Psyllid ID: psy9379

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSIPGHKERVEKEKDKGRIRSKERGEEEGKKKKGTGSLMKIRRTQGKKYWFCKMAMKSTCSSTDWTENSGT
cEEEEEEEcccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHcccccccHHHHHHcccccccccccccccccccHHHHHcccccccccccccccccccccccccEEEEccccEEEEEccccccccccccccccccc
cEEEEEEEEHcccccHHHHHHHHHHHHHHHHHHHHHEEEHHHHHHccccEEEEEEcccHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHEEEEEcccccccHHHHHHHHHHcccccccccccc
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNkegirwrhiefsdntlclqlvegkpngllcvlddqantHLLCTsflsipghkervekekdkgrirskergeeegkkkkgtgSLMKIRRTQGKKYWFCKMamkstcsstdwtensgt
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTsflsipghkervekekdkgrirskergeeegkkkkgtgslmkirrtqGKKYWFCKMAmkstcsstdwtensgt
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSIPGHKERVEKEKDkgrirskergeeegkkkkgTGSLMKIRRTQGKKYWFCKMAMKSTCSSTDWTENSGT
*YLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSI*****************************************QGKKYWFCKMAMK**************
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSIPGHKERVE*********************KGTGSLMKIRRTQGKKYWFCKMAMKSTCSST*W******
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSIPGHKE****************************SLMKIRRTQGKKYWFCKMAMKS*************
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSIPGHKERVEKEKDKGRIRSKERGEEEGKKKKGTGSLMKIRRTQGKKYWFCKMAMKSTCS**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANTHLLCTSFLSIPGHKERVEKEKDKGRIRSKERGEEEGKKKKGTGSLMKIRRTQGKKYWFCKMAMKSTCSSTDWTENSGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q9Z1N3 2626 Unconventional myosin-IXa yes N/A 0.422 0.025 0.602 6e-21
Q8C170 2542 Unconventional myosin-IXa no N/A 0.422 0.026 0.602 6e-21
B2RTY4 2548 Unconventional myosin-IXa yes N/A 0.422 0.026 0.602 7e-21
Q63358 1980 Unconventional myosin-IXb no N/A 0.472 0.038 0.530 8e-21
Q9QY06 2114 Unconventional myosin-IXb no N/A 0.472 0.035 0.530 9e-21
Q13459 2157 Unconventional myosin-IXb no N/A 0.422 0.031 0.602 1e-20
Q9QZZ4 3511 Unconventional myosin-XV no N/A 0.409 0.018 0.636 1e-19
Q9UKN7 3530 Unconventional myosin-XV no N/A 0.409 0.018 0.636 2e-19
Q9U1M8 2357 Myosin-I heavy chain OS=D yes N/A 0.416 0.028 0.567 1e-17
Q13402 2215 Unconventional myosin-VII no N/A 0.416 0.030 0.537 4e-17
>sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%)

Query: 15  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 74
           SFEQ CIN+ANE LQ+YFNQH+F+ EQEEY  EGI W +I++ DNT C+ L+  KP GLL
Sbjct: 548 SFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLISKKPTGLL 607

Query: 75  CVLDDQAN 82
            +LD+++N
Sbjct: 608 HLLDEESN 615
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho by stimulating it's GTPase activity in neurons, has a role in the regulation of neuronal morphology and function.
Rattus norvegicus (taxid: 10116)
>sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 Back     alignment and function description
>sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 Back     alignment and function description
>sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 Back     alignment and function description
>sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 Back     alignment and function description
>sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 Back     alignment and function description
>sp|Q9QZZ4|MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus GN=Myo15a PE=1 SV=2 Back     alignment and function description
>sp|Q9UKN7|MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens GN=MYO15A PE=1 SV=2 Back     alignment and function description
>sp|Q9U1M8|MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum GN=myoI PE=1 SV=1 Back     alignment and function description
>sp|Q13402|MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens GN=MYO7A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
189234985 1843 PREDICTED: similar to myosin-rhogap prot 0.422 0.036 0.852 3e-29
270002356 2021 hypothetical protein TcasGA2_TC001372 [T 0.422 0.033 0.852 3e-29
357623270 1062 hypothetical protein KGM_18974 [Danaus p 0.453 0.068 0.794 1e-28
328701263 1931 PREDICTED: myosin-IXb isoform 2 [Acyrtho 0.453 0.037 0.794 1e-28
328701265 1863 PREDICTED: myosin-IXb isoform 3 [Acyrtho 0.453 0.039 0.794 1e-28
328701267 1776 PREDICTED: myosin-IXb isoform 4 [Acyrtho 0.453 0.041 0.794 1e-28
328701269 1847 PREDICTED: myosin-IXb isoform 1 [Acyrtho 0.453 0.039 0.794 1e-28
242011074 783 myosin IIIB, putative [Pediculus humanus 0.422 0.086 0.838 1e-27
427791915 1463 Putative myosin class i heavy chain, par 0.453 0.049 0.739 1e-27
321455065 1839 hypothetical protein DAPPUDRAFT_64918 [D 0.422 0.036 0.794 1e-26
>gi|189234985|ref|XP_968193.2| PREDICTED: similar to myosin-rhogap protein, myr [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (92%)

Query: 15  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 74
           SFEQLCINYANEHLQYYFNQHVF+YEQEEY KEGIRW +I+F DNT CLQL+EGKPNGLL
Sbjct: 523 SFEQLCINYANEHLQYYFNQHVFKYEQEEYRKEGIRWNNIDFMDNTGCLQLIEGKPNGLL 582

Query: 75  CVLDDQAN 82
           C+LDDQ N
Sbjct: 583 CLLDDQCN 590

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270002356|gb|EEZ98803.1| hypothetical protein TcasGA2_TC001372 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357623270|gb|EHJ74495.1| hypothetical protein KGM_18974 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328701263|ref|XP_003241546.1| PREDICTED: myosin-IXb isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701265|ref|XP_003241547.1| PREDICTED: myosin-IXb isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701267|ref|XP_003241548.1| PREDICTED: myosin-IXb isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701269|ref|XP_001944223.2| PREDICTED: myosin-IXb isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242011074|ref|XP_002426282.1| myosin IIIB, putative [Pediculus humanus corporis] gi|212510345|gb|EEB13544.1| myosin IIIB, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427791915|gb|JAA61409.1| Putative myosin class i heavy chain, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|321455065|gb|EFX66210.1| hypothetical protein DAPPUDRAFT_64918 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
WB|WBGene00002040 1880 hum-7 [Caenorhabditis elegans 0.422 0.036 0.661 1.2e-20
UNIPROTKB|F1S9U2548 F1S9U2 "Uncharacterized protei 0.422 0.124 0.602 3.2e-20
UNIPROTKB|E2R266 2161 MYO9B "Uncharacterized protein 0.422 0.031 0.602 1.4e-19
UNIPROTKB|G3MXH1 1104 Bt.27781 "Uncharacterized prot 0.422 0.061 0.602 1.9e-19
UNIPROTKB|E1BS57 2001 Gga.50857 "Uncharacterized pro 0.422 0.033 0.602 1.9e-19
UNIPROTKB|E1C471 2031 Gga.50857 "Uncharacterized pro 0.422 0.033 0.602 2e-19
UNIPROTKB|E1C470 2140 Gga.50857 "Uncharacterized pro 0.422 0.031 0.602 2.1e-19
UNIPROTKB|H3BMM1 1301 MYO9A "Unconventional myosin-I 0.422 0.052 0.602 2.3e-19
UNIPROTKB|E1BNV7 2159 MYO9B "Uncharacterized protein 0.422 0.031 0.602 2.7e-19
UNIPROTKB|G3MXE8 1951 Bt.27781 "Uncharacterized prot 0.422 0.034 0.602 3.9e-19
WB|WBGene00002040 hum-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 1.2e-20, P = 1.2e-20
 Identities = 45/68 (66%), Positives = 58/68 (85%)

Query:    15 SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 74
             SFEQLCINYANE LQ YFNQH+FQ+EQEEY KEGI W +IE++DNT C+QL + KP G+L
Sbjct:   555 SFEQLCINYANEKLQSYFNQHIFQFEQEEYLKEGISWTNIEYTDNTECVQLFQSKPYGIL 614

Query:    75 CVLDDQAN 82
              ++D+++N
Sbjct:   615 RLVDEESN 622
GO:0007165 "signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003774 "motor activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016459 "myosin complex" evidence=IEA
GO:0060002 "plus-end directed microfilament motor activity" evidence=IDA
GO:0005516 "calmodulin binding" evidence=IPI
GO:0033275 "actin-myosin filament sliding" evidence=IDA
UNIPROTKB|F1S9U2 F1S9U2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R266 MYO9B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS57 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C471 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C470 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BMM1 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNV7 MYO9B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXE8 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9U1M8MYOI_DICDINo assigned EC number0.56710.41610.0284yesN/A
P32492MYO4_YEASTNo assigned EC number0.62680.40990.0448yesN/A
Q9Z1N3MYO9A_RATNo assigned EC number0.60290.42230.0258yesN/A
O74805MYO51_SCHPONo assigned EC number0.60600.40370.0441yesN/A
B2RTY4MYO9A_HUMANNo assigned EC number0.60290.42230.0266yesN/A
Q875X3MYO2A_NAUCCNo assigned EC number0.61190.40990.0421yesN/A
Q9V3Z6MYO7A_DROMENo assigned EC number0.54280.43470.0323yesN/A
Q29P71MYO7A_DROPSNo assigned EC number0.54280.43470.0322yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 2e-34
smart00242 677 smart00242, MYSc, Myosin 3e-33
cd00124 679 cd00124, MYSc, Myosin motor domain 4e-30
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 3e-28
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 7e-28
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 2e-27
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 5e-27
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 2e-26
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 5e-25
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 4e-24
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 4e-22
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 5e-22
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 1e-21
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-19
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 6e-11
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 4e-05
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information 
 Score =  126 bits (318), Expect = 2e-34
 Identities = 45/68 (66%), Positives = 55/68 (80%)

Query: 15  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 74
           SFEQLCINYANE LQYYFNQH+F+ EQEEY  EGI W +IE++DN  C+QL   KP GLL
Sbjct: 394 SFEQLCINYANEQLQYYFNQHIFKLEQEEYQGEGITWTNIEYTDNVGCIQLFSKKPTGLL 453

Query: 75  CVLDDQAN 82
            +LD+++N
Sbjct: 454 YLLDEESN 461

Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
PTZ00014 821 myosin-A; Provisional 100.0
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 100.0
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 100.0
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
KOG0164|consensus 1001 100.0
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 100.0
KOG0162|consensus 1106 100.0
KOG0161|consensus 1930 99.97
KOG0163|consensus 1259 99.96
KOG0160|consensus 862 99.96
KOG4229|consensus 1062 99.93
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information 
Probab=100.00  E-value=1.3e-39  Score=294.98  Aligned_cols=130  Identities=35%  Similarity=0.489  Sum_probs=114.3

Q ss_pred             CceecCcccCCCCchhhhhhhhhhhhhhHHHHHHhhhhhhHHHHhhhCCcccccccCChhhHHHHhhcCcCcccccchhh
Q psy9379           1 MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQ   80 (161)
Q Consensus         1 ilDi~GFE~f~~~N~feQl~iN~anE~Lq~~~~~~~f~~e~~~y~~EgI~~~~i~~~dn~~~ldLi~~~p~GLlslLDee   80 (161)
                      ||||||||+|. .|+||||||||||||||++|++++|+.||++|.+|||+|..|+|.||++|+|||+++|.|||+|||||
T Consensus       365 ILDIfGFE~f~-~NsfEQLcINyaNEkLQ~~f~~~vF~~eq~eY~~EgI~~~~i~f~dN~~~ldLi~~kp~Gil~lLdee  443 (677)
T cd01387         365 ILDIYGFEDLS-FNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQLDWTEIAFADNQPVINLISLKPYGILRILDDQ  443 (677)
T ss_pred             EEecCccccCC-CCCHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCcccCcCChHHHHHHHhcCCCchHHHHHHH
Confidence            79999999999 99999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hh-----hchHHHHHhhcCCCCCceeccCCC--CceEEee--------cccccccccccccccceE
Q psy9379          81 AN-----THLLCTSFLSIPGHKERVEKEKDK--GRIRSKE--------RGEEEGKKKKGTGSLMKI  131 (161)
Q Consensus        81 ~~-----d~~fl~kl~~~~~~~~~f~~~~~~--~~~~~~~--------~g~~~~~~~~~~~~l~~i  131 (161)
                      |+     |++|++|+...+++|+.|.+|+..  .|++.|+        .|+++||+|.++.++..+
T Consensus       444 ~~~p~~td~~~~~kl~~~~~~~~~~~~~~~~~~~F~I~HyAG~V~Y~~~gfleKN~D~l~~~~~~l  509 (677)
T cd01387         444 CCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDL  509 (677)
T ss_pred             hcCCCCchHHHHHHHHHhccCCccccCCCCCCCeeEEEEeCceeeecCCChHHhccchhhHHHHHH
Confidence            99     999999999999999999887642  2333333        344666666666665555

In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 2e-16
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 2e-16
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 3e-16
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 3e-16
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 3e-16
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 3e-16
1b7t_A 835 Myosin Digested By Papain Length = 835 3e-16
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 6e-16
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 1e-15
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-15
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 1e-15
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 1e-15
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 1e-15
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 1e-15
2y9e_X 758 Structural Basis For The Allosteric Interference Of 1e-15
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 1e-15
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-15
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 1e-15
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 1e-15
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 1e-15
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-15
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 1e-15
2y0r_X 758 Structural Basis For The Allosteric Interference Of 1e-15
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 1e-15
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 1e-15
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 1e-15
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-15
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 1e-15
2x9h_A695 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-15
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 2e-15
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-15
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-15
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-15
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-15
3mkd_A692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 2e-15
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 3e-15
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 3e-15
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 4e-14
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 5e-14
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-13
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 1e-13
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-13
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 1e-13
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-13
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 1e-13
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 1e-13
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 1e-12
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 1e-12
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 1e-12
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 1e-12
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 1e-12
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 1e-12
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 1e-12
2x51_A 789 M6 Delta Insert1 Length = 789 1e-12
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 1e-12
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 1e-12
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 1e-12
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 1e-12
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 2e-12
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 2e-12
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 50/67 (74%), Gaps = 2/67 (2%)
Query: 15  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFS-DNTLCLQLVEGKPNGL 73
           SFEQLCINY NE LQ +FN H+F  EQEEY KEGI+W  I+F  D  +C+ L+E KP G+
Sbjct: 473 SFEQLCINYTNERLQQFFNHHMFVLEQEEYKKEGIQWEFIDFGMDLQMCIDLIE-KPMGI 531
Query: 74  LCVLDDQ 80
           L +L+++
Sbjct: 532 LSILEEE 538
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 8e-36
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 3e-35
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 1e-33
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-33
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 9e-32
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 2e-31
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 3e-31
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-31
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 4e-31
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-29
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
 Score =  130 bits (328), Expect = 8e-36
 Identities = 30/66 (45%), Positives = 44/66 (66%)

Query: 15  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 74
           SFEQ CINY NE LQ +FN+ + + EQE Y KEG+    + + DN  C+ L+E +  G+L
Sbjct: 463 SFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGIL 522

Query: 75  CVLDDQ 80
            +LD++
Sbjct: 523 DILDEE 528
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
Probab=100.00  E-value=9.9e-41  Score=301.65  Aligned_cols=129  Identities=27%  Similarity=0.437  Sum_probs=113.4

Q ss_pred             CceecCcccCCCCchhhhhhhhhhhhhhHHHHHHhhhhhhHHHHhhhCCcccccccCChhhHHHHhhcCcCcccccchhh
Q psy9379           1 MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQ   80 (161)
Q Consensus         1 ilDi~GFE~f~~~N~feQl~iN~anE~Lq~~~~~~~f~~e~~~y~~EgI~~~~i~~~dn~~~ldLi~~~p~GLlslLDee   80 (161)
                      ||||||||+|+ .|+|||||||||||+||++|++++|+.||++|.+|||+|+.|+|.||++|+|||++||.|||+|||||
T Consensus       384 vLDI~GFE~f~-~NsFEQlcINy~NEkLQq~F~~~~f~~EqeeY~~EgI~w~~i~f~dN~~~idLie~kp~GilslLDEe  462 (697)
T 1lkx_A          384 ILDIYGFEVFQ-NNSFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLISLLDEA  462 (697)
T ss_dssp             EEECCCCCCCS-SBCHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCCCCCSCCCHHHHHTTSSSSSHHHHHHHH
T ss_pred             eeccccccccC-cCCHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHhcCCcccccCCCCCHHHHHHHhcccCChhhhhHHh
Confidence            69999999999 99999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hh-----hchHHHHHhhcCCCCCceeccCCCCceEEeecccccccccccccccceEEeecCceeeeeh
Q psy9379          81 AN-----THLLCTSFLSIPGHKERVEKEKDKGRIRSKERGEEEGKKKKGTGSLMKIRRTQGKKYWFCK  143 (161)
Q Consensus        81 ~~-----d~~fl~kl~~~~~~~~~f~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~i~h~~g~~~y~~~  143 (161)
                      |+     |.+|++||.+++++|+.|.+|+....             ......-|.|+||||.|.|++.
T Consensus       463 c~~p~~tD~~f~~kl~~~~~~~~~f~~~~~~~~-------------k~~~~~~F~I~HyAG~V~Y~~~  517 (697)
T 1lkx_A          463 CLIAKSTDQTFLDSICKQFEKNPHLQSYVVSKD-------------RSIGDTCFRLKHYAGDVTYDVR  517 (697)
T ss_dssp             HHSTTCCHHHHHHHHHHHSSSSTTEECTTTSCC-------------TTSCTTEEEEEETTEEEEEECT
T ss_pred             hCCCCCChHHHHHHHHHHhcCCCccccCCCCCC-------------CccccCceeeeeeeeEEEEccC
Confidence            98     99999999999999999988653211             0112345666666666666665
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 7e-17
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 3e-15
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 6e-15
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 1e-14
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 3e-14
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 4e-13
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]

 Score = 74.3 bits (182), Expect = 7e-17
 Identities = 32/66 (48%), Positives = 45/66 (68%)

Query: 15  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 74
           SFEQL IN+ NE LQ  F +   + EQEEY +EGI W++IE+ +N    +L+E KP GL+
Sbjct: 389 SFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLI 448

Query: 75  CVLDDQ 80
            +LD+ 
Sbjct: 449 SLLDEA 454
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]

Probab=100.00  E-value=2.3e-36  Score=271.06  Aligned_cols=132  Identities=27%  Similarity=0.420  Sum_probs=114.6

Q ss_pred             CceecCcccCCCCchhhhhhhhhhhhhhHHHHHHhhhhhhHHHHhhhCCcccccccCChhhHHHHhhcCcCcccccchhh
Q psy9379           1 MYLYLALNAFSDEISFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQ   80 (161)
Q Consensus         1 ilDi~GFE~f~~~N~feQl~iN~anE~Lq~~~~~~~f~~e~~~y~~EgI~~~~i~~~dn~~~ldLi~~~p~GLlslLDee   80 (161)
                      ||||||||+|+ .|+|||||||||||+||++|++++|..++++|.+|||+|+.++|.||++|++||+++|.|||++||||
T Consensus       376 iLDifGFE~f~-~NsfEQLcINyaNEkLq~~f~~~if~~e~~~Y~~EgI~~~~i~~~dN~~~l~li~~~~~Gil~lLdee  454 (684)
T d1lkxa_         376 ILDIYGFEVFQ-NNSFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLISLLDEA  454 (684)
T ss_dssp             EEECCCCCCCS-SBCHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCCCCCSCCCHHHHHTTSSSSSHHHHHHHH
T ss_pred             EeeccCCcCCC-CCcHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHhccCCCCCCCcCCchHHHHHHHhccchHHHHhHHH
Confidence            69999999999 99999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hh-----hchHHHHHhhcCCCCCceeccCCCCceEEeecccccccccccccccceEEeecCceeeeehhhh
Q psy9379          81 AN-----THLLCTSFLSIPGHKERVEKEKDKGRIRSKERGEEEGKKKKGTGSLMKIRRTQGKKYWFCKMAM  146 (161)
Q Consensus        81 ~~-----d~~fl~kl~~~~~~~~~f~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~i~h~~g~~~y~~~~~~  146 (161)
                      |+     |++|++||.+++++|+++..+.....             .......|.|+||+|.|.|+++-++
T Consensus       455 ~~~~~~tD~~~l~kl~~~~~~~~~~~~~~~~~~-------------~~~~~~~F~I~H~aG~V~Y~~~gfl  512 (684)
T d1lkxa_         455 CLIAKSTDQTFLDSICKQFEKNPHLQSYVVSKD-------------RSIGDTCFRLKHYAGDVTYDVRGFL  512 (684)
T ss_dssp             HHSTTCCHHHHHHHHHHHSSSSTTEECTTTSCC-------------TTSCTTEEEEEETTEEEEEECTTHH
T ss_pred             hcCCCCchHHHHHHHHHHhccCcccccCccCCC-------------CccCCCceEEecccCccccccccHH
Confidence            99     99999999999999988766533111             0112235777777777777776443
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure