Psyllid ID: psy9478


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTALRY
cEEEEEEccccccccccEEEEEEccccccccccccccccccccccccEEEEEEcccccccccccccccccc
ccEEEEEEEEEcccccEEEEEEEccccccccHHHHccccccHHEcccEEEEEEEEEcccHccccccccccc
MFCDTKCQVKVAQTTLLPVMVWIHgggfayghgnadaygpeflmNKNVILVTVNYRLGILGHVILSTALRY
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTALRY
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTALRY
**CDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTA***
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILST****
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTALRY
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTALR*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFCDTKCQVKVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILSTALRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
P12992 564 Juvenile hormone esterase N/A N/A 0.760 0.095 0.537 5e-13
P16854 540 Esterase B1 OS=Culex pipi N/A N/A 0.732 0.096 0.480 4e-10
Q47M62 497 Carboxylesterase OS=Therm yes N/A 0.732 0.104 0.480 2e-07
P86325 497 Carboxylesterase OS=Therm yes N/A 0.732 0.104 0.480 2e-07
P37967 489 Para-nitrobenzyl esterase yes N/A 0.718 0.104 0.519 2e-07
B2D0J5 557 Venom carboxylesterase-6 no N/A 0.901 0.114 0.382 4e-07
P23953 554 Carboxylesterase 1C OS=Mu no N/A 0.704 0.090 0.470 1e-06
Q92035 606 Acetylcholinesterase OS=B N/A N/A 0.619 0.072 0.511 2e-06
P16303 565 Carboxylesterase 1D OS=Ra yes N/A 0.690 0.086 0.480 2e-06
Q8VCT4 565 Carboxylesterase 1D OS=Mu no N/A 0.704 0.088 0.470 2e-06
>sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 14  TTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILST 67
           T L P++V+IHGGGFA+G G+ D +GPE+L+ KNVI++T NYRL + G + ++T
Sbjct: 128 TPLRPILVFIHGGGFAFGSGHEDLHGPEYