCCCCCCCcHHHHHHhcCcHHHHH
Q psy903          161 SLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGFIEIVRLLINHGADVNGQSSSGNTPLMYACAGGHEAVVR  240 (739)
Q Consensus       161 ~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~L~~A~~~~~~~~v~  240 (739)
                      ..+...+...........+......+.. +.++++.|+..++.+++++|+++|++++..+..|.+|||+|+..|+.++++
T Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~L~~A~~~~~~~~~~  182 (408)
T d1n11a_         104 HIAAREGHVETVLALLEKEASQACMTKK-GFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVK  182 (408)
T ss_dssp             HHHHHHTCHHHHHHHHHTTCCSCCCCTT-SCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHH
T ss_pred             hhhhhhcccccccccccccccccccccc-cchHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCchHHHHHHHcCCHHHHH
Confidence            5555555544444444444443333222 235555555555555555555555555555555555555555555555555


Q ss_pred             HHHHCCCCCCCCCCCCCcHHHHHHhcCChHHHHHHHHcCCCCcccCcCccCCHHHHHHHcCCHHHHHHHHHcCCCCCCCC
Q psy903          241 VLLECGANVEDHNENGHTPLMEAASAGHVGVAKILLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLSAGADQEHKT  320 (739)
Q Consensus       241 ~Ll~~~~~~~~~~~~~~t~L~~A~~~~~~~ii~~Ll~~~~~~~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~  320 (739)
                      +|+++|++++..+..|.||++.++.....++...++..+...... +..+.||++.|+..++.++++++.+.+...+..+
T Consensus       183 ~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~-~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~  261 (408)
T d1n11a_         183 LLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAE-SVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGN  261 (408)
T ss_dssp             HHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCC-CTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCC
T ss_pred             HHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhcccccccc-CCCCCCHHHHHHHhCcHhHhhhhhcccccccccc
Confidence            555555555555555555555555555555544444444333322 2224444444444444444444444444444444


Q ss_pred             CcCCcHHHHHHhCCchHHHHHHHHcCCCchhhhcccCCCCCCCCCCCCCcccccchHHHHHHhcCCHHHHHHHHHCCCCC
Q psy903          321 DEMHTALMEASMDGHVEVAKLLLDSGAQSVSAYARHDFFPNDKCERPSSISYTYSRSLVQACSDGDVKTVKKLLTEGRSV  400 (739)
Q Consensus       321 ~~~~~~l~~a~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~  400 (739)
                      .                                                                               
T Consensus       262 ~-------------------------------------------------------------------------------  262 (408)
T d1n11a_         262 K-------------------------------------------------------------------------------  262 (408)
T ss_dssp             T-------------------------------------------------------------------------------
T ss_pred             C-------------------------------------------------------------------------------
Confidence            4                                                                               


Q ss_pred             ccCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCcccccCCCCCcHHHHHHHcCCccchhhHHHhhhccCCCCCCcccccch
Q psy903          401 HETTDEGESLLSLACSAGYYELAQVLLAMHANVEDRGIKGECTPLMEAASSGRQCNLNESVSAYARHDFFPNDKSVNGLQ  480 (739)
Q Consensus       401 ~~~~~~~~t~l~~a~~~~~~~~v~~Ll~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (739)
                           .|.+|++.++..++.+++++|+++|++++.....                                         
T Consensus       263 -----~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~-----------------------------------------  296 (408)
T d1n11a_         263 -----SGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRM-----------------------------------------  296 (408)
T ss_dssp             -----TCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSS-----------------------------------------
T ss_pred             -----CCCChhhhhhhcCcHHHHHHHHHCCCcccccccc-----------------------------------------
Confidence                 4445555555555555555555555444433221                                         


Q ss_pred             hhhhhccCccccccCcCCCCCHHHHHHhcCCHHHHHHHHHcCCCC---CCCCCcHHHHHHHcCcHHHHHHHHHCCCCCCC
Q psy903          481 ASVILIPGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANI---ELGASTPLMEAAQEGHLELVRYLLDSGAQVHA  557 (739)
Q Consensus       481 ~~~l~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~~~~~---~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~  557 (739)
                                        +.+||+.++..++.++++++++.|.++   +..|.||||.|++.|+.++|++|+++|++++.
T Consensus       297 ------------------~~t~L~~~~~~~~~~~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~  358 (408)
T d1n11a_         297 ------------------GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE  358 (408)
T ss_dssp             ------------------CCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCC
T ss_pred             ------------------ccccchhhcccCcceeeeeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCC
Confidence                              124444444445555555555555544   33578999999999999999999999999999


Q ss_pred             CCCCCCcHHHHHHHcCcHHHHHHH
Q psy903          558 KTQTGDTALTYACENGHTDVADLL  581 (739)
Q Consensus       558 ~d~~g~t~l~~A~~~~~~~iv~~L  581 (739)
                      +|.+|+||||+|++.|+.++|++|
T Consensus       359 ~d~~G~t~L~~A~~~~~~~iv~~L  382 (408)
T d1n11a_         359 VSSDGTTPLAIAKRLGYISVTDVL  382 (408)
T ss_dssp             CCSSSCCHHHHHHHTTCHHHHHHH
T ss_pred             CCCCCCCHHHHHHHcCCHHHHHHH
Confidence            999999999999999999988865



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure