Psyllid ID: psy9326

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
KFSTKKFLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF
cEEEEcccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
ccHHHHHHHcccEEEEcccHHcEEEEEEEcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccEEEccccHHc
kfstkkflypnlesysiptderigNLTLVlkdkshipavkSQITLIVRAmysnppshgARIVSLvlnnprlydQWKQCIETMSGRIKQMRRGLRERLEklntpgtwnhiteqigmfsytglnrkf
kfstkkflypnlesysiptderIGNLTLvlkdkshipaVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKlntpgtwnhiteqigmfsytglnrkf
KFSTKKFLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF
******FLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTG*****
KFSTKKFLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRK*
KFSTKKFLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF
KFSTKKFLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNR*F
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KFSTKKFLYPNLESYSIPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
P00504412 Aspartate aminotransferas yes N/A 0.84 0.254 0.571 4e-31
Q4R5L1413 Aspartate aminotransferas N/A N/A 0.84 0.254 0.6 2e-30
Q22067408 Probable aspartate aminot yes N/A 0.816 0.25 0.568 4e-30
A5A6K8413 Aspartate aminotransferas yes N/A 0.84 0.254 0.580 8e-30
P17174413 Aspartate aminotransferas yes N/A 0.84 0.254 0.580 9e-30
P13221413 Aspartate aminotransferas yes N/A 0.84 0.254 0.580 1e-29
P08906413 Aspartate aminotransferas yes N/A 0.84 0.254 0.580 1e-29
P33097413 Aspartate aminotransferas yes N/A 0.84 0.254 0.580 1e-29
Q5R691413 Aspartate aminotransferas yes N/A 0.84 0.254 0.580 2e-29
P05201413 Aspartate aminotransferas yes N/A 0.84 0.254 0.571 2e-29
>sp|P00504|AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus GN=GOT1 PE=1 SV=3 Back     alignment and function desciption
 Score =  132 bits (333), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 80/105 (76%)

Query: 20  DERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCI 79
           +ER+GNL++V KD+ ++  V SQ+  IVR  +SNPPS GARIV+  L +P+L+ +WK  +
Sbjct: 264 NERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNV 323

Query: 80  ETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRK 124
           +TM+ R+  MR  LR RLE L TPGTWNHIT+QIGMFS+TGLN K
Sbjct: 324 KTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPK 368
Plays a key role in amino acid metabolism.
Gallus gallus (taxid: 9031)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|Q4R5L1|AATC_MACFA Aspartate aminotransferase, cytoplasmic OS=Macaca fascicularis GN=GOT1 PE=2 SV=1 Back     alignment and function description
>sp|Q22067|AATC_CAEEL Probable aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans GN=T01C8.5 PE=3 SV=1 Back     alignment and function description
>sp|A5A6K8|AATC_PANTR Aspartate aminotransferase, cytoplasmic OS=Pan troglodytes GN=GOT1 PE=2 SV=1 Back     alignment and function description
>sp|P17174|AATC_HUMAN Aspartate aminotransferase, cytoplasmic OS=Homo sapiens GN=GOT1 PE=1 SV=3 Back     alignment and function description
>sp|P13221|AATC_RAT Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus GN=Got1 PE=1 SV=3 Back     alignment and function description
>sp|P08906|AATC_HORSE Aspartate aminotransferase, cytoplasmic OS=Equus caballus GN=GOT1 PE=1 SV=2 Back     alignment and function description
>sp|P33097|AATC_BOVIN Aspartate aminotransferase, cytoplasmic OS=Bos taurus GN=GOT1 PE=1 SV=3 Back     alignment and function description
>sp|Q5R691|AATC_PONAB Aspartate aminotransferase, cytoplasmic OS=Pongo abelii GN=GOT1 PE=2 SV=1 Back     alignment and function description
>sp|P05201|AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus GN=Got1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
242010566 410 aspartate aminotransferase, cytoplasmic, 0.824 0.251 0.685 9e-38
156554459 406 PREDICTED: aspartate aminotransferase, c 0.84 0.258 0.685 2e-37
321460829 411 hypothetical protein DAPPUDRAFT_308666 [ 0.816 0.248 0.705 4e-37
224486250 402 glutamine-oxaloacetic transaminase [Daph 0.816 0.253 0.715 6e-37
224486246 407 glutamine-oxaloacetic transaminase [Daph 0.816 0.250 0.715 6e-37
224486244 407 glutamine-oxaloacetic transaminase [Daph 0.816 0.250 0.715 7e-37
91083103 405 PREDICTED: similar to aspartate aminotra 0.84 0.259 0.676 8e-37
225718800 410 Aspartate aminotransferase, cytoplasmic 0.816 0.248 0.686 1e-36
307180800 1089 Aspartate aminotransferase, cytoplasmic 0.84 0.096 0.666 2e-36
372477536 374 aspartate aminotransferase, partial [All 0.84 0.280 0.676 4e-36
>gi|242010566|ref|XP_002426036.1| aspartate aminotransferase, cytoplasmic, putative [Pediculus humanus corporis] gi|212510046|gb|EEB13298.1| aspartate aminotransferase, cytoplasmic, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 72/105 (68%), Positives = 86/105 (81%), Gaps = 2/105 (1%)

Query: 20  DERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCI 79
           +ER+GNLT V+ DK  IP++KSQ+T+I+R MYSNPP+HG RIV+ VLNNP LY +WKQCI
Sbjct: 258 NERVGNLTFVVADKCVIPSIKSQVTIIIRGMYSNPPNHGCRIVATVLNNPELYKEWKQCI 317

Query: 80  ETMSGRIKQMRRGLRERLEKLNTPGT--WNHITEQIGMFSYTGLN 122
             MS RIK+MR+GL+ERL  L TP    WNHITEQIGMFSYTGLN
Sbjct: 318 RIMSNRIKEMRKGLKERLRDLKTPNDNKWNHITEQIGMFSYTGLN 362

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156554459|ref|XP_001601449.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321460829|gb|EFX71867.1| hypothetical protein DAPPUDRAFT_308666 [Daphnia pulex] Back     alignment and taxonomy information
>gi|224486250|gb|ACN51890.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486246|gb|ACN51888.1| glutamine-oxaloacetic transaminase [Daphnia magna] gi|224486254|gb|ACN51892.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486244|gb|ACN51887.1| glutamine-oxaloacetic transaminase [Daphnia magna] gi|224486260|gb|ACN51895.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|91083103|ref|XP_969549.1| PREDICTED: similar to aspartate aminotransferase [Tribolium castaneum] gi|270007674|gb|EFA04122.1| hypothetical protein TcasGA2_TC014364 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|225718800|gb|ACO15246.1| Aspartate aminotransferase, cytoplasmic [Caligus clemensi] Back     alignment and taxonomy information
>gi|307180800|gb|EFN68664.1| Aspartate aminotransferase, cytoplasmic [Camponotus floridanus] Back     alignment and taxonomy information
>gi|372477536|gb|AEX97003.1| aspartate aminotransferase, partial [Allonemobius fasciatus] gi|372477538|gb|AEX97004.1| aspartate aminotransferase, partial [Allonemobius fasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
UNIPROTKB|P00504412 GOT1 "Aspartate aminotransfera 0.84 0.254 0.571 7.1e-29
ZFIN|ZDB-GENE-040426-2003410 got1 "glutamic-oxaloacetic tra 0.84 0.256 0.561 7.1e-29
FB|FBgn0001124448 Got1 "Glutamate oxaloacetate t 0.816 0.227 0.598 9.1e-29
UNIPROTKB|Q4R5L1413 GOT1 "Aspartate aminotransfera 0.84 0.254 0.6 9.1e-29
UNIPROTKB|F1NTM7344 GOT1 "Aspartate aminotransfera 0.84 0.305 0.571 1.2e-28
UNIPROTKB|A5A6K8413 GOT1 "Aspartate aminotransfera 0.84 0.254 0.580 5e-28
RGD|2721413 Got1 "glutamic-oxaloacetic tra 0.84 0.254 0.580 5e-28
UNIPROTKB|P33097413 GOT1 "Aspartate aminotransfera 0.84 0.254 0.580 6.4e-28
UNIPROTKB|B7Z7E9392 GOT1 "Aspartate aminotransfera 0.84 0.267 0.580 6.4e-28
UNIPROTKB|P17174413 GOT1 "Aspartate aminotransfera 0.84 0.254 0.580 6.4e-28
UNIPROTKB|P00504 GOT1 "Aspartate aminotransferase, cytoplasmic" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
 Identities = 60/105 (57%), Positives = 80/105 (76%)

Query:    20 DERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCI 79
             +ER+GNL++V KD+ ++  V SQ+  IVR  +SNPPS GARIV+  L +P+L+ +WK  +
Sbjct:   264 NERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNV 323

Query:    80 ETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRK 124
             +TM+ R+  MR  LR RLE L TPGTWNHIT+QIGMFS+TGLN K
Sbjct:   324 KTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPK 368
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA
GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS
GO:0047801 "L-cysteine:2-oxoglutarate aminotransferase activity" evidence=ISS
GO:0006114 "glycerol biosynthetic process" evidence=ISS
GO:0006531 "aspartate metabolic process" evidence=ISS
GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISS;TAS
GO:0006536 "glutamate metabolic process" evidence=ISS
GO:0005829 "cytosol" evidence=TAS
GO:0005975 "carbohydrate metabolic process" evidence=TAS
GO:0006094 "gluconeogenesis" evidence=TAS
GO:0006520 "cellular amino acid metabolic process" evidence=TAS
GO:0044281 "small molecule metabolic process" evidence=TAS
ZFIN|ZDB-GENE-040426-2003 got1 "glutamic-oxaloacetic transaminase 1, soluble" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0001124 Got1 "Glutamate oxaloacetate transaminase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R5L1 GOT1 "Aspartate aminotransferase, cytoplasmic" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTM7 GOT1 "Aspartate aminotransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5A6K8 GOT1 "Aspartate aminotransferase, cytoplasmic" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
RGD|2721 Got1 "glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P33097 GOT1 "Aspartate aminotransferase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z7E9 GOT1 "Aspartate aminotransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17174 GOT1 "Aspartate aminotransferase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O42652AATC_SCHPO2, ., 6, ., 1, ., 10.51480.8080.2469yesN/A
Q22067AATC_CAEEL2, ., 6, ., 1, ., 10.56860.8160.25yesN/A
P13221AATC_RAT2, ., 6, ., 1, ., 10.58090.840.2542yesN/A
P33097AATC_BOVIN2, ., 6, ., 1, ., 10.58090.840.2542yesN/A
P17174AATC_HUMAN2, ., 6, ., 1, ., 10.58090.840.2542yesN/A
Q5R691AATC_PONAB2, ., 6, ., 1, ., 10.58090.840.2542yesN/A
P00503AATC_PIG2, ., 6, ., 1, ., 10.57140.840.2542yesN/A
P05201AATC_MOUSE2, ., 6, ., 1, ., 10.57140.840.2542yesN/A
P00504AATC_CHICK2, ., 6, ., 1, ., 10.57140.840.2548yesN/A
P08906AATC_HORSE2, ., 6, ., 1, ., 10.58090.840.2542yesN/A
A5A6K8AATC_PANTR2, ., 6, ., 1, ., 10.58090.840.2542yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
PLN02397423 PLN02397, PLN02397, aspartate transaminase 2e-49
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 2e-47
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 3e-40
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 7e-38
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 2e-14
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 1e-06
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information 
 Score =  161 bits (410), Expect = 2e-49
 Identities = 52/102 (50%), Positives = 71/102 (69%)

Query: 21  ERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIE 80
           ER+G L++V K       VKSQ+ LI R MYSNPP HGA IV+ +L +P L+ +W + ++
Sbjct: 276 ERVGALSVVCKSADVAVRVKSQLKLIARPMYSNPPIHGASIVATILGDPELFSEWTKELK 335

Query: 81  TMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLN 122
            M+ RI  MR+ L + LE   +PG W+HIT+QIGMFS+TGLN
Sbjct: 336 GMADRIISMRQKLYDALEARGSPGDWSHITKQIGMFSFTGLN 377

Length = 423
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 100.0
KOG1411|consensus427 100.0
KOG1412|consensus410 100.0
PLN02397423 aspartate transaminase 99.55
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.42
PTZ00376404 aspartate aminotransferase; Provisional 99.4
PRK08637388 hypothetical protein; Provisional 98.46
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 98.07
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 97.87
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 97.87
PRK06108382 aspartate aminotransferase; Provisional 97.72
PLN02231534 alanine transaminase 97.68
PTZ00377481 alanine aminotransferase; Provisional 97.6
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 97.55
PLN02368407 alanine transaminase 97.45
PRK15481431 transcriptional regulatory protein PtsJ; Provision 97.44
PRK05957389 aspartate aminotransferase; Provisional 97.38
PTZ00433412 tyrosine aminotransferase; Provisional 97.31
PRK08068389 transaminase; Reviewed 97.29
PRK09148405 aminotransferase; Validated 97.27
PRK06855433 aminotransferase; Validated 97.25
PRK07550386 hypothetical protein; Provisional 97.23
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 97.23
cd00609350 AAT_like Aspartate aminotransferase family. This f 97.19
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 97.09
PRK08636403 aspartate aminotransferase; Provisional 97.03
PRK08912387 hypothetical protein; Provisional 96.9
PRK12414384 putative aminotransferase; Provisional 96.87
PRK09440416 avtA valine--pyruvate transaminase; Provisional 96.84
PRK07681399 aspartate aminotransferase; Provisional 96.83
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 96.83
PRK09265404 aminotransferase AlaT; Validated 96.83
PRK08363398 alanine aminotransferase; Validated 96.82
PRK09082386 methionine aminotransferase; Validated 96.81
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 96.78
PRK07682378 hypothetical protein; Validated 96.78
PRK06836394 aspartate aminotransferase; Provisional 96.78
PRK08960387 hypothetical protein; Provisional 96.77
PRK07568397 aspartate aminotransferase; Provisional 96.77
PRK06290410 aspartate aminotransferase; Provisional 96.74
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 96.74
PRK08175395 aminotransferase; Validated 96.71
PRK06348384 aspartate aminotransferase; Provisional 96.66
PRK07337388 aminotransferase; Validated 96.59
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 96.55
PRK07777387 aminotransferase; Validated 96.52
PRK07366388 succinyldiaminopimelate transaminase; Validated 96.5
PRK06107402 aspartate aminotransferase; Provisional 96.49
PRK05764393 aspartate aminotransferase; Provisional 96.48
PRK07683387 aminotransferase A; Validated 96.47
PRK09105370 putative aminotransferase; Provisional 96.45
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 96.42
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 96.4
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 96.31
PRK08361391 aspartate aminotransferase; Provisional 96.25
PRK07309391 aromatic amino acid aminotransferase; Validated 96.25
PRK13355517 bifunctional HTH-domain containing protein/aminotr 96.2
PLN02656409 tyrosine transaminase 96.13
PRK08056356 threonine-phosphate decarboxylase; Provisional 96.1
PRK05942394 aspartate aminotransferase; Provisional 96.07
PRK03967337 histidinol-phosphate aminotransferase; Provisional 95.95
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 95.88
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 95.85
PRK06207405 aspartate aminotransferase; Provisional 95.83
PRK07324373 transaminase; Validated 95.78
PLN00175413 aminotransferase family protein; Provisional 95.76
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 95.66
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 95.61
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 95.61
PRK09147396 succinyldiaminopimelate transaminase; Provisional 94.91
PRK05387353 histidinol-phosphate aminotransferase; Provisional 94.8
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 94.75
PRK02610374 histidinol-phosphate aminotransferase; Provisional 94.68
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 94.62
KOG0256|consensus471 94.55
PLN02187462 rooty/superroot1 94.49
PRK08153369 histidinol-phosphate aminotransferase; Provisional 94.42
PLN03026380 histidinol-phosphate aminotransferase; Provisional 94.3
PRK04781364 histidinol-phosphate aminotransferase; Provisional 94.21
PRK04870356 histidinol-phosphate aminotransferase; Provisional 93.97
PRK06358354 threonine-phosphate decarboxylase; Provisional 93.73
PRK06959339 putative threonine-phosphate decarboxylase; Provis 93.57
PRK05166371 histidinol-phosphate aminotransferase; Provisional 93.39
PRK03317368 histidinol-phosphate aminotransferase; Provisional 93.14
PRK03158359 histidinol-phosphate aminotransferase; Provisional 92.96
PRK07392360 threonine-phosphate decarboxylase; Validated 92.83
PRK14809357 histidinol-phosphate aminotransferase; Provisional 92.8
PRK07908349 hypothetical protein; Provisional 92.69
PRK05839374 hypothetical protein; Provisional 91.97
PRK14807351 histidinol-phosphate aminotransferase; Provisional 91.86
PRK05664330 threonine-phosphate decarboxylase; Reviewed 91.55
PRK04635354 histidinol-phosphate aminotransferase; Provisional 90.82
PRK14808335 histidinol-phosphate aminotransferase; Provisional 90.8
PLN026721082 methionine S-methyltransferase 90.37
PRK01688351 histidinol-phosphate aminotransferase; Provisional 89.95
PRK02731367 histidinol-phosphate aminotransferase; Validated 89.42
PRK06425332 histidinol-phosphate aminotransferase; Validated 88.64
PRK06225380 aspartate aminotransferase; Provisional 88.59
PRK00950361 histidinol-phosphate aminotransferase; Validated 88.58
PRK03321352 putative aminotransferase; Provisional 87.48
TIGR00707379 argD acetylornithine and succinylornithine aminotr 86.4
PRK09275527 aspartate aminotransferase; Provisional 85.12
KOG0634|consensus472 83.48
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 80.85
PRK01533366 histidinol-phosphate aminotransferase; Validated 80.83
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-43  Score=294.15  Aligned_cols=120  Identities=41%  Similarity=0.666  Sum_probs=114.7

Q ss_pred             ccccCCCccccc-ccCCccceEEEEcCCCCcHHHHHHHHHHHHHhhcCCCcchHHHHHHHHhCCHhhHHHHHHHHHHHHH
Q psy9326           6 KFLYPNLESYSI-PTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSG   84 (125)
Q Consensus         6 ~~~~~~~~~~~~-~ygeRvGal~vV~~~~~~a~~v~sql~~i~R~~yS~PP~~Ga~IV~~IL~dp~L~~~W~~EL~~m~~   84 (125)
                      ++++-+--||+| +|||||||+++|++|++.++++.|||+.++|++|||||+|||+||++||+||+||++|++||+.||.
T Consensus       237 ~~lva~S~SKnfgLYgERVGa~~vva~~~~~a~~v~sqlk~~iR~~ySnPP~~Ga~vva~IL~~p~Lra~W~~El~~Mr~  316 (396)
T COG1448         237 ELLVASSFSKNFGLYGERVGALSVVAEDAEEADRVLSQLKAIIRTNYSNPPAHGAAVVATILNNPELRAEWEQELEEMRQ  316 (396)
T ss_pred             cEEEEehhhhhhhhhhhccceeEEEeCCHHHHHHHHHHHHHHHHhccCCCchhhHHHHHHHhCCHHHHHHHHHHHHHHHH
Confidence            356666667777 7999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCCCC
Q psy9326          85 RIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF  125 (125)
Q Consensus        85 RI~~~R~~L~~~L~~~~~~~~w~~i~~Q~GMFs~~gLs~~q  125 (125)
                      ||++||..|++.|++.+.+++|+||.+|+|||||+|||++|
T Consensus       317 Ri~~mR~~lv~~L~~~~~~~~f~~i~~Q~GMFsy~Gls~~Q  357 (396)
T COG1448         317 RILEMRQALVDALKALGAPRNFDFIISQRGMFSYTGLSPEQ  357 (396)
T ss_pred             HHHHHHHHHHHHHHhhCCCcccchHhhcCceeecCCCCHHH
Confidence            99999999999999999999999999999999999999987

