Psyllid ID: psy9446

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MRIATGASMVEVVEEKEKFRWSSFFLLYDFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPRADCETNEKHRPRLNTGKGEEKEENYF
cccccccccHHHHHHHccccccHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHcccccccccccEEccccEEEccEEEccccEEEEEEccccccccccccccccccccccccccccccccc
ccEEccccHHEEHcHHHHHHHHHHHHHHHHcccccccccccccHcHEcEEEEHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEccEEEcccccEEEEEccccccccccccccccccccccccccccccccc
MRIATGASMVEVVEEKEKFRWSSFFLLYdfetspkpgsenldsrnqssgvrshiqngavLTSTITIILLQVIQETLavfgpegltqcptyeQLQELKYLDKVIKETLRlfpavpilgrniekdenvgghilapaktkcqlkaitpdpradcetnekhrprlntgkgeekeenyf
mriatgasmvevvEEKEKFRWSSFFLLYDFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITpdpradcetnekhrprlntgkgeekeenyf
MRIATGASMVEVVEEKEKFRWSSFFLLYDFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPRADCETNEKHRPRLNTGKGEEKEENYF
**********EVVEEKEKFRWSSFFLLYDF***********************IQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLK*********************************
*********************SSFFLLYDFETS**PGSENLDSRNQSSGVRSHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPRADCETNEKHRPRLNTGKG********
MRIATGASMVEVVEEKEKFRWSSFFLLYDFETSPK****************SHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPRADCETNEKHRPRLNTG**********
*RIATGASMVEVVEEKEKFRWSSFFLLYDFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPR**************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIATGASMVEVVEEKEKFRWSSFFLLYDFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTITIILLQVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPRADCETNEKHRPRLNTGKGEEKEENYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
Q9W011510 Probable cytochrome P450 yes N/A 0.396 0.135 0.436 5e-08
Q9VA27535 Cytochrome P450 4c3 OS=Dr no N/A 0.448 0.145 0.365 1e-07
Q9VLZ7511 Probable cytochrome P450 no N/A 0.390 0.133 0.471 2e-07
Q9DBW0525 Cytochrome P450 4V2 OS=Mu yes N/A 0.442 0.146 0.425 3e-07
O44221522 Cytochrome P450 4e5, mito N/A N/A 0.419 0.139 0.386 5e-07
O18596513 Cytochrome P450 4d10 OS=D N/A N/A 0.367 0.124 0.411 5e-07
P29981511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.396 0.135 0.388 6e-07
Q9V4T5531 Probable cytochrome P450 no N/A 0.385 0.126 0.373 7e-07
A2RRT9525 Cytochrome P450 4V2 OS=Ra yes N/A 0.344 0.114 0.442 9e-07
O46051507 Probable cytochrome P450 no N/A 0.373 0.128 0.462 1e-06
>sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 70  QVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGH 129
           ++ +E   V GP+  +   T  QLQ+LKYLD VIKET+RL+P VP +GR+ +K+  +G  
Sbjct: 341 RIFEELQRVLGPDA-SAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDK 399

Query: 130 ILAPAKTKCQL 140
            + PA T   L
Sbjct: 400 TI-PANTSIYL 409
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description
>sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 Back     alignment and function description
>sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 Back     alignment and function description
>sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 Back     alignment and function description
>sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 Back     alignment and function description
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 Back     alignment and function description
>sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 Back     alignment and function description
>sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
347966705 510 AGAP013305-PA [Anopheles gambiae str. PE 0.339 0.115 0.559 1e-08
328717989 510 PREDICTED: cytochrome P450 4C1-like [Acy 0.367 0.125 0.446 1e-08
242003790 504 cytochrome P-450, putative [Pediculus hu 0.362 0.125 0.430 1e-08
91082227 487 PREDICTED: similar to pheromone-degradin 0.396 0.141 0.436 3e-08
307186689174 Cytochrome P450 4C1 [Camponotus floridan 0.477 0.477 0.406 4e-08
18139569151 cytochrome P450 CYP4H15 [Anopheles gambi 0.442 0.509 0.467 4e-08
332016341 382 Cytochrome P450 4V3 [Acromyrmex echinati 0.356 0.162 0.444 4e-08
347966703 510 AGAP001864-PA [Anopheles gambiae str. PE 0.339 0.115 0.542 5e-08
307180915122 Cytochrome P450 4C1 [Camponotus floridan 0.477 0.680 0.384 6e-08
322784865195 hypothetical protein SINV_02477 [Solenop 0.477 0.425 0.351 8e-08
>gi|347966705|ref|XP_003435957.1| AGAP013305-PA [Anopheles gambiae str. PEST] gi|333469936|gb|EGK97456.1| AGAP013305-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 70  QVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGG 128
           +V  E LA+ GP+  TQ  TY  LQELKYLD VIKETLR+ P+VPI+GR    D  + G
Sbjct: 342 RVYDEILAIVGPDAKTQELTYGTLQELKYLDMVIKETLRINPSVPIIGRRSAGDMLIDG 400

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328717989|ref|XP_003246356.1| PREDICTED: cytochrome P450 4C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242003790|ref|XP_002422861.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212505743|gb|EEB10123.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91082227|ref|XP_972577.1| PREDICTED: similar to pheromone-degrading enzyme [Tribolium castaneum] gi|270008181|gb|EFA04629.1| cytochrome P450-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307186689|gb|EFN72161.1| Cytochrome P450 4C1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|18139569|gb|AAL58551.1| cytochrome P450 CYP4H15 [Anopheles gambiae] Back     alignment and taxonomy information
>gi|332016341|gb|EGI57254.1| Cytochrome P450 4V3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|347966703|ref|XP_001238447.3| AGAP001864-PA [Anopheles gambiae str. PEST] gi|333469937|gb|EAU75616.3| AGAP001864-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307180915|gb|EFN68714.1| Cytochrome P450 4C1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322784865|gb|EFZ11645.1| hypothetical protein SINV_02477 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
FB|FBgn0035344510 Cyp4d20 "Cyp4d20" [Drosophila 0.396 0.135 0.436 3.8e-09
FB|FBgn0031925511 Cyp4d21 "Cyp4d21" [Drosophila 0.390 0.133 0.471 2.8e-08
FB|FBgn0015032535 Cyp4c3 "Cytochrome P450-4c3" [ 0.442 0.143 0.370 3e-08
MGI|MGI:2142763525 Cyp4v3 "cytochrome P450, famil 0.5 0.165 0.406 6.1e-08
WB|WBGene00009226509 cyp-37B1 [Caenorhabditis elega 0.327 0.111 0.423 1.2e-07
UNIPROTKB|F1N3Z7527 CYP4V2 "Uncharacterized protei 0.304 0.100 0.508 1.7e-07
FB|FBgn0023541507 Cyp4d14 "Cyp4d14" [Drosophila 0.356 0.122 0.484 2.6e-07
UNIPROTKB|F1PNR5523 CYP4V2 "Uncharacterized protei 0.442 0.147 0.412 1e-06
RGD|708530525 Cyp4v3 "cytochrome P450, famil 0.344 0.114 0.442 1.8e-06
FB|FBgn0010019556 Cyp4g1 "Cytochrome P450-4g1" [ 0.321 0.100 0.438 3.1e-06
FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 3.8e-09, P = 3.8e-09
 Identities = 31/71 (43%), Positives = 44/71 (61%)

Query:    70 QVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGH 129
             ++ +E   V GP+      T  QLQ+LKYLD VIKET+RL+P VP +GR+ +K+  +G  
Sbjct:   341 RIFEELQRVLGPDASAPV-TQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDK 399

Query:   130 ILAPAKTKCQL 140
              + PA T   L
Sbjct:   400 TI-PANTSIYL 409
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2142763 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00009226 cyp-37B1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3Z7 CYP4V2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNR5 CYP4V2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|708530 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0010019 Cyp4g1 "Cytochrome P450-4g1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
pfam00067461 pfam00067, p450, Cytochrome P450 1e-10
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 8e-06
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 4e-05
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-05
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-05
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 5e-05
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-04
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 1e-04
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-04
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 0.001
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 0.002
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 0.004
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 58.8 bits (143), Expect = 1e-10
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 15/91 (16%)

Query: 61  TSTITIILL----------QVIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLF 110
           +ST++  L           ++ +E   V G     + PTY+ LQ + YLD VIKETLRL 
Sbjct: 278 SSTLSWALYELAKHPEVQEKLREEIDEVIGD---KRSPTYDDLQNMPYLDAVIKETLRLH 334

Query: 111 PAVPI-LGRNIEKDENVGGHILAPAKTKCQL 140
           P VP+ L R + KD  + G+++ P  T   +
Sbjct: 335 PVVPLLLPREVTKDTVIPGYLI-PKGTLVIV 364

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
KOG0158|consensus499 100.0
KOG0156|consensus489 100.0
PLN02971543 tryptophan N-hydroxylase 99.97
PLN03234499 cytochrome P450 83B1; Provisional 99.97
PLN02183516 ferulate 5-hydroxylase 99.97
PLN02500490 cytochrome P450 90B1 99.97
PLN00168519 Cytochrome P450; Provisional 99.97
KOG0157|consensus497 99.97
PLN02290516 cytokinin trans-hydroxylase 99.97
PLN02774463 brassinosteroid-6-oxidase 99.97
PLN02966502 cytochrome P450 83A1 99.96
PLN02394503 trans-cinnamate 4-monooxygenase 99.96
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.96
PTZ00404482 cytochrome P450; Provisional 99.96
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.96
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.96
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.96
PLN02738 633 carotene beta-ring hydroxylase 99.96
PLN02687517 flavonoid 3'-monooxygenase 99.96
PLN03112514 cytochrome P450 family protein; Provisional 99.96
PLN02655466 ent-kaurene oxidase 99.96
PLN03018534 homomethionine N-hydroxylase 99.96
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.96
PLN02196463 abscisic acid 8'-hydroxylase 99.96
PLN02302490 ent-kaurenoic acid oxidase 99.95
KOG0159|consensus519 99.95
PLN02987472 Cytochrome P450, family 90, subfamily A 99.95
PLN02936489 epsilon-ring hydroxylase 99.95
KOG0684|consensus486 99.92
PLN02648480 allene oxide synthase 99.91
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.9
>KOG0158|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.8e-34  Score=234.76  Aligned_cols=146  Identities=27%  Similarity=0.335  Sum_probs=130.7

Q ss_pred             hcccCHHHHHHhhhcC--CCCCCC-CCChHHHHHHHHHHhHhccchhhcH-----------HHHHHHHHHHHHHhcCCCC
Q psy9446          18 KFRWSSFFLLYDFETS--PKPGSE-NLDSRNQSSGVRSHIQNGAVLTSTI-----------TIILLQVIQETLAVFGPEG   83 (174)
Q Consensus        18 ~~~~~~~~~l~~~~~~--~~~~~~-~l~~~~i~~~~~~~~~ag~~tt~~~-----------p~~~~kl~~Ei~~~~~~~~   83 (174)
                      ..++|+++++..+...  ...... .++.++|+.+|..+++||.||||++           |++|+|||+||++++.  +
T Consensus       264 ~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~--~  341 (499)
T KOG0158|consen  264 IERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLE--E  341 (499)
T ss_pred             CCCchHHHHHHHhhcccccccccccccCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhc--c
Confidence            4688999999999863  222222 5999999999999999999999976           9999999999999977  2


Q ss_pred             CCCCCCHHHhccCHhHHHHHhhhhcCCCCCCCcccccCCCceec-CceecCCCCEEEEecccCCCCCC-CCCCCCCcCCC
Q psy9446          84 LTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVG-GHILAPAKTKCQLKAITPDPRAD-CETNEKHRPRL  161 (174)
Q Consensus        84 ~~~~~~~~~~~~l~~l~~~i~E~lRl~p~~~~~~r~~~~~~~i~-~~~~ip~g~~v~~~~~~~~~~~~-~~~p~~F~P~R  161 (174)
                      ... ++++.+.+|+|+++||+|+||+||+++.+.|.+++|++++ + +.||||+.|.++++++|+|+. ||||++|+|||
T Consensus       342 ~~~-ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~~-~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PER  419 (499)
T KOG0158|consen  342 KEG-LTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPGG-FVIPKGTPVMIPTYALHHDPEYWPEPEKFKPER  419 (499)
T ss_pred             cCC-CCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCCC-eEeCCCCEEEeecccccCCcccCCCcccCCCcc
Confidence            233 9999999999999999999999999999999999999999 7 999999999999999999995 89999999999


Q ss_pred             CCCCCC
Q psy9446         162 NTGKGE  167 (174)
Q Consensus       162 fl~~~~  167 (174)
                      |.+++.
T Consensus       420 F~~~~~  425 (499)
T KOG0158|consen  420 FEEENN  425 (499)
T ss_pred             CCCCcc
Confidence            997654

>KOG0156|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 8e-06
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-04
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-04
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-04
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 3e-04
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 8e-04
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 8e-04
1fah_A471 Structure Of Cytochrome P450 Length = 471 8e-04
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 8e-04
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 8e-04
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 8e-04
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 8e-04
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 8e-04
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 8e-04
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 8e-04
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 8e-04
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 8e-04
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 8e-04
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 8e-04
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 8e-04
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 8e-04
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 8e-04
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 8e-04
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-04
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 8e-04
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 9e-04
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 9e-04
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 9e-04
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 9e-04
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 9e-04
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 9e-04
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 9e-04
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 9e-04
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 9e-04
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 9e-04
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 9e-04
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 9e-04
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 9e-04
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 9e-04
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%)
Query: 89  TYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKC 138
           TY+QL++L  LD+ IKETLRL P + I+ R     + V G+ + P    C
Sbjct: 305 TYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVC 354
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 9e-18
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-17
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-15
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-15
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 9e-15
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 9e-15
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-14
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-14
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-14
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-14
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-13
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-12
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 8e-12
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-10
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-10
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 6e-10
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-09
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-07
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-07
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score = 78.4 bits (194), Expect = 9e-18
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 71  VIQETLAVFGPEGLTQCPTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHI 130
           +  E   V G +       +E L  L+YL +V+KE+LRL+P      R +E++  + G  
Sbjct: 280 LQAEVDEVIGSKRY---LDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVR 336

Query: 131 LAPAKTKCQL 140
           + P  T    
Sbjct: 337 V-PGNTPLLF 345
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.97
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.97
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.97
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.97
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.97
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.97
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.97
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.97
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.97
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.96
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.96
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.96
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.96
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.96
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.95
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.94
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.94
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.94
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.93
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.93
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.92
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.91
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.91
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.91
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.91
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.91
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.91
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.91
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.91
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.91
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.9
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.9
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.9
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.9
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.9
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.9
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.9
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.9
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.9
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.9
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.9
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.9
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.9
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.9
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.9
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.9
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.9
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.9
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.9
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.9
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.9
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.89
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.89
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.89
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.89
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.89
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.89
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.89
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.88
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.88
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.88
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.88
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.88
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.88
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.88
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.87
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.86
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.86
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.8
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.73
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.97  E-value=5.4e-32  Score=219.73  Aligned_cols=144  Identities=19%  Similarity=0.166  Sum_probs=124.1

Q ss_pred             ccCHHHHHH-hhhcCCCCCCCCCChHHHHHHHHHHhHhccchhhcH-----------HHHHHHHHHHHHHhcCCCCCCCC
Q psy9446          20 RWSSFFLLY-DFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTI-----------TIILLQVIQETLAVFGPEGLTQC   87 (174)
Q Consensus        20 ~~~~~~~l~-~~~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~-----------p~~~~kl~~Ei~~~~~~~~~~~~   87 (174)
                      ..+....+. ............++++++...+.++++||+|||+++           |++|+||++||+.+++   ....
T Consensus       246 ~~d~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~---~~~~  322 (479)
T 3tbg_A          246 PRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIG---QVRR  322 (479)
T ss_dssp             CCSHHHHHHHHHHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTC---SSSC
T ss_pred             cchhhhhhhhhhhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHh---hccc
Confidence            344544333 333334445567999999999999999999999975           9999999999999998   5778


Q ss_pred             CCHHHhccCHhHHHHHhhhhcCCCCCCC-cccccCCCceecCceecCCCCEEEEecccCCCCCC-CCCCCCCcCCCCCCC
Q psy9446          88 PTYEQLQELKYLDKVIKETLRLFPAVPI-LGRNIEKDENVGGHILAPAKTKCQLKAITPDPRAD-CETNEKHRPRLNTGK  165 (174)
Q Consensus        88 ~~~~~~~~l~~l~~~i~E~lRl~p~~~~-~~r~~~~~~~i~~~~~ip~g~~v~~~~~~~~~~~~-~~~p~~F~P~Rfl~~  165 (174)
                      ++++++.+|||++|||+|+||++|+++. .+|.+.+|++++| |.|||||.|.++.+++|+|+. |+||++|+||||+++
T Consensus       323 ~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g-~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~  401 (479)
T 3tbg_A          323 PEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQG-FRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDA  401 (479)
T ss_dssp             CCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETT-EEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCT
T ss_pred             cchhhhccccccccceeeeccccccccccceeecCCCceECC-EEecCCCeeeechhhhcCChhhCCCccccCccccCCC
Confidence            9999999999999999999999999999 6567789999999 999999999999999999995 899999999999975


Q ss_pred             CC
Q psy9446         166 GE  167 (174)
Q Consensus       166 ~~  167 (174)
                      ..
T Consensus       402 ~~  403 (479)
T 3tbg_A          402 QG  403 (479)
T ss_dssp             TC
T ss_pred             Cc
Confidence            43
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.96
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.96
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.96
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.96
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.95
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.91
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.87
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.82
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.8
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.77
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.76
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.75
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.74
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.72
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.71
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.71
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.7
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.64
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.64
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.45
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.96  E-value=5.9e-30  Score=204.23  Aligned_cols=143  Identities=17%  Similarity=0.192  Sum_probs=125.5

Q ss_pred             cccCHHHHHHhhhcCCCCCCCCCChHHHHHHHHHHhHhccchhhcH-----------HHHHHHHHHHHHHhcCCCCCCCC
Q psy9446          19 FRWSSFFLLYDFETSPKPGSENLDSRNQSSGVRSHIQNGAVLTSTI-----------TIILLQVIQETLAVFGPEGLTQC   87 (174)
Q Consensus        19 ~~~~~~~~l~~~~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~-----------p~~~~kl~~Ei~~~~~~~~~~~~   87 (174)
                      ..+|+++.+.....  +.....++++++...+..+++||++||+.+           |++|++|++||+.+++   .+..
T Consensus       217 ~~~dll~~ll~~~~--~~~~~~ls~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~---~~~~  291 (445)
T d2ciba1         217 SDRDMLDVLIAVKA--ETGTPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYG---DGRS  291 (445)
T ss_dssp             -CCCHHHHHHHCBC--TTSSBSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGG---GCCC
T ss_pred             cccchhhhhhcccc--ccccccCCcchhhhhhhhhhhhccccchhhccccccccccccccccccccccccccc---cccc
Confidence            34567776665543  223346899999999999999999999865           9999999999999998   5677


Q ss_pred             CCHHHhccCHhHHHHHhhhhcCCCCCCCcccccCCCceecCceecCCCCEEEEecccCCCCCC-CCCCCCCcCCCCCCCC
Q psy9446          88 PTYEQLQELKYLDKVIKETLRLFPAVPILGRNIEKDENVGGHILAPAKTKCQLKAITPDPRAD-CETNEKHRPRLNTGKG  166 (174)
Q Consensus        88 ~~~~~~~~l~~l~~~i~E~lRl~p~~~~~~r~~~~~~~i~~~~~ip~g~~v~~~~~~~~~~~~-~~~p~~F~P~Rfl~~~  166 (174)
                      ++++++.+||||++||+|++|++|+++...|.+.+++.++| +.||||+.|+++.+++|+|+. |+||++|+||||++.+
T Consensus       292 ~~~~~l~~lp~L~a~i~E~lRl~p~~~~~~~~~~~~~~~~~-~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~PeRf~~~~  370 (445)
T d2ciba1         292 VSFHALRQIPQLENVLKETLRLHPPLIILMRVAKGEFEVQG-HRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPR  370 (445)
T ss_dssp             HHHHTTSCCHHHHHHHHHHHHHSCSCCCEEEEECSCEEETT-EEECTTCEEEECHHHHTTCTTTSSSTTSCCGGGGSTTT
T ss_pred             chhhhcccchhhccccccccccccccceeccccccccccce-eeccccccccccccccccCcccCCChhhCCcccccCcc
Confidence            89999999999999999999999999998899999999999 999999999999999999995 8999999999999654


Q ss_pred             C
Q psy9446         167 E  167 (174)
Q Consensus       167 ~  167 (174)
                      .
T Consensus       371 ~  371 (445)
T d2ciba1         371 Q  371 (445)
T ss_dssp             C
T ss_pred             c
Confidence            3
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure