Psyllid ID: psy9419
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 739 | 2.2.26 [Sep-21-2011] | |||||||
| Q8N2S1 | 1624 | Latent-transforming growt | yes | N/A | 0.646 | 0.294 | 0.296 | 5e-24 | |
| Q8K4G1 | 1666 | Latent-transforming growt | yes | N/A | 0.658 | 0.292 | 0.302 | 1e-22 | |
| A1A5Y0 | 811 | Protein kinase C-binding | no | N/A | 0.305 | 0.278 | 0.341 | 1e-19 | |
| P35555 | 2871 | Fibrillin-1 OS=Homo sapie | no | N/A | 0.721 | 0.185 | 0.263 | 1e-19 | |
| P98133 | 2871 | Fibrillin-1 OS=Bos taurus | no | N/A | 0.721 | 0.185 | 0.263 | 1e-19 | |
| Q9TV36 | 2871 | Fibrillin-1 OS=Sus scrofa | yes | N/A | 0.721 | 0.185 | 0.263 | 1e-19 | |
| Q61554 | 2871 | Fibrillin-1 OS=Mus muscul | no | N/A | 0.654 | 0.168 | 0.262 | 2e-18 | |
| A6QR11 | 816 | Protein kinase C-binding | no | N/A | 0.311 | 0.281 | 0.325 | 5e-18 | |
| Q5R3Z7 | 816 | Protein kinase C-binding | no | N/A | 0.311 | 0.281 | 0.325 | 2e-17 | |
| P46531 | 2555 | Neurogenic locus notch ho | no | N/A | 0.680 | 0.196 | 0.280 | 2e-17 |
| >sp|Q8N2S1|LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens GN=LTBP4 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 113 bits (283), Expect = 5e-24, Method: Compositional matrix adjust.
Identities = 182/614 (29%), Positives = 228/614 (37%), Gaps = 136/614 (22%)
Query: 37 GGAECVNIAGGVSYCACPKGFRPKEDG-YCEDVDECAESRHLCGPGAVCINHPGSYTCQC 95
G C++ G + CAC GFR G C DVDEC C PG C N PGS+ C C
Sbjct: 557 GPGRCISRPSGYT-CACDSGFRLSPQGTRCIDVDECRRVPPPCAPGR-CENSPGSFRCVC 614
Query: 96 PPNSSGDPLLGCTHARVQCSR-DADCDGPYERCVRA----ACVCPAPYYA--------DV 142
P P +C R CD RC CVCPA Y A DV
Sbjct: 615 GPGFRAGPRAAECLDVDECHRVPPPCD--LGRCENTPGSFLCVCPAGYQAAPHGASCQDV 672
Query: 143 NDGHKCKSPCERFSCGINAQCTPADPPQCTCLAGYTGEATLGCLDVDECLGVSPCASSAL 202
++ + C R +C + P +C C AG+ G A DVDEC P
Sbjct: 673 DECTQSPGLCGRGAC----KNLPGSF-RCVCPAGFRGSACE--EDVDECAQEPPPCGPGR 725
Query: 203 CVNEKGGFKCVCPKGTTGDPYTLGCVGSGSPRTECRVDKVGCLDVDECLGVSPCASSALC 262
C N G F C CP G G G+P C DVDEC P + C
Sbjct: 726 CDNTAGSFHCACPAG-------FRSRGPGAP----------CQDVDECARSPPPCTYGRC 768
Query: 263 VNEKGGFKCVCPKGTTGDPYTLGCVGSGSPRTECRVDKECSPSLQCRGGACVDPCRSVEC 322
N +G F+CVCP G P T G +EC EC L C G CV+ S +C
Sbjct: 769 ENTEGSFQCVCPMGF--QPNTAG--------SECEDVDECENHLACPGQECVNSPGSFQC 818
Query: 323 ---------------------------GAHALCEPQDHRASCRCELGYT--EGLNGKCVS 353
G H C + C C GY G G C
Sbjct: 819 RTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCAD 878
Query: 354 L---CEGIVCAPGAACIVTPAGPTCTCADGARGNPFPGGACYPDLCSATQPCPALSVCVA 410
+ EG C P C+ T CTCA G R P P GA C C +C +
Sbjct: 879 VNECLEGDFCFPHGECLNTDGSFACTCAPGYR--PGPRGAS----CLDVDECSEEDLCQS 932
Query: 411 GRCKARCAGVVCGAGAQCDPALDRCVCPPFYVGDPEFNCVPPVTMPVCIPPCGPNAHCEY 470
G C D + + C+CPP + P+ + + C
Sbjct: 933 GIC------------TNTDGSFE-CICPPGHRAGPDLASC------LDVDECRERGPALC 973
Query: 471 NSESPGSSPGSDN-ICVCNSGTHGNPYAGCGTAGPQDRGSC-DSGAGLCGPGAQCLETGG 528
S+ +SPGS + C+ G H P C D C + G +CG +C T G
Sbjct: 974 GSQRCENSPGSYRCVRDCDPGYHAGPEGTC-----DDVDECQEYGPEICG-AQRCENTPG 1027
Query: 529 SVECQCPAGYKGNPYVQCVGGSVECQCPAGYKGNPYVQCVDIDECWSSNTCGSNAVCINT 588
S C PA C GY+ P C D+DEC + + CG++AVC N
Sbjct: 1028 SYRCT-PA------------------CDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNL 1068
Query: 589 PGSYDCRCKEGNAG 602
PGS+ C C +G G
Sbjct: 1069 PGSFQCLCDQGYEG 1082
|
May be involved in the assembly, secretion and targeting of TGFB1 to sites at which it is stored and/or activated. May play critical roles in controlling and directing the activity of TGFB1. May have a structural role in the extra cellular matrix (ECM). Homo sapiens (taxid: 9606) |
| >sp|Q8K4G1|LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus GN=Ltbp4 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|A1A5Y0|NELL2_DANRE Protein kinase C-binding protein NELL2 OS=Danio rerio GN=nell2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|A6QR11|NELL2_BOVIN Protein kinase C-binding protein NELL2 OS=Bos taurus GN=NELL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R3Z7|NELL2_PONAB Protein kinase C-binding protein NELL2 OS=Pongo abelii GN=NELL2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 739 | ||||||
| 328714521 | 16577 | PREDICTED: hypothetical protein LOC10016 | 0.809 | 0.036 | 0.496 | 1e-170 | |
| 307204119 | 1785 | Neurogenic locus Notch protein [Harpegna | 0.813 | 0.336 | 0.472 | 1e-164 | |
| 157133851 | 3461 | hypothetical protein AaeL_AAEL012909 [Ae | 0.851 | 0.181 | 0.472 | 1e-163 | |
| 332028267 | 1784 | Fibrillin-1 [Acromyrmex echinatior] | 0.813 | 0.336 | 0.473 | 1e-163 | |
| 270013391 | 21117 | hypothetical protein TcasGA2_TC011986 [T | 0.809 | 0.028 | 0.466 | 1e-161 | |
| 312374879 | 3945 | hypothetical protein AND_15392 [Anophele | 0.811 | 0.152 | 0.461 | 1e-151 | |
| 442625922 | 14825 | dumpy, isoform X [Drosophila melanogaste | 0.807 | 0.040 | 0.440 | 1e-148 | |
| 386769088 | 15105 | dumpy, isoform J [Drosophila melanogaste | 0.807 | 0.039 | 0.440 | 1e-147 | |
| 386769086 | 15638 | dumpy, isoform I [Drosophila melanogaste | 0.807 | 0.038 | 0.440 | 1e-147 | |
| 194766193 | 2634 | GF23960 [Drosophila ananassae] gi|190617 | 0.807 | 0.226 | 0.442 | 1e-147 |
| >gi|328714521|ref|XP_003245382.1| PREDICTED: hypothetical protein LOC100166039 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 603 bits (1556), Expect = e-170, Method: Compositional matrix adjust.
Identities = 346/697 (49%), Positives = 427/697 (61%), Gaps = 99/697 (14%)
Query: 5 QCNTLECQCRPPYQIVAGECTLATCGTQGQCPGGAECVNIAGGVSYCACPKGFRPKEDGY 64
+CN+LECQCRPPYQIV GECTLA C +G+CP GAEC++IAGGVSYCACPKG+RP+EDG
Sbjct: 915 ECNSLECQCRPPYQIVNGECTLAGC-NKGKCPAGAECMSIAGGVSYCACPKGYRPREDGS 973
Query: 65 CEDVDECAESRHLCGPGAVCINHPGSYTCQCPPNSSGDPLLGCTHARVQCSRDADCDGPY 124
C DVDEC E H CG GA CIN PG++ C CP SGDP GC+ ++ +C +D+DC
Sbjct: 974 CYDVDECEEKIHSCGYGAECINKPGTHECLCPDGYSGDPHHGCSRSQKKCIKDSDCLL-N 1032
Query: 125 ERCVR-AACVCPAPYYADVNDGHKCKSPCERFSCGINAQCTPADPPQCTCLAGYTGEATL 183
E C++ CVCP PYY DV D +CKSPC+RF CG+NAQCTP+DPP
Sbjct: 1033 ENCIQPGVCVCPVPYYTDVLDNDRCKSPCDRFPCGVNAQCTPSDPP-------------- 1078
Query: 184 GCLDVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDPYTLGCVGSGSPRTECRVDKVG 243
KC+C G GDP G
Sbjct: 1079 ---------------------------KCLCLPGYKGDPLH------------------G 1093
Query: 244 CLDVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDPYTLGCVGSGSPRTECRVDKECS 303
C DVDEC +PCA + C+NEKG +KC+CP GT GDPY++GC+G +P EC D EC
Sbjct: 1094 CEDVDECKD-NPCALGSQCINEKGHYKCICPLGTNGDPYSVGCLGKEAPEFECSTDDECV 1152
Query: 304 PSLQCRGGACVDPCRSVECGAHALCEPQDHRASCRCELGYTEGLNGKCVSLCEGIVCAPG 363
L C G C +PC + CG +A CE + H A CRC GY E + G+CVS C+G +C G
Sbjct: 1153 AQLACVKGTCTNPCSLLPCGQNAYCESEKHAAWCRCSAGYVESIFGECVSPCDGYICGHG 1212
Query: 364 AACIVTPAGPTCTCADGARGNPFPGGACYPDLCSATQPCPALSVCVAGRCKARCAGVVCG 423
A CIV+ GPTC C +G+ GNPF GG+C PD+CS+T C A ++CVAGRCK +C CG
Sbjct: 1213 AQCIVSAQGPTCKCLEGSIGNPFAGGSCEPDVCSSTSLCVAPNICVAGRCKEKCQDHFCG 1272
Query: 424 AGAQCDPALDRCVCPPFYVGDPEFNCVPPVTMPVCIPPCGPNAHCEYNSESPGSSPGSDN 483
GA C+ + CVC P ++GDP + C+PP+TMP C P CG NAHCEY+ ++N
Sbjct: 1273 IGASCNHETNECVCNPLFIGDPNYLCMPPITMPSCYPGCGINAHCEYDVL-------NEN 1325
Query: 484 ICVCNSGTHGNPYAGCGTAGPQDRGSCDSGAGLCGPGAQCLETGGSVECQCPAGYKGNPY 543
CVCNSG GNPY C + Q + SC + CG GA C E S+EC CP+G+KGNPY
Sbjct: 1326 KCVCNSGFIGNPYHECDS---QSKKSCSNMT--CGTGALCKEKLNSIECNCPSGFKGNPY 1380
Query: 544 VQCVGGSVECQCPAGYKGNPYVQCVDIDECWSSNTCGSNAVCINTPGSYDCRCKEGNAGN 603
VQ CVDIDEC S CG+NAVCINT GSYDCRC EG GN
Sbjct: 1381 VQ---------------------CVDIDECLIS-ACGNNAVCINTIGSYDCRCIEGYVGN 1418
Query: 604 PFVACTPVAVVPHSCEDPATCVCSKNAPCPSGYVCKNSRCTDLCANVRCGPRALCVQGQC 663
PF+ C+ A P C DP TC CSKN PCP G+ CK+ +C + C N++CG RA CV G+C
Sbjct: 1419 PFLECS--AKTPQICYDPLTCQCSKNVPCPVGFACKHGKCENQCDNIKCGLRAGCVFGKC 1476
Query: 664 LCPSDLIGNPTDLTRGCQVKGQCANDLECKPNEICFQ 700
+CP LIG+P + GC+ +GQC ND +CK EICF
Sbjct: 1477 VCPPGLIGDPYNFKTGCKAQGQCTNDGDCKDTEICFH 1513
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307204119|gb|EFN82988.1| Neurogenic locus Notch protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|157133851|ref|XP_001663040.1| hypothetical protein AaeL_AAEL012909 [Aedes aegypti] gi|108870664|gb|EAT34889.1| AAEL012909-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|332028267|gb|EGI68314.1| Fibrillin-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|270013391|gb|EFA09839.1| hypothetical protein TcasGA2_TC011986 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|312374879|gb|EFR22350.1| hypothetical protein AND_15392 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|442625922|ref|NP_001260039.1| dumpy, isoform X [Drosophila melanogaster] gi|440213324|gb|AGB92575.1| dumpy, isoform X [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|386769088|ref|NP_001245876.1| dumpy, isoform J [Drosophila melanogaster] gi|383291324|gb|AFH03552.1| dumpy, isoform J [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|386769086|ref|NP_001245875.1| dumpy, isoform I [Drosophila melanogaster] gi|383291323|gb|AFH03551.1| dumpy, isoform I [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194766193|ref|XP_001965209.1| GF23960 [Drosophila ananassae] gi|190617819|gb|EDV33343.1| GF23960 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 739 | ||||||
| FB|FBgn0053196 | 22 | dp "dumpy" [Drosophila melanog | 0.872 | 29.31 | 0.331 | 1.8e-101 | |
| MGI|MGI:1321395 | 1666 | Ltbp4 "latent transforming gro | 0.726 | 0.322 | 0.317 | 8.7e-63 | |
| UNIPROTKB|E1BA44 | 1627 | E1BA44 "Uncharacterized protei | 0.729 | 0.331 | 0.315 | 1.1e-60 | |
| UNIPROTKB|G3MZT8 | 1658 | G3MZT8 "Uncharacterized protei | 0.729 | 0.325 | 0.315 | 1.2e-60 | |
| RGD|1307033 | 1663 | Ltbp4 "latent transforming gro | 0.752 | 0.334 | 0.317 | 3.9e-58 | |
| UNIPROTKB|D4A917 | 1664 | D4A917 "Uncharacterized protei | 0.752 | 0.334 | 0.317 | 3.9e-58 | |
| UNIPROTKB|Q8N2S1 | 1624 | LTBP4 "Latent-transforming gro | 0.721 | 0.328 | 0.319 | 8.5e-57 | |
| UNIPROTKB|F1PDK5 | 1504 | LTBP4 "Uncharacterized protein | 0.729 | 0.358 | 0.308 | 1e-55 | |
| UNIPROTKB|F1PDK1 | 1650 | LTBP4 "Uncharacterized protein | 0.729 | 0.326 | 0.308 | 1.7e-55 | |
| UNIPROTKB|E7EUU1 | 1556 | LTBP4 "Latent-transforming gro | 0.719 | 0.341 | 0.317 | 2.8e-53 |
| FB|FBgn0053196 dp "dumpy" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 985 (351.8 bits), Expect = 1.8e-101, Sum P(2) = 1.8e-101
Identities = 244/735 (33%), Positives = 328/735 (44%)
Query: 11 CQCRPPYQIVA--GECT-LATCGTQ-GQ--CPGGAECVNIAGGVSY-CACPKGFRPKEDG 63
C CR Y+ + G+C + C Q G+ C A C N+ G SY C CP+G
Sbjct: 899 CICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPG--SYECRCPQGHNGNPFI 956
Query: 64 YCE--DVDEC-AESRH-LCGPGAVCINHPGSYTC----QCPPNSSGDPLLGCTHARVQCS 115
CE + EC +S + L G V C +C + G C Q
Sbjct: 957 MCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKG-YQTQ 1015
Query: 116 RDADCDGPYERCVRAACVCPAPYYADVNDG-HKCKSPCERFSCGINAQCTPADPPQCTCL 174
D C E R A +C G + C P N C A Q C
Sbjct: 1016 PDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALA---QRKCA 1072
Query: 175 AGYTGEATLGCLDVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDPYTLGCVGSGSPR 234
A A C+ EC+ P L + K C + G C S P+
Sbjct: 1073 ADRECAANEKCIQPGECVCPPPYF---LDPQDNNKCKSPCERFPCG--INAKCTPSDPPQ 1127
Query: 235 TECRV----DKV-GCLDVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDPYTLGCV-G 288
C D + GC D DEC + PCA A CVN+KGG++CVCPK TGDPY GC+
Sbjct: 1128 CMCEAGFKGDPLLGCTDEDECSHL-PCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFE 1186
Query: 289 SGSPRTECRVDKECSPSLQCRGGACVDPCRSVECGAHALCEPQDHRASCRCELGYTEGLN 348
SG+P+++C + +C+ +L C G+CV PC S+ CG++A CE + H CRC +GY + +
Sbjct: 1187 SGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGD 1246
Query: 349 GKCVSLCEGIVCAPGAACIVTPAGPTCTCADGARGNPFPGGACYPDLCSATQPCPALSVC 408
G CVS C+ ++C GA CI T GPTC C G GNPFPGG+C D CSA +PC +C
Sbjct: 1247 GDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQIC 1306
Query: 409 VAGRCKARXXXXXXXXXXQCDPALDRCVCPPFYVGDPEFNCVPPVTMPVCIPPCGPNAHC 468
+ GRCK R CD +C+C P +VG+P+ C+PP+ C P CG NAHC
Sbjct: 1307 INGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHC 1366
Query: 469 EYNSESPGSSPGSDNICVCNSGTHGNPYAGCGTAGPQDRGSCDSGAGLCGPGAQCLETGG 528
EY G S C CN GT GNPY GCG Q + C + CGP A+C G
Sbjct: 1367 EYGL---GQSR-----CACNPGTFGNPYEGCGA---QSKNVCQPNS--CGPNAECRAVGN 1413
Query: 529 SVECQCPAGYKGNPYVQCV-------------------GGSVECQCPAGYKGNPYVQCVD 569
+ C CP G+ GNPY+ C G EC C +G+ GNPY C
Sbjct: 1414 HISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQP 1473
Query: 570 IDE--CWSSNTCGSNAVCINTPGSYDCRCKEGNAGNPFVACTPVAVVPHSCEDPATCVCS 627
I+ C +N C N + P Y C+ +G N C+ + P + D C+C
Sbjct: 1474 IESKFCQDANKCQCNER-VECPEGYSCQ--KGQCKN---LCSQASCGPRAICDAGNCIC- 1526
Query: 628 KNAPCPSGYVCKNSRCTDLCA-NVRCGPRALCVQGQCLCPSDLIGNPTDLTRGCQVKGQC 686
P GY+ C+ +CG A C+ + +C L +G +
Sbjct: 1527 -----PMGYIGDPHDQVHGCSIRGQCGNDADCLHSE-IC--------FQLGKGLRKCVDA 1572
Query: 687 ANDLECKPNEICFQE 701
+ ++C PN +C E
Sbjct: 1573 CSKIQCGPNALCVSE 1587
|
|
| MGI|MGI:1321395 Ltbp4 "latent transforming growth factor beta binding protein 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BA44 E1BA44 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MZT8 G3MZT8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1307033 Ltbp4 "latent transforming growth factor beta binding protein 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A917 D4A917 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N2S1 LTBP4 "Latent-transforming growth factor beta-binding protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDK5 LTBP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDK1 LTBP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EUU1 LTBP4 "Latent-transforming growth factor beta-binding protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 739 | |||
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 4e-05 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 5e-05 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 1e-04 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 2e-04 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 2e-04 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 2e-04 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 5e-04 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 5e-04 |
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
Score = 41.1 bits (97), Expect = 4e-05
Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
Query: 67 DVDECAESRHLCGPGAVCINHPGSYTCQCPP 97
D+DECA S + C G C+N GSY C+CPP
Sbjct: 1 DIDECA-SGNPCQNGGTCVNTVGSYRCECPP 30
|
Length = 39 |
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 739 | |||
| KOG1214|consensus | 1289 | 99.68 | ||
| KOG1214|consensus | 1289 | 99.66 | ||
| KOG1217|consensus | 487 | 99.66 | ||
| KOG1217|consensus | 487 | 99.64 | ||
| KOG4289|consensus | 2531 | 99.61 | ||
| KOG4289|consensus | 2531 | 99.57 | ||
| KOG1219|consensus | 4289 | 99.28 | ||
| KOG1219|consensus | 4289 | 99.2 | ||
| KOG1225|consensus | 525 | 99.15 | ||
| KOG0994|consensus | 1758 | 99.09 | ||
| KOG1225|consensus | 525 | 99.09 | ||
| KOG0994|consensus | 1758 | 98.98 | ||
| KOG4260|consensus | 350 | 98.85 | ||
| KOG4260|consensus | 350 | 98.56 | ||
| KOG1836|consensus | 1705 | 98.36 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.24 | |
| KOG1836|consensus | 1705 | 98.03 | ||
| KOG1226|consensus | 783 | 97.89 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.87 | |
| KOG1226|consensus | 783 | 97.82 | ||
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 97.54 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 97.47 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.41 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.4 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.38 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.33 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.24 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 97.16 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.02 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 96.84 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 96.61 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 96.31 | |
| KOG1218|consensus | 316 | 96.01 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 95.91 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 95.89 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 95.79 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.79 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.44 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 95.31 | |
| KOG1218|consensus | 316 | 95.21 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 94.91 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 94.04 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 92.82 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 91.63 | |
| smart00051 | 63 | DSL delta serrate ligand. | 91.25 | |
| PF01683 | 52 | EB: EB module; InterPro: IPR006149 The EB domain h | 87.01 | |
| smart00051 | 63 | DSL delta serrate ligand. | 84.73 | |
| PF01683 | 52 | EB: EB module; InterPro: IPR006149 The EB domain h | 82.55 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 82.51 | |
| PTZ00214 | 800 | high cysteine membrane protein Group 4; Provisiona | 82.2 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 80.61 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 80.46 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 80.31 |
| >KOG1214|consensus | Back alignment and domain information |
|---|
Probab=99.68 E-value=3.3e-15 Score=163.01 Aligned_cols=236 Identities=27% Similarity=0.596 Sum_probs=161.3
Q ss_pred CCCCCCCeeeccCC-ceEeeCCCCCcCCCCCCCccCCCCCCcccccCCCCcccCCCCC-CCCCCCCCCeeeecCCceEEe
Q psy9419 195 SPCASSALCVNEKG-GFKCVCPKGTTGDPYTLGCVGSGSPRTECRVDKVGCLDVDECL-GVSPCASSALCVNEKGGFKCV 272 (739)
Q Consensus 195 ~~C~~~~~C~n~~g-~~~C~C~~Gy~g~~~~~~C~~~~~~~~~c~~~~~~C~d~~eC~-~~~~C~~~~~C~~~~g~~~C~ 272 (739)
+-|..++.|....+ .|+|.|..||.|++ ..|.|++||+ ..+.|..+++|++.+|+|+|.
T Consensus 700 h~cdt~a~C~pg~~~~~tcecs~g~~gdg-------------------r~c~d~~eca~~~~~CGp~s~Cin~pg~~rce 760 (1289)
T KOG1214|consen 700 HMCDTTARCHPGTGVDYTCECSSGYQGDG-------------------RNCVDENECATGFHRCGPNSVCINLPGSYRCE 760 (1289)
T ss_pred cccCCCccccCCCCcceEEEEeeccCCCC-------------------CCCCChhhhccCCCCCCCCceeecCCCceeEE
Confidence 44666677776543 68999999999976 4578999997 568899999999999999999
Q ss_pred CCCCCCCCCCCccccCCCC--CCCccccCCCCCCCCCCCCCcccCCCCCCCCCCC--cccccC-CCCceeecCCCceeCC
Q psy9419 273 CPKGTTGDPYTLGCVGSGS--PRTECRVDKECSPSLQCRGGACVDPCRSVECGAH--ALCEPQ-DHRASCRCELGYTEGL 347 (739)
Q Consensus 273 C~~Gy~g~~c~~~c~~~~~--~~~~C~~~~~C~~~~~C~~g~C~~~C~~~~C~~~--~~C~~~-~g~~~C~C~~G~~g~~ 347 (739)
|..||.......+|+.+.. ....|++. +..|... +.|+.. .+.|+|.|.|||.|+.
T Consensus 761 C~~gy~F~dd~~tCV~i~~pap~n~Ce~g-------------------~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGDG 821 (1289)
T KOG1214|consen 761 CRSGYEFADDRHTCVLITPPAPANPCEDG-------------------SHTCAIAGQARCVHHGGSTYSCACLPGFSGDG 821 (1289)
T ss_pred EeecceeccCCcceEEecCCCCCCccccC-------------------ccccCcCCceEEEecCCceEEEeecCCccCCc
Confidence 9999987766666765432 22223222 1234433 344443 3479999999999976
Q ss_pred CCc-cccCCCCCCCCCCCeeecCCCCCeeecCCCCccCCCCCCCccCCCCCCCCCCCCCCcccCCCccCCCCCCCCCCCc
Q psy9419 348 NGK-CVSLCEGIVCAPGAACIVTPAGPTCTCADGARGNPFPGGACYPDLCSATQPCPALSVCVAGRCKARCAGVVCGAGA 426 (739)
Q Consensus 348 ~~~-c~~~C~~~~C~~~~~C~~~~~~~~C~C~~Gy~g~~~~g~~C~~~~C~~~~~C~~~~~C~~~~C~~~C~~~~C~~~~ 426 (739)
-.- .+|+|+++.|..+|.|.++++++.|+|.+||.|+.+ .|.+++- ...+|... +-..+.|+..+
T Consensus 822 ~~c~dvDeC~psrChp~A~CyntpgsfsC~C~pGy~GDGf---~CVP~~~-~~T~C~~e----------r~hpl~chg~t 887 (1289)
T KOG1214|consen 822 HQCTDVDECSPSRCHPAATCYNTPGSFSCRCQPGYYGDGF---QCVPDTS-SLTPCEQE----------RFHPLQCHGST 887 (1289)
T ss_pred cccccccccCccccCCCceEecCCCcceeecccCccCCCc---eecCCCc-cCCccccc----------cccceeecccc
Confidence 332 368999999999999999999999999999999944 7766421 11233221 01122344444
Q ss_pred ee----cCCCCcccCCCCccCCCCccccCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCceeecCC
Q psy9419 427 QC----DPALDRCVCPPFYVGDPEFNCVPPVTMPVCIPPCGPNAHCEYNSESPGSSPGSDNICVCNS 489 (739)
Q Consensus 427 ~C----~~~~~~C~C~~g~~g~~~~~C~~~~~~~~C~~~C~~~~~C~~~~~~~~~~~~~~~~C~C~~ 489 (739)
.| ++..+++.+.++=.|++...|..... .. ...|..+|.+..... .+.++.|.|..
T Consensus 888 ~~~~~~Dp~~~e~p~~~~ppG~~~~~c~~~~~-~~-vp~Cd~hgh~ap~qc-----hG~~~~CwCvd 947 (1289)
T KOG1214|consen 888 GFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPE-QY-VPQCDDHGHFAPLQC-----HGKSDFCWCVD 947 (1289)
T ss_pred ceeEeeCCCcccCCCCCCCCCCCCCCCCCccc-cc-CCCcccccccccccc-----CCCcceeEEec
Confidence 33 24567888888777776556654321 11 236778888876652 23558899976
|
|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >PTZ00214 high cysteine membrane protein Group 4; Provisional | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 739 | ||||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 2e-07 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 1e-04 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 3e-07 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 2e-04 | ||
| 2w86_A | 147 | Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 | 1e-05 | ||
| 2w86_A | 147 | Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 | 6e-04 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 4e-05 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 5e-05 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 2e-04 | ||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 5e-05 | ||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 5e-05 | ||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 2e-04 | ||
| 2bo2_A | 143 | Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst | 6e-05 | ||
| 2bo2_A | 143 | Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst | 1e-04 | ||
| 3p5c_L | 440 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 1e-04 | ||
| 3p5c_L | 440 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 1e-04 | ||
| 3p5c_L | 440 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 4e-04 | ||
| 3p5b_L | 400 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 1e-04 | ||
| 3p5b_L | 400 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 1e-04 | ||
| 3p5b_L | 400 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 5e-04 | ||
| 1emn_A | 82 | Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide | 2e-04 | ||
| 1hz8_A | 82 | Solution Structure And Backbone Dynamics Of A Conca | 3e-04 | ||
| 1z6c_A | 87 | Solution Structure Of An Egf Pair (Egf34) From Vita | 3e-04 | ||
| 1hj7_A | 80 | Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep | 3e-04 | ||
| 1hj7_A | 80 | Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep | 4e-04 | ||
| 1hj7_A | 80 | Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep | 4e-04 | ||
| 2w2m_E | 107 | Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = | 3e-04 | ||
| 2w2m_E | 107 | Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = | 4e-04 | ||
| 2w2n_E | 107 | Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr | 4e-04 | ||
| 2w2n_E | 107 | Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr | 5e-04 | ||
| 3bps_E | 83 | Pcsk9:egf-a Complex Length = 83 | 4e-04 | ||
| 3bps_E | 83 | Pcsk9:egf-a Complex Length = 83 | 4e-04 | ||
| 3gcw_E | 83 | Pcsk9:egfa(H306y) Length = 83 | 4e-04 | ||
| 3gcw_E | 83 | Pcsk9:egfa(H306y) Length = 83 | 4e-04 |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
|
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
| >pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 | Back alignment and structure |
| >pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 | Back alignment and structure |
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
| >pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 | Back alignment and structure |
| >pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 | Back alignment and structure |
| >pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 | Back alignment and structure |
| >pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 | Back alignment and structure |
| >pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 | Back alignment and structure |
| >pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 | Back alignment and structure |
| >pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 | Back alignment and structure |
| >pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 | Back alignment and structure |
| >pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 | Back alignment and structure |
| >pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 | Back alignment and structure |
| >pdb|1Z6C|A Chain A, Solution Structure Of An Egf Pair (Egf34) From Vitamin K- Dependent Protein S Length = 87 | Back alignment and structure |
| >pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 | Back alignment and structure |
| >pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 | Back alignment and structure |
| >pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 | Back alignment and structure |
| >pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 | Back alignment and structure |
| >pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 | Back alignment and structure |
| >pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 | Back alignment and structure |
| >pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 | Back alignment and structure |
| >pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 | Back alignment and structure |
| >pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 | Back alignment and structure |
| >pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 | Back alignment and structure |
| >pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
Score = 71.2 bits (175), Expect = 1e-14
Identities = 40/221 (18%), Positives = 62/221 (28%), Gaps = 62/221 (28%)
Query: 67 DVDECAESRHLCGPGAVCINHPGSYTCQCPPNSSGDPLLGCTHARVQCSRDADCDGPYER 126
DV+EC + C+N PGSY C CPP+
Sbjct: 2 DVNECLDPTTCI--SGNCVNTPGSYICDCPPD---------------------------- 31
Query: 127 CVRAACVCPAPYYADVNDGHKCKSPCERFSCGINAQCTPADP-PQCTCLAGYTGEATLGC 185
+ C +C ++ + + C+ G C
Sbjct: 32 ------------FELNPTRVGCVDTRSG-NCYLDIRPRGDNGDTACSNEIGVGVSKASCC 78
Query: 186 LDVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDPYTLGCVGSGSPRTECRVDKVGCL 245
+ + G +PC + C +G +P V
Sbjct: 79 CSLGKAWG-TPCEMCPAVNTSEYKILCPGGEGFRPNP-----------------ITVILE 120
Query: 246 DVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDPYTLGC 286
D+DEC + C+N G F+C CP G + T C
Sbjct: 121 DIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVC 161
|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 739 | |||
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.81 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.8 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.79 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.79 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.78 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.78 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.68 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.68 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.67 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.66 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.66 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.66 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.66 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.65 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.61 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.59 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.58 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.58 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.56 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.54 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.48 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.44 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.4 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.37 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.34 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.3 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.29 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.27 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.26 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.26 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.22 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.22 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.2 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.19 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.17 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.16 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.09 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.06 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.06 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.02 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.98 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.97 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.95 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.94 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.88 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.85 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.84 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.84 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.83 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.81 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.8 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.79 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.68 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.67 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.65 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.65 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.51 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.44 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.4 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.39 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.37 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.32 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.25 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.21 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.18 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.11 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.04 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.0 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.77 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.71 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.69 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.63 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.63 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.56 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.5 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.48 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.47 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.45 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.41 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.39 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.34 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.33 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.32 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.31 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.3 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.29 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.25 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.15 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.08 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 97.03 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.01 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 96.91 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 96.9 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 96.88 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.82 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 96.79 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 96.65 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.54 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 96.54 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 96.53 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 96.53 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.47 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.35 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 96.29 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.18 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 95.85 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 95.27 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 94.89 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 94.88 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 94.51 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 94.5 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 94.3 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 94.13 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 94.1 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 93.96 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 92.75 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 92.74 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 91.87 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 90.96 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 90.91 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 90.59 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 89.9 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 89.81 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 89.73 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 88.68 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 88.61 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 88.57 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 88.3 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 88.18 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 87.84 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 87.27 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 87.22 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 86.74 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 86.32 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 86.02 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 85.3 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 85.16 | |
| 1b9w_A | 95 | Protein (merozoite surface protein 1); MSP-1, cand | 85.15 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 84.16 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 84.02 | |
| 1oig_A | 26 | Dumpy, CG33196-PB; structural protein; NMR {Drosop | 83.96 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 83.69 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 83.65 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 83.62 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 80.74 |
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
Probab=99.81 E-value=9.1e-20 Score=167.81 Aligned_cols=122 Identities=35% Similarity=0.819 Sum_probs=102.3
Q ss_pred CcccccccCCCCCCCCCCceeeCCCCceeeCCCCCcCCCCCCCccCCCCCC-CCCCCCCCCCCccCccccCCCCccccCC
Q psy9419 65 CEDVDECAESRHLCGPGAVCINHPGSYTCQCPPNSSGDPLLGCTHARVQCS-RDADCDGPYERCVRAACVCPAPYYADVN 143 (739)
Q Consensus 65 C~dideC~~~~~~C~~~~~C~n~~gsy~C~C~~Gy~g~~~~~C~~~~~~C~-~~~~C~~~~~~C~~~~C~C~~g~~g~~~ 143 (739)
|+|||||+..+++|.++|+|+++.++|+|+|++||+|.. |+ ++++|
T Consensus 2 c~dideC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~G~~----------C~~~~~~C----------------------- 48 (135)
T 2vj3_A 2 AQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPR----------CEIDVNEC----------------------- 48 (135)
T ss_dssp -CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEESTT----------SCEECCTT-----------------------
T ss_pred CcccccccCCCCCCCCCCEeECCCCCEEEECCCCCcCCc----------ccccCccC-----------------------
Confidence 679999997778999999999999999999999999973 32 33333
Q ss_pred CCCCccCCCCCCCCCCCceeccC-CCCeeeCCCCCccCCCCCCcccCCCCCCCCCCCCCeeeccCCceEeeCCCCCcCCC
Q psy9419 144 DGHKCKSPCERFSCGINAQCTPA-DPPQCTCLAGYTGEATLGCLDVDECLGVSPCASSALCVNEKGGFKCVCPKGTTGDP 222 (739)
Q Consensus 144 ~~~~C~~~C~~~~C~~~~~C~~~-~~~~C~C~~Gy~g~~~~~C~~i~eC~~~~~C~~~~~C~n~~g~~~C~C~~Gy~g~~ 222 (739)
...+|.++++|++. ++|+|+|++||+|..++ .++++|.. ++|.++++|+++.++|+|+|++||+|..
T Consensus 49 ---------~~~~C~~~~~C~~~~g~~~C~C~~G~~G~~C~--~~~~~C~~-~~C~~~g~C~~~~g~~~C~C~~G~~G~~ 116 (135)
T 2vj3_A 49 ---------VSNPCQNDATCLDQIGEFQCICMPGYEGVHCE--VNTDECAS-SPCLHNGRCLDKINEFQCECPTGFTGHL 116 (135)
T ss_dssp ---------TTCCCCSSCEEEECSSCEEEECCTTEESSSSC--EECCTTTT-CCSTTTCEEEECSSCEEEECCTTEESSS
T ss_pred ---------CCCCCCCCCEEeCCCCCceeeCCCCCcCCcce--ecCCcccC-CCcCCCCEeECCCCCeEEECCCCCcCCc
Confidence 34578889999986 78999999999998765 68999997 8999999999999999999999999976
Q ss_pred CCCCccCCCCCCcccccCCCCcccCCCCC
Q psy9419 223 YTLGCVGSGSPRTECRVDKVGCLDVDECL 251 (739)
Q Consensus 223 ~~~~C~~~~~~~~~c~~~~~~C~d~~eC~ 251 (739)
|+ ++|++|.
T Consensus 117 ----C~----------------~~i~~C~ 125 (135)
T 2vj3_A 117 ----CQ----------------VDLHHIL 125 (135)
T ss_dssp ----SC----------------EECC---
T ss_pred ----cC----------------ccCcccc
Confidence 44 6899997
|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 739 | ||||
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 1e-05 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 0.004 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 5e-05 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 0.002 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 0.004 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 0.004 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 6e-05 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 2e-04 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 0.004 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 0.004 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 2e-04 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 0.002 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 2e-04 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 8e-04 | |
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 0.002 |
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.5 bits (95), Expect = 1e-05
Identities = 15/37 (40%), Positives = 20/37 (54%)
Query: 66 EDVDECAESRHLCGPGAVCINHPGSYTCQCPPNSSGD 102
+DVDEC+ + C CIN GS+ CQC +G
Sbjct: 1 QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGP 37
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 739 | |||
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.66 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.6 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.48 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.45 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.44 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.42 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.4 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.39 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.37 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.34 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.34 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.32 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.31 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.18 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.17 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.14 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.11 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.1 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.1 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.04 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.96 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.96 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.86 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.85 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.85 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.84 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.78 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.77 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.77 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.76 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.74 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.74 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.72 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.7 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.7 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.69 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.67 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.64 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.53 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.52 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.51 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.48 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.42 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.34 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.33 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.2 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.92 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.82 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.75 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 96.73 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.71 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.58 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.4 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 96.36 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.3 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 95.91 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 95.74 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 95.45 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 94.71 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.64 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 94.51 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 94.45 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 93.67 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 93.55 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 93.52 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 93.42 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 93.13 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 92.91 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 92.47 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 92.05 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 91.57 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 91.39 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 91.01 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 90.63 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 89.7 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 89.57 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 88.97 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 88.96 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 86.21 |
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.66 E-value=7.1e-09 Score=71.37 Aligned_cols=38 Identities=39% Similarity=0.826 Sum_probs=35.5
Q ss_pred cccccccCCCCCCCCCCceeeCCCCceeeCCCCCcCCC
Q psy9419 66 EDVDECAESRHLCGPGAVCINHPGSYTCQCPPNSSGDP 103 (739)
Q Consensus 66 ~dideC~~~~~~C~~~~~C~n~~gsy~C~C~~Gy~g~~ 103 (739)
+|||||+..+++|.++|+|+|+.++|+|+|++||+|..
T Consensus 1 qDideC~~~~~pC~n~g~C~n~~g~y~C~C~~G~~G~~ 38 (42)
T d2vj3a1 1 QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPR 38 (42)
T ss_dssp CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEESTT
T ss_pred CCCccccCCCCCCCCCcEeECCCCCEEeECCCCCcCCC
Confidence 48999998788999999999999999999999999984
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|