>KOG1411|consensus Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2cst_A411 Crystal Structure Of The Closed Form Of Chicken Cyt 3e-32
1aat_A411 Oxoglutarate-Induced Conformational Changes In Cyto 1e-31
3ii0_A422 Crystal Structure Of Human Glutamate Oxaloacetate T 8e-31
1ajs_A412 Refinement And Comparison Of The Crystal Structures 2e-30
1ajr_A412 Refinement And Comparison Of The Crystal Structures 2e-30
1yaa_A412 Aspartate Aminotransferase From Saccharomyces Cerev 5e-25
4h51_A420 Crystal Structure Of A Putative Aspartate Aminotran 8e-24
3pd6_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 3e-22
3hlm_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 3e-22
7aat_A401 X-Ray Structure Refinement And Comparison Of Three 3e-22
1aka_A401 Structural Basis For The Catalytic Activity Of Aspa 4e-22
4f4e_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 1e-18
4eff_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 1e-18
4eu1_A409 Structure Of A Mitochondrial Aspartate Aminotransfe 5e-18
4f5m_A406 Wild-type E. Coli Aspartate Aminotransferase: A Tem 3e-16
4f5j_A406 Rational Design And Directed Evolution For Conversi 3e-16
4f5f_A406 Structure Of Aspartate Aminotransferase Conversion 3e-16
1bqa_A396 Aspartate Aminotransferase P195a Mutant Length = 39 3e-16
2aat_A396 2.8-Angstroms-Resolution Crystal Structure Of An Ac 3e-16
1ix8_A396 Aspartate Aminotransferase Active Site Mutant V39fN 3e-16
1bqd_A396 Aspartate Aminotransferase P138aP195A DOUBLE MUTANT 3e-16
1ari_A396 Aspartate Aminotransferase, W140h Mutant, Maleate C 3e-16
1qis_A396 Aspartate Aminotransferase From Escherichia Coli, C 3e-16
1asf_A396 The Structural Basis For The Reduced Activity Of Th 3e-16
1arh_A396 Aspartate Aminotransferase, Y225rR386A MUTANT Lengt 3e-16
1aia_A396 Structural Basis For The Catalytic Activity Of Aspa 3e-16
1g7w_A396 Aspartate Aminotransferase Active Site Mutant N194a 3e-16
2q7w_A396 Structural Studies Reveals The Inactivation Of E. C 3e-16
1asb_A396 The Structural Basis For The Reduced Activity Of Th 3e-16
1g4v_A396 Aspartate Aminotransferase Active Site Mutant N194a 3e-16
1ix6_A396 Aspartate Aminotransferase Active Site Mutant V39f 3e-16
3aat_A396 Activity And Structure Of The Active-Site Mutants R 3e-16
1asl_A396 Crystal Structures Of Escherichia Coli Aspartate Am 3e-16
1qir_A396 Aspartate Aminotransferase From Escherichia Coli, C 3e-16
1b4x_A396 Aspartate Aminotransferase From E. Coli, C191s Muta 3e-16
1qit_A396 Aspartate Aminotransferase From Escherichia Coli, C 3e-16
4f5k_A406 Substrate Specificity Conversion Of Aspartate Amino 1e-15
4f5i_A406 Substrate Specificity Conversion Of E. Coli Pyridox 1e-15
1ahy_A396 Aspartate Aminotransferase Hexamutant Length = 396 1e-15
4f5g_A406 Rational Design And Directed Evolution Of E. Coli A 2e-15
1aam_A396 The Structural Basis For The Altered Substrate Spec 2e-15
3zzj_A396 Structure Of An Engineered Aspartate Aminotransfera 2e-15
1g7x_A396 Aspartate Aminotransferase Active Site Mutant N194a 3e-15
1g4x_A396 Aspartate Aminotransferase Active Site Mutant N194a 3e-15
4f5h_A406 Intercoversion Of Substrate Specificity: E. Coli As 4e-15
2d61_A396 Aspartate Aminotransferase Mutant Ma With Maleic Ac 4e-15
2d66_A396 Aspartate Aminotransferase Mutant Mab Length = 396 4e-15
1toj_A396 Hydrocinnamic Acid-Bound Structure Of Srhept Mutant 5e-15
1toe_A396 Unliganded Structure Of Hexamutant + A293d Mutant O 7e-15
1tog_A396 Hydrocinnamic Acid-Bound Structure Of Srhept + A293 2e-14
3meb_A448 Structure Of Cytoplasmic Aspartate Aminotransferase 9e-14
3fsl_A397 Crystal Structure Of Tyrosine Aminotransferase Trip 9e-14
3tat_A397 Tyrosine Aminotransferase From E. Coli Length = 397 2e-13
1yoo_A396 Aspartate Aminotransferase Mutant Atb17 With Isoval 2e-13
1czc_A396 Aspartate Aminotransferase Mutant Atb17139S142N WIT 2e-13
2d5y_A396 Aspartate Aminotransferase Mutant Mc With Isovaleri 3e-13
2d64_A396 Aspartate Aminotransferase Mutant Mabc With Isovale 3e-13
1ay4_A394 Aromatic Amino Acid Aminotransferase Without Substr 3e-09
3uak_A406 Crystal Structure Of De Novo Designed Cysteine Este 2e-08
3k7y_A405 Aspartate Aminotransferase Of Plasmodium Falciparum 2e-06
>pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 Back     alignment and structure 
Iteration: 1

 Score =  132 bits (333), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 80/105 (76%)
Query: 20  DERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCI 79
           +ER+GNL++V KD+ ++  V SQ+  IVR  +SNPPS GARIV+  L +P+L+ +WK  +
Sbjct: 263 NERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNV 322
Query: 80  ETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRK 124
           +TM+ R+  MR  LR RLE L TPGTWNHIT+QIGMFS+TGLN K
Sbjct: 323 KTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPK 367
>pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 Back     alignment and structure
>pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 Back     alignment and structure
>pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 Back     alignment and structure
>pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 Back     alignment and structure
>pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 Back     alignment and structure
>pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 Back     alignment and structure
>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 Back     alignment and structure
>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 Back     alignment and structure
>pdb|4F4E|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Covalently Bound To Pyridoxal Phosphate Length = 420 Back     alignment and structure
>pdb|4EFF|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Length = 420 Back     alignment and structure
>pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 Back     alignment and structure
>pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 Back     alignment and structure
>pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 Back     alignment and structure
>pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 Back     alignment and structure
>pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 Back     alignment and structure
>pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 Back     alignment and structure
>pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 Back     alignment and structure
>pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 Back     alignment and structure
>pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 Back     alignment and structure
>pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 Back     alignment and structure
>pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 Back     alignment and structure
>pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 Back     alignment and structure
>pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 Back     alignment and structure
>pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 Back     alignment and structure
>pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 Back     alignment and structure
>pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 Back     alignment and structure
>pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 Back     alignment and structure
>pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 Back     alignment and structure
>pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 Back     alignment and structure
>pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 Back     alignment and structure
>pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 Back     alignment and structure
>pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 Back     alignment and structure
>pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 Back     alignment and structure
>pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 Back     alignment and structure
>pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 Back     alignment and structure
>pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 Back     alignment and structure
>pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 Back     alignment and structure
>pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 Back     alignment and structure
>pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 Back     alignment and structure
>pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 Back     alignment and structure
>pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 2e-57
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 6e-57
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 7e-57
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 1e-56
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 1e-56
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 1e-56
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 2e-56
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 2e-54
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 2e-54
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 2e-51
3rq1_A418 Aminotransferase class I and II; structural genomi 2e-49
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 2e-46
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 5e-33
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
 Score =  182 bits (463), Expect = 2e-57
 Identities = 60/105 (57%), Positives = 77/105 (73%)

Query: 20  DERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCI 79
           +ER+GNLT+V K+   I  V SQ+  IVR  +SNPP+ GARIV+  L++P L+ +W   +
Sbjct: 264 NERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNV 323

Query: 80  ETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRK 124
           +TM+ RI  MR  LR RLE L TPGTWNHIT+QIGMFS+TGLN K
Sbjct: 324 KTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPK 368
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.95
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.76
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.67
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.55
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.49
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.45
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.29
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.1
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.08
3rq1_A418 Aminotransferase class I and II; structural genomi 99.05
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.04
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.01
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 98.81
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 98.77
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 98.62
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 98.45
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 98.39
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 97.96
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 97.72
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 97.59
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 97.58
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 97.57
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 97.46
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 97.42
3nra_A407 Aspartate aminotransferase; structural genomics, j 97.39
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 97.34
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 97.3
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 97.17
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 97.13
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 97.08
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 97.05
3aow_A448 Putative uncharacterized protein PH0207; protein-P 97.02
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 96.97
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 96.86
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 96.83
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 96.82
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 96.81
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 96.77
1vp4_A425 Aminotransferase, putative; structural genomics, j 96.64
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 96.62
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 96.52
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 96.52
1xi9_A406 Putative transaminase; alanine aminotransferase, s 96.51
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 96.5
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 96.48
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 96.41
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 96.39
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 96.38
3ele_A398 Amino transferase; RER070207001803, structural gen 96.37
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 96.28
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 96.26
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 96.26
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 96.24
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 96.17
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 96.17
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 96.13
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 96.04
2z61_A370 Probable aspartate aminotransferase 2; amino acid 96.03
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 96.01
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 95.96
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 95.9
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 95.82
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 95.75
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 95.73
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 95.65
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 95.42
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 95.41
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 95.4
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 95.36
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 95.35
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 95.27
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 94.91
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 94.82
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 94.5
3ftb_A361 Histidinol-phosphate aminotransferase; structural 94.2
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 94.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 93.97
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 92.69
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 91.27
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 89.83
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 87.01
3twe_A27 Alpha4H; unknown function; HET: PGE; 1.36A {Synthe 85.93
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 83.05
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 80.99
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 80.61
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
Probab=99.95  E-value=7.8e-29  Score=206.23  Aligned_cols=112  Identities=42%  Similarity=0.763  Sum_probs=108.0

Q ss_pred             ccc-cccCCccceEEEEcCCCCcHHHHHHHHHHHHHhhcCCCcchHHHHHHHHhCCHhhHHHHHHHHHHHHHHHHHHHHH
Q psy9326          14 SYS-IPTDERIGNLTLVLKDKSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMRRG   92 (125)
Q Consensus        14 ~~~-~~ygeRvGal~vV~~~~~~a~~v~sql~~i~R~~yS~PP~~Ga~IV~~IL~dp~L~~~W~~EL~~m~~RI~~~R~~   92 (125)
                      ||. -+||+|+|++++++++.+.+.++.+++..++|++||+||.+|+++|..+|+||+|+++|++|++.|++|++.+|..
T Consensus       264 SK~~~~~G~RvG~~~~~~~~~~~~~~~~~~l~~~~r~~~s~~p~~~a~~~~~~l~d~~l~~~~~~~~~~m~~r~~~~R~~  343 (420)
T 4h51_A          264 SKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRT  343 (420)
T ss_dssp             TTTSCCGGGCEEEEEEECSCHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccccccCceEEEEecccCHHHHHHHHHHHHHhhhcccCcchHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            453 5799999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCccccccccceeecCCCCCC
Q psy9326          93 LRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF  125 (125)
Q Consensus        93 L~~~L~~~~~~~~w~~i~~Q~GMFs~~gLs~~q  125 (125)
                      |+++|++.+++++|+||..|.|||+|+||+++|
T Consensus       344 l~~~L~~~g~~~~~~~i~~q~GmF~~~gls~e~  376 (420)
T 4h51_A          344 VYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQ  376 (420)
T ss_dssp             HHHHHHHTTCSSCCTHHHHCCSSEEECCCCHHH
T ss_pred             HHHHHHHhCCCCCCCeecCCCceEEecCcCHHH
Confidence            999999999999999999999999999999864
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3twe_A Alpha4H; unknown function; HET: PGE; 1.36A {Synthetic} PDB: 3twf_A* 4g4m_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 2e-20
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 3e-20
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 2e-19
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 5e-19
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 4e-18
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 9e-18
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]

 Score = 82.7 bits (203), Expect = 2e-20
 Identities = 52/109 (47%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 21  ERIGNLTLVLKD----KSHIPAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWK 76
           ER+G   L L      K+  PAV SQ+  I+R+  SNPP++GA+IV+ +L  P L +QW 
Sbjct: 261 ERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWH 320

Query: 77  QCIETMSGRIKQMRRGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRKF 125
           + + TMS RI +MR  LR+ L KL TPG W+HI  Q GMFS+TGL  + 
Sbjct: 321 KDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQM 369
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.78
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.78
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.75
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.74
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.72
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.68
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 97.45
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.3
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 97.23
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 97.21
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.16
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 97.14
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 97.11
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 97.1
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 97.04
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 96.96
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 96.84
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 96.22
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 96.21
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 95.7
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 94.72
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 94.25
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 94.24
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 91.68
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 91.02
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 88.26
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 86.4
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]

Probab=99.78  E-value=3.7e-19  Score=143.17  Aligned_cols=110  Identities=46%  Similarity=0.787  Sum_probs=100.5

Q ss_pred             cccccCCccceEEEEcCCCCcH----HHHHHHHHHHHHhhcCCCcchHHHHHHHHhCCHhhHHHHHHHHHHHHHHHHHHH
Q psy9326          15 YSIPTDERIGNLTLVLKDKSHI----PAVKSQITLIVRAMYSNPPSHGARIVSLVLNNPRLYDQWKQCIETMSGRIKQMR   90 (125)
Q Consensus        15 ~~~~ygeRvGal~vV~~~~~~a----~~v~sql~~i~R~~yS~PP~~Ga~IV~~IL~dp~L~~~W~~EL~~m~~RI~~~R   90 (125)
                      ..-+||.|+|.+++..+..+..    +.+.+++...+|++|++||.+++.++..++.|+.++++|.++++.|+.+++++|
T Consensus       255 ~~~~~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~r  334 (412)
T d1yaaa_         255 NAGMYGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMR  334 (412)
T ss_dssp             TSCCGGGCEEEEEEECCSCTTHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccCcCceEEEEEchhhhhhHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHH
Confidence            3457999999999998776654    445566778899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCCCCccccccccceeecCCCCC
Q psy9326          91 RGLRERLEKLNTPGTWNHITEQIGMFSYTGLNRK  124 (125)
Q Consensus        91 ~~L~~~L~~~~~~~~w~~i~~Q~GMFs~~gLs~~  124 (125)
                      ..|++.|++.+.+++|+++..|.|||+++||+++
T Consensus       335 ~~l~~~L~~~g~~~~~~~~~~~gG~F~~~~ls~e  368 (412)
T d1yaaa_         335 HALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQ  368 (412)
T ss_dssp             HHHHHHHHHHTCSSCCTHHHHCCSSEEECCCCHH
T ss_pred             HHHHHHHHHhCCCCCCceeCCCceEEEecCcCHH
Confidence            9999999999999999999999999999999875
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure