Psyllid ID: psy9274

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MNVPERDVMGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYCKGGEREVHEEEEEEEEEEEETKAKETKLKEKKKLGGGGGEEEEEEEEEEEEEEEEEEEIGGVVVSAVDFGSGGWWFES
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHEEEccEEccccccccccHHHHHHHcccccccEEcEEEEEEEEcccccccccc
ccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEccc
mnvperdvmgkgIVDIQHHYATCnisyneynrsnipaicrnfsheyindndvDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCvpftatdyvttcwpfgdvWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVpvfnmhgeVSYTYASELHTACVfldldpvnrpdgynktifqsendyckggerevheeeeeeeEEEEETKAKETKLKEkkklgggggeeeeeeeeeeeeeeeeeeeiGGVVVSAVdfgsggwwfes
mnvperdvmgkGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYCKGGErevheeeeeeeeeeeetkaketklkekkklgggggeeeeeeeeeeeeeeeeeeeiggvvvsAVDFGSGGWWFES
MNVPERDVMGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSiivpiffgiiiilgffgNALVVVVVAFNQQMRSTTnlliinlaiadllfiVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYCkggerevheeeeeeeeeeeetkaketklkekkklgggggeeeeeeeeeeeeeeeeeeeiggVVVSAVDFGSGGWWFES
********MGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQ************************************************************************************
**VPERDVMGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYCKGGE**********************************************************VVSAVDFGSGGWWFE*
********MGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYC***********************************************************GGVVVSAVDFGSGGWWFES
*NVPERDVMGKGIVDIQHHYATCNISYN**************************EAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYCKGGEREV**************************************************EIGGVVVSAVDFGSG******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVPERDVMGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKMYLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQSENDYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGGxxxxxxxxxxxxxxxxxxxxxxxxGVVVSAVDFGSGGWWFES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
Q8WPA2361 Allatostatin-A receptor O N/A N/A 0.597 0.526 0.603 2e-59
O88626370 Galanin receptor type 3 O yes N/A 0.449 0.386 0.453 7e-30
O88854371 Galanin receptor type 2 O yes N/A 0.477 0.409 0.435 2e-29
O08726372 Galanin receptor type 2 O yes N/A 0.477 0.408 0.435 2e-29
O60755368 Galanin receptor type 3 O yes N/A 0.493 0.426 0.408 4e-29
O43603 387 Galanin receptor type 2 O no N/A 0.477 0.392 0.428 2e-28
O88853370 Galanin receptor type 3 O no N/A 0.449 0.386 0.44 3e-28
Q924U1396 KiSS-1 receptor OS=Rattus no N/A 0.512 0.411 0.365 2e-25
Q91V45396 KiSS-1 receptor OS=Mus mu no N/A 0.512 0.411 0.365 6e-25
Q969F8398 KiSS-1 receptor OS=Homo s no N/A 0.477 0.381 0.370 7e-24
>sp|Q8WPA2|AR_BOMMO Allatostatin-A receptor OS=Bombyx mori GN=AR PE=2 SV=1 Back     alignment and function desciption
 Score =  229 bits (584), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 151/207 (72%), Gaps = 17/207 (8%)

Query: 38  ICRNFSHE--------YINDNDVDAEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAF 89
           IC N + E        Y  D + + E +E++VS +VPIFFG I I+G  GNALVV+VVA 
Sbjct: 11  ICLNLTAEDPSFGNCNYTTDFE-NGELLEKVVSRVVPIFFGFIGIVGLVGNALVVLVVAA 69

Query: 90  NQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKM--YLIVVTAYAS 147
           N  MRSTTNLLIINLA+ADLLF++ CVPFTATDYV   WPFGD WCK+  Y IVVTA+AS
Sbjct: 70  NPGMRSTTNLLIINLAVADLLFVIFCVPFTATDYVMPRWPFGDWWCKVVQYFIVVTAHAS 129

Query: 148 VYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYA 207
           VYTLVLMSLDRF+AVVHPIASMS+RTE+NAL AI   W+VI+ TA+PV   HGE  Y+Y 
Sbjct: 130 VYTLVLMSLDRFMAVVHPIASMSIRTEKNALLAIACIWVVILTTAIPVGICHGEREYSYF 189

Query: 208 SELHTACVFLDLDPVNRPDGYNKTIFQ 234
           +  H++CVFL+        GY+K  FQ
Sbjct: 190 NRNHSSCVFLE------ERGYSKLGFQ 210
Acts as a receptor for A-type allatostatin neuropeptide hormones.
Bombyx mori (taxid: 7091)
>sp|O88626|GALR3_RAT Galanin receptor type 3 OS=Rattus norvegicus GN=Galr3 PE=2 SV=1 Back     alignment and function description
>sp|O88854|GALR2_MOUSE Galanin receptor type 2 OS=Mus musculus GN=Galr2 PE=2 SV=2 Back     alignment and function description
>sp|O08726|GALR2_RAT Galanin receptor type 2 OS=Rattus norvegicus GN=Galr2 PE=2 SV=1 Back     alignment and function description
>sp|O60755|GALR3_HUMAN Galanin receptor type 3 OS=Homo sapiens GN=GALR3 PE=2 SV=1 Back     alignment and function description
>sp|O43603|GALR2_HUMAN Galanin receptor type 2 OS=Homo sapiens GN=GALR2 PE=2 SV=1 Back     alignment and function description
>sp|O88853|GALR3_MOUSE Galanin receptor type 3 OS=Mus musculus GN=Galr3 PE=2 SV=2 Back     alignment and function description
>sp|Q924U1|KISSR_RAT KiSS-1 receptor OS=Rattus norvegicus GN=Kiss1r PE=2 SV=2 Back     alignment and function description
>sp|Q91V45|KISSR_MOUSE KiSS-1 receptor OS=Mus musculus GN=Kiss1r PE=1 SV=1 Back     alignment and function description
>sp|Q969F8|KISSR_HUMAN KiSS-1 receptor OS=Homo sapiens GN=KISS1R PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
14028711 423 allatostatin receptor [Periplaneta ameri 0.694 0.522 0.646 1e-79
328704431375 PREDICTED: allatostatin-A receptor-like 0.578 0.490 0.715 1e-70
210076540361 Sl allatostatin A receptor [Spodoptera l 0.575 0.506 0.632 3e-58
112983160361 allatostatin-A receptor [Bombyx mori] gi 0.597 0.526 0.603 1e-57
312372534306 hypothetical protein AND_20025 [Anophele 0.792 0.823 0.475 3e-57
195393440 424 GJ19325 [Drosophila virilis] gi|19414987 0.591 0.443 0.594 3e-54
194887814397 GG18661 [Drosophila erecta] gi|190648459 0.603 0.483 0.580 3e-54
195047863 436 GH24210 [Drosophila grimshawi] gi|193893 0.591 0.431 0.594 3e-54
195340964394 GM12299 [Drosophila sechellia] gi|195564 0.603 0.487 0.580 3e-54
195477322394 GE16306 [Drosophila yakuba] gi|194187689 0.603 0.487 0.580 3e-54
>gi|14028711|gb|AAK52473.1|AF336364_1 allatostatin receptor [Periplaneta americana] Back     alignment and taxonomy information
 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 152/235 (64%), Positives = 186/235 (79%), Gaps = 14/235 (5%)

Query: 9   MGKGIVDIQHHYATCNISYNEYNRSNIPAICRNFSHEYINDNDVDA-------EAMERMV 61
           +G GI  +++H A  NIS N    S + A C N S E +N   +D        + ++++V
Sbjct: 13  LGVGIGGLRYH-ACVNISVNT---SELSAFCSN-SSEQLNGYGLDPPPEPQSLQLIQKIV 67

Query: 62  SIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTAT 121
           SI+VP+ FG+I+++G FGNALVV+VVA NQQMRSTTNLLIINLA+ADLLFIV CVPFTAT
Sbjct: 68  SIVVPLLFGLIVLVGLFGNALVVLVVAANQQMRSTTNLLIINLAVADLLFIVFCVPFTAT 127

Query: 122 DYVTTCWPFGDVWCKM--YLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALK 179
           DYV   WPFGD+WCK+  YLIVVTAYASVYTLVLMSLDRFLAVVHPI SMS+RTERNA+ 
Sbjct: 128 DYVLPFWPFGDIWCKIVQYLIVVTAYASVYTLVLMSLDRFLAVVHPITSMSIRTERNAIA 187

Query: 180 AILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVFLDLDPVNRPDGYNKTIFQ 234
           AI +TW+VI+L +VPV+  HGEV+YTY+S  HTACVFL+ DP+NRPDGYNK +FQ
Sbjct: 188 AIAVTWVVILLASVPVYLSHGEVTYTYSSAEHTACVFLEADPINRPDGYNKPVFQ 242

Source: Periplaneta americana

Species: Periplaneta americana

Genus: Periplaneta

Family: Blattidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328704431|ref|XP_001952361.2| PREDICTED: allatostatin-A receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|210076540|gb|ACJ06649.1| Sl allatostatin A receptor [Spodoptera littoralis] Back     alignment and taxonomy information
>gi|112983160|ref|NP_001037035.1| allatostatin-A receptor [Bombyx mori] gi|75018194|sp|Q8WPA2.1|AR_BOMMO RecName: Full=Allatostatin-A receptor; Short=BAR gi|12005811|gb|AAG44631.1|AF254742_1 allatostatin receptor [Bombyx mori] gi|17864791|gb|AAL47056.1| allatostatin receptor BAR [Bombyx mori] Back     alignment and taxonomy information
>gi|312372534|gb|EFR20477.1| hypothetical protein AND_20025 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195393440|ref|XP_002055362.1| GJ19325 [Drosophila virilis] gi|194149872|gb|EDW65563.1| GJ19325 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194887814|ref|XP_001976810.1| GG18661 [Drosophila erecta] gi|190648459|gb|EDV45737.1| GG18661 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195047863|ref|XP_001992426.1| GH24210 [Drosophila grimshawi] gi|193893267|gb|EDV92133.1| GH24210 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195340964|ref|XP_002037082.1| GM12299 [Drosophila sechellia] gi|195564929|ref|XP_002106061.1| GD16646 [Drosophila simulans] gi|194131198|gb|EDW53241.1| GM12299 [Drosophila sechellia] gi|194203431|gb|EDX17007.1| GD16646 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195477322|ref|XP_002100165.1| GE16306 [Drosophila yakuba] gi|194187689|gb|EDX01273.1| GE16306 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
UNIPROTKB|Q8WPA2361 AR "Allatostatin-A receptor" [ 0.610 0.537 0.5 6.6e-42
FB|FBgn0028961394 AlstR "Allatostatin Receptor" 0.663 0.535 0.454 1.1e-39
FB|FBgn0039595357 AR-2 "Allatostatin Receptor 2" 0.487 0.434 0.468 3.3e-31
WB|WBGene00013974 444 npr-9 [Caenorhabditis elegans 0.493 0.353 0.381 1e-24
ZFIN|ZDB-GENE-060526-54364 kiss1rb "KISS1 receptor b" [Da 0.430 0.376 0.392 3.1e-20
UNIPROTKB|F1N6V5278 GALR2 "Uncharacterized protein 0.421 0.482 0.367 7.5e-18
RGD|2658370 Galr3 "galanin receptor 3" [Ra 0.358 0.308 0.405 7.6e-18
UNIPROTKB|O60755368 GALR3 "Galanin receptor type 3 0.358 0.309 0.396 1.6e-17
UNIPROTKB|F1NBF2304 GALR3 "Uncharacterized protein 0.393 0.411 0.375 2e-17
UNIPROTKB|E2RNY2 387 GALR2 "Uncharacterized protein 0.421 0.346 0.375 2.7e-17
UNIPROTKB|Q8WPA2 AR "Allatostatin-A receptor" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
 Score = 444 (161.4 bits), Expect = 6.6e-42, P = 6.6e-42
 Identities = 102/204 (50%), Positives = 126/204 (61%)

Query:    34 NIPAICRNFSH-EYINDNDVDAEAMERMVSXXXXXXXXXXXXXXXXXNALVVVVVAFNQQ 92
             N+ A   +F +  Y  D + + E +E++VS                 NALVV+VVA N  
Sbjct:    14 NLTAEDPSFGNCNYTTDFE-NGELLEKVVSRVVPIFFGFIGIVGLVGNALVVLVVAANPG 72

Query:    93 MRSTTXXXXXXXXXXXXXXXVCCVPFTATDYVTTCWPFGDVWCKM--YLIVVTAYASVYT 150
             MRSTT               + CVPFTATDYV   WPFGD WCK+  Y IVVTA+ASVYT
Sbjct:    73 MRSTTNLLIINLAVADLLFVIFCVPFTATDYVMPRWPFGDWWCKVVQYFIVVTAHASVYT 132

Query:   151 LVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASEL 210
             LVLMSLDRF+AVVHPIASMS+RTE+NAL AI   W+VI+ TA+PV   HGE  Y+Y +  
Sbjct:   133 LVLMSLDRFMAVVHPIASMSIRTEKNALLAIACIWVVILTTAIPVGICHGEREYSYFNRN 192

Query:   211 HTACVFLDLDPVNRPDGYNKTIFQ 234
             H++CVFL+     R  GY+K  FQ
Sbjct:   193 HSSCVFLE----ER--GYSKLGFQ 210
GO:0042562 "hormone binding" evidence=IDA
GO:0042923 "neuropeptide binding" evidence=IDA
FB|FBgn0028961 AlstR "Allatostatin Receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039595 AR-2 "Allatostatin Receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00013974 npr-9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-54 kiss1rb "KISS1 receptor b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6V5 GALR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2658 Galr3 "galanin receptor 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60755 GALR3 "Galanin receptor type 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBF2 GALR3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNY2 GALR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 9e-37
PHA03087335 PHA03087, PHA03087, G protein-coupled chemokine re 3e-22
PHA02638417 PHA02638, PHA02638, CC chemokine receptor-like pro 2e-21
pfam10328275 pfam10328, 7TM_GPCR_Srx, Serpentine type 7TM GPCR 4e-10
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-09
PHA02834323 PHA02834, PHA02834, chemokine receptor-like protei 2e-08
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-08
pfam10320257 pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR 3e-07
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 7e-07
pfam05285 317 pfam05285, SDA1, SDA1 4e-06
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 6e-06
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-06
pfam07767 387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 9e-06
pfam03344 715 pfam03344, Daxx, Daxx Family 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-05
pfam05285 317 pfam05285, SDA1, SDA1 5e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-05
pfam05793 528 pfam05793, TFIIF_alpha, Transcription initiation f 6e-05
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 6e-05
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 8e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 9e-05
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 1e-04
pfam01271 585 pfam01271, Granin, Granin (chromogranin or secreto 1e-04
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 1e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 2e-04
pfam05793 528 pfam05793, TFIIF_alpha, Transcription initiation f 2e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 2e-04
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 2e-04
pfam0042888 pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro 2e-04
pfam04147 809 pfam04147, Nop14, Nop14-like family 2e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 3e-04
pfam01517194 pfam01517, HDV_ag, Hepatitis delta virus delta ant 3e-04
pfam04774106 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi 3e-04
pfam03985431 pfam03985, Paf1, Paf1 3e-04
pfam03344 715 pfam03344, Daxx, Daxx Family 4e-04
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 4e-04
pfam04147 809 pfam04147, Nop14, Nop14-like family 4e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 4e-04
PHA03235 409 PHA03235, PHA03235, DNA packaging protein UL33; Pr 4e-04
pfam04147 809 pfam04147, Nop14, Nop14-like family 5e-04
pfam01056329 pfam01056, Myc_N, Myc amino-terminal region 5e-04
pfam10323283 pfam10323, 7TM_GPCR_Srv, Serpentine type 7TM GPCR 6e-04
pfam14153185 pfam14153, Spore_coat_CotO, Spore coat protein Cot 6e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-04
pfam05285 317 pfam05285, SDA1, SDA1 7e-04
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 7e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 7e-04
pfam01271 585 pfam01271, Granin, Granin (chromogranin or secreto 8e-04
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 8e-04
pfam0042888 pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro 9e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.001
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.001
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.001
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.001
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.001
pfam09073 424 pfam09073, BUD22, BUD22 0.001
pfam09756 189 pfam09756, DDRGK, DDRGK domain 0.001
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 0.001
pfam10156 454 pfam10156, Med17, Subunit 17 of Mediator complex 0.001
PRK14160 211 PRK14160, PRK14160, heat shock protein GrpE; Provi 0.001
COG5129303 COG5129, MAK16, Nuclear protein with HMG-like acid 0.001
pfam07543139 pfam07543, PGA2, Protein trafficking PGA2 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.002
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.002
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.002
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.002
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.002
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.002
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.002
pfam14303147 pfam14303, NAM-associated, No apical meristem-asso 0.002
pfam14303147 pfam14303, NAM-associated, No apical meristem-asso 0.002
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.002
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.002
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
PRK04456463 PRK04456, PRK04456, acetyl-CoA decarbonylase/synth 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 0.002
pfam06991 277 pfam06991, Prp19_bind, Splicing factor, Prp19-bind 0.002
pfam09184285 pfam09184, PPP4R2, PPP4R2 0.002
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.002
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.003
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.003
PRK14160 211 PRK14160, PRK14160, heat shock protein GrpE; Provi 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.003
pfam10324317 pfam10324, 7TM_GPCR_Srw, Serpentine type 7TM GPCR 0.003
pfam04502321 pfam04502, DUF572, Family of unknown function (DUF 0.003
pfam02029 431 pfam02029, Caldesmon, Caldesmon 0.003
pfam02029 431 pfam02029, Caldesmon, Caldesmon 0.003
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.003
PRK14520155 PRK14520, rpsP, 30S ribosomal protein S16; Provisi 0.003
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.004
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.004
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.004
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.004
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.004
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 0.004
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 0.004
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score =  131 bits (332), Expect = 9e-37
 Identities = 48/134 (35%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 85  VVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCK--MYLIVV 142
           +V+   +++R+ TN+ ++NLA+ADLLF++   P+     V   WPFGD  CK   +L VV
Sbjct: 1   LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVV 60

Query: 143 TAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEV 202
             YAS+  L  +S+DR+LA+VHP+    +RT R A   IL+ W++ +L ++P        
Sbjct: 61  NGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPL--LFSW 118

Query: 203 SYTYASELHTACVF 216
             T      T C+ 
Sbjct: 119 LRTVEEGNVTTCLI 132

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220695 pfam10328, 7TM_GPCR_Srx, Serpentine type 7TM GPCR chemoreceptor Srx Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|165177 PHA02834, PHA02834, chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|192535 pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR chemoreceptor Srsx Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|216403 pfam01271, Granin, Granin (chromogranin or secretogranin) Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|110514 pfam01517, HDV_ag, Hepatitis delta virus delta antigen Back     alignment and domain information
>gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|223017 PHA03235, PHA03235, DNA packaging protein UL33; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|216269 pfam01056, Myc_N, Myc amino-terminal region Back     alignment and domain information
>gnl|CDD|220691 pfam10323, 7TM_GPCR_Srv, Serpentine type 7TM GPCR chemoreceptor Srv Back     alignment and domain information
>gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|216403 pfam01271, Granin, Granin (chromogranin or secretogranin) Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|220102 pfam09073, BUD22, BUD22 Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|220605 pfam10156, Med17, Subunit 17 of Mediator complex Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|227458 COG5129, MAK16, Nuclear protein with HMG-like acidic region [General function prediction only] Back     alignment and domain information
>gnl|CDD|219461 pfam07543, PGA2, Protein trafficking PGA2 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain Back     alignment and domain information
>gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|235302 PRK04456, PRK04456, acetyl-CoA decarbonylase/synthase complex subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|220692 pfam10324, 7TM_GPCR_Srw, Serpentine type 7TM GPCR chemoreceptor Srw Back     alignment and domain information
>gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG4219|consensus 423 99.93
KOG4220|consensus 503 99.92
PHA03234338 DNA packaging protein UL33; Provisional 99.91
PHA02834323 chemokine receptor-like protein; Provisional 99.88
PHA02638417 CC chemokine receptor-like protein; Provisional 99.87
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.87
PHA03235 409 DNA packaging protein UL33; Provisional 99.86
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.85
KOG2087|consensus363 99.61
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 99.57
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 99.44
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 99.16
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 98.62
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 98.55
PF11710201 Git3: G protein-coupled glucose receptor regulatin 98.48
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 98.41
PF10316273 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemorecep 98.15
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 98.06
PF10292324 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor c 97.92
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 97.89
PF02118275 Srg: Srg family chemoreceptor; InterPro: IPR000609 97.55
PF00002242 7tm_2: 7 transmembrane receptor (Secretin family); 97.35
PF04789305 DUF621: Protein of unknown function (DUF621); Inte 97.14
PF03383153 Serpentine_r_xa: Caenorhabditis serpentine recepto 97.14
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 96.93
PF02117328 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemorecept 96.19
PF02101 405 Ocular_alb: Ocular albinism type 1 protein; InterP 96.14
PF06681226 DUF1182: Protein of unknown function (DUF1182); In 95.59
PF10326307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 95.49
KOG1832|consensus1516 94.88
KOG4193|consensus610 94.59
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 94.47
PF02175236 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemorecept 93.43
PF10319310 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept 93.18
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 92.65
KOG1832|consensus1516 92.58
KOG2568|consensus518 92.54
PF03344 713 Daxx: Daxx Family; InterPro: IPR005012 Daxx is a u 92.17
PF01534328 Frizzled: Frizzled/Smoothened family membrane regi 91.82
TIGR00927 1096 2A1904 K+-dependent Na+/Ca+ exchanger. 91.79
KOG4564|consensus473 91.17
PF03125365 Sre: C. elegans Sre G protein-coupled chemorecepto 90.93
PRK12585197 putative monovalent cation/H+ antiporter subunit G 90.21
KOG4156|consensus 1329 89.93
PRK12585197 putative monovalent cation/H+ antiporter subunit G 89.1
KOG0262|consensus 1640 89.03
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 88.83
PF10322307 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemorecept 87.56
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 85.95
PF07133173 Merozoite_SPAM: Merozoite surface protein (SPAM); 85.82
PF02076283 STE3: Pheromone A receptor; InterPro: IPR001499 G- 84.1
PF03821233 Mtp: Golgi 4-transmembrane spanning transporter; I 82.48
PF02724 622 CDC45: CDC45-like protein; InterPro: IPR003874 CDC 82.11
KOG0127|consensus 678 81.5
PF03348429 Serinc: Serine incorporator (Serinc); InterPro: IP 81.17
PF10329232 DUF2417: Region of unknown function (DUF2417); Int 81.13
PRK14891131 50S ribosomal protein L24e/unknown domain fusion p 81.06
>KOG4219|consensus Back     alignment and domain information 
Probab=99.93  E-value=1.2e-26  Score=209.26  Aligned_cols=166  Identities=24%  Similarity=0.507  Sum_probs=150.0

Q ss_pred             hHHHhhhHHHHHHHHHHHHHHHHHHHHHHhhhhhhccCCCCchHHHHHHHHHHHHHHHHhhhHHHHHHHHhhcCCcchhH
Q psy9274          54 AEAMERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDV  133 (318)
Q Consensus        54 ~~~~~~~~~~~~~~~~~ii~~~gi~gN~lvi~~i~~~~~l~~~~~~ll~~LaiaDll~~l~~~p~~~~~~~~~~~~~~~~  133 (318)
                      ....+.+...+.+++++++++++++||++|++++..+|++|+.+|+||+|||+||++++++..++.....+...|.+|..
T Consensus        27 ~f~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f  106 (423)
T KOG4219|consen   27 LFVLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSF  106 (423)
T ss_pred             cccCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccccc
Confidence            34566777899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHH--HHHHHHHHHHHHHHHHHHHHhheeeeccCccccccchhhHHHHHHHHHHHHHHHHhhhHhhcCceeeee-CCCc
Q psy9274         134 WCKM--YLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTY-ASEL  210 (318)
Q Consensus       134 ~C~~--~~~~~~~~~s~~~l~~isidRy~aI~~P~~y~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~~~-~~~~  210 (318)
                      +|++  |+..+...+|+++|++||+|||.||.||++.+  .++|.++++++++|+.|+++++|..+......... .+..
T Consensus       107 ~C~f~nf~~itav~vSVfTlvAiA~DRy~AIi~Pl~~r--~s~r~sk~iIllIW~lA~l~a~P~~l~s~v~~~~~~d~~~  184 (423)
T KOG4219|consen  107 YCRFVNFFPITAVFVSVFTLVAIAIDRYMAIIHPLQPR--PSRRSSKIIILLIWALALLLALPQLLYSSVEELYLYDGES  184 (423)
T ss_pred             eeeeccccchhhhhHhHHHHHHHHHHHHHHHhhhcccC--CCCcceeehhHHHHHHHHHHhccceeeeeeEEeeccCCcc
Confidence            9999  99999999999999999999999999999876  69999999999999999999999998877655433 2344


Q ss_pred             ceeeEeecCCC
Q psy9274         211 HTACVFLDLDP  221 (318)
Q Consensus       211 ~~~C~~~~~~~  221 (318)
                      ...|...+...
T Consensus       185 ~~~~~~~~pe~  195 (423)
T KOG4219|consen  185 RVVCVTAWPEH  195 (423)
T ss_pred             eEEEEEecccc
Confidence            67788777765

>KOG4220|consensus Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10316 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemoreceptor Srbc ; InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10292 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor class ab chemoreceptor; InterPro: IPR019408 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF04789 DUF621: Protein of unknown function (DUF621); InterPro: IPR006874 This is a conserved region found in uncharacterised proteins from Caenorhabditis elegans, and is noted to have possible G-protein-coupled receptor-like activity Back     alignment and domain information
>PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02117 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemoreceptor Sra; InterPro: IPR000344 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF06681 DUF1182: Protein of unknown function (DUF1182); InterPro: IPR010601 This family consists of several hypothetical proteins of around 360 residues in length and seems to be specific to Caenorhabditis elegans Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG4193|consensus Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02175 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemoreceptor Srb; InterPro: IPR002184 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2568|consensus Back     alignment and domain information
>PF03344 Daxx: Daxx Family; InterPro: IPR005012 Daxx is a ubiquitously expressed protein that functions, in part, as a transcriptional co-repressor through its interaction with a growing number of nuclear, DNA-associated proteins Back     alignment and domain information
>PF01534 Frizzled: Frizzled/Smoothened family membrane region; InterPro: IPR000539 The frizzled (fz) locus of Drosophila coordinates the cytoskeletons of epidermal cells, producing a parallel array of cuticular hairs and bristles [, ] Back     alignment and domain information
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>PF03125 Sre: C Back     alignment and domain information
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>KOG4156|consensus Back     alignment and domain information
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>KOG0262|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF10322 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemoreceptor Sru; InterPro: IPR003839 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF07133 Merozoite_SPAM: Merozoite surface protein (SPAM); InterPro: IPR010784 This entry consists of several Plasmodium falciparum SPAM (secreted polymorphic antigen associated with merozoites) proteins, also know as merozoite surface proteins Back     alignment and domain information
>PF02076 STE3: Pheromone A receptor; InterPro: IPR001499 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03821 Mtp: Golgi 4-transmembrane spanning transporter; InterPro: IPR004687 LAPTM4 and 5 are lysosome-associated transmembrane proteins, found in mammals, insects and nematodes Back     alignment and domain information
>PF02724 CDC45: CDC45-like protein; InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46 Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PF03348 Serinc: Serine incorporator (Serinc); InterPro: IPR005016 This is a family of proteins which display differential expression in various tumour and cell lines Back     alignment and domain information
>PF10329 DUF2417: Region of unknown function (DUF2417); InterPro: IPR019431 This entry represents a family of fungal proteins with no known function Back     alignment and domain information
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
4dkl_A 464 Crystal Structure Of The Mu-Opioid Receptor Bound T 2e-11
3sn6_R514 Crystal Structure Of The Beta2 Adrenergic Receptor- 7e-11
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 2e-10
4djh_A 480 Structure Of The Human Kappa Opioid Receptor In Com 3e-10
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 3e-10
4ej4_A 461 Structure Of The Delta Opioid Receptor Bound To Nal 3e-10
4ea3_B434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 3e-10
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 4e-10
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 4e-10
3kj6_A366 Crystal Structure Of A Methylated Beta2 Adrenergic 5e-10
2r4r_A365 Crystal Structure Of The Human Beta2 Adrenoceptor L 5e-10
2r4s_A342 Crystal Structure Of The Human Beta2 Adrenoceptor L 7e-10
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 2e-09
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 2e-08
3odu_A 502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 2e-08
3oe0_A 499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 2e-08
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-06
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-06
3vw7_A 484 Crystal Structure Of Human Protease-Activated Recep 6e-06
4grv_A 510 The Crystal Structure Of The Neurotensin Receptor N 4e-05
4daj_A 479 Structure Of The M3 Muscarinic Acetylcholine Recept 7e-05
2ks9_A364 Solution Conformation Of Substance P In Water Compl 3e-04
2z73_A 448 Crystal Structure Of Squid Rhodopsin Length = 448 4e-04
2ziy_A372 Crystal Structure Of Squid Rhodopsin Length = 372 4e-04
>pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
Query: 116 VPFTATDYVTTCWPFGDVWCKMYLIV--VTAYASVYTLVLMSLDRFLAVVHPIASMSVRT 173
           +PF + +Y+   WPFG++ CK+ + +     + S++TL  MS+DR++AV HP+ ++  RT
Sbjct: 70  LPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT 129
Query: 174 ERNALKAILITWIVIVLTAVPVFNM 198
            RNA    +  WI+     +PV  M
Sbjct: 130 PRNAKIVNVCNWILSSAIGLPVMFM 154
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 Back     alignment and structure
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|3VW7|A Chain A, Crystal Structure Of Human Protease-Activated Receptor 1 (Par1) Bound With Antagonist Vorapaxar At 2.2 Angstrom Length = 484 Back     alignment and structure
>pdb|4GRV|A Chain A, The Crystal Structure Of The Neurotensin Receptor Nts1 In Complex With Neurotensin (8-13) Length = 510 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure
>pdb|2Z73|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 448 Back     alignment and structure
>pdb|2ZIY|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.94
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.93
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.93
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.93
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.93
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.92
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.92
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.92
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.92
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.92
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.92
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.91
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.91
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.91
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.91
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.91
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.91
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.9
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 98.64
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 96.9
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.94  E-value=1.9e-26  Score=223.23  Aligned_cols=145  Identities=23%  Similarity=0.495  Sum_probs=129.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhhhhhccCCCC---chHHHHHHHHHHHHHHHHhhhHHHHHHHHhh--cCCcchhHH
Q psy9274          60 MVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMR---STTNLLIINLAIADLLFIVCCVPFTATDYVT--TCWPFGDVW  134 (318)
Q Consensus        60 ~~~~~~~~~~~ii~~~gi~gN~lvi~~i~~~~~l~---~~~~~ll~~LaiaDll~~l~~~p~~~~~~~~--~~~~~~~~~  134 (318)
                      ..++++.+++++++++|++||++|++++.++|++|   +++|+|++|||+||++++++.+|+.+...+.  ..|.++..+
T Consensus        30 ~~~v~~~~~~~~i~~~g~~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~~~  109 (510)
T 4grv_A           30 YSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAG  109 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhHHH
Confidence            34778889999999999999999999999876554   7899999999999999999999999887654  469999999


Q ss_pred             HHH--HHHHHHHHHHHHHHHHHHHHhheeeeccCccccccchhhHHHHHHHHHHHHHHHHhhhHhhcCceee
Q psy9274         135 CKM--YLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSY  204 (318)
Q Consensus       135 C~~--~~~~~~~~~s~~~l~~isidRy~aI~~P~~y~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~  204 (318)
                      |++  ++..++..+|++++++||+|||+||++|++|++++|++++.++++++|++++++++|++++++....
T Consensus       110 C~~~~~~~~~~~~~S~~~l~~is~dRy~ai~~P~~~~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~  181 (510)
T 4grv_A          110 CRGYYFLRDACTYATALNVASLSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNR  181 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCCCCCCCSCCHHHHHHHHHHHHHHHTTHHHHEEEEEC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHheEEEeccccccccccccccceeehHHHHHHHHHHHHHHHhhccccc
Confidence            999  8888999999999999999999999999999999999999999999999999999999998876554
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 7e-23
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 6e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 8e-04
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.004
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 95.0 bits (235), Expect = 7e-23
 Identities = 27/145 (18%), Positives = 66/145 (45%), Gaps = 2/145 (1%)

Query: 57  MERMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCV 116
            E     ++  +  ++I+LGF  N L + V   ++++R+  N +++NLA+ADL  +    
Sbjct: 32  AEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGF 91

Query: 117 PFTATDYVTTCWPFGDVWCKMYL--IVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTE 174
             T    +   + FG   C +      +    ++++LV+++++R++ V  P+++      
Sbjct: 92  TTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGEN 151

Query: 175 RNALKAILITWIVIVLTAVPVFNMH 199
              +       + +   A P+    
Sbjct: 152 HAIMGVAFTWVMALACAAPPLVGWS 176
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.89
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.89  E-value=1.3e-22  Score=183.28  Aligned_cols=158  Identities=20%  Similarity=0.399  Sum_probs=135.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHhhhhhhccCCCCchHHHHHHHHHHHHHHHHhhhHHHHHHHHhhcCCcchhHHHHH-
Q psy9274          59 RMVSIIVPIFFGIIIILGFFGNALVVVVVAFNQQMRSTTNLLIINLAIADLLFIVCCVPFTATDYVTTCWPFGDVWCKM-  137 (318)
Q Consensus        59 ~~~~~~~~~~~~ii~~~gi~gN~lvi~~i~~~~~l~~~~~~ll~~LaiaDll~~l~~~p~~~~~~~~~~~~~~~~~C~~-  137 (318)
                      ++...++++++.+++++|++||+++++++.++|++|++.|++++|||++|++.++..+|..+.....+.|..+...|++ 
T Consensus        34 ~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~~~  113 (348)
T d1u19a_          34 PWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLE  113 (348)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCchhhhhh
Confidence            4456788889999999999999999999999999999999999999999999999999999988888889889999998 


Q ss_pred             -HHHHHHHHHHHHHHHHHHHHhheeeeccCccccccchhhHHHHHHHHHHHHHHHHhhhHhhcCceeeeeCCCcceeeEe
Q psy9274         138 -YLIVVTAYASVYTLVLMSLDRFLAVVHPIASMSVRTERNALKAILITWIVIVLTAVPVFNMHGEVSYTYASELHTACVF  216 (318)
Q Consensus       138 -~~~~~~~~~s~~~l~~isidRy~aI~~P~~y~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~~~~~~~~~~C~~  216 (318)
                       ++..++..+|++++++|++|||++|++|++|+.. ++++....++++|.+++++.+|+.++.........   ...|..
T Consensus       114 ~~~~~~~~~~s~~~l~~is~~R~~~i~~p~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~  189 (348)
T d1u19a_         114 GFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRF-GENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGM---QCSCGI  189 (348)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCC-CHHHHHHHHHHHHHHHHHHHSGGGTTSSCCEEETT---TTEEEC
T ss_pred             hhccccceeeecchhhhhhcccceeeecccccccc-ccccccccceeeehhhhheecccccccceeccCCc---cccccc
Confidence             7788889999999999999999999999998765 66677788888899999999988887776655432   344444


Q ss_pred             ecCC
Q psy9274         217 LDLD  220 (318)
Q Consensus       217 ~~~~  220 (318)
                      ....
T Consensus       190 ~~~~  193 (348)
T d1u19a_         190 DYYT  193 (348)
T ss_dssp             CCSC
T ss_pred             cccc
Confidence            4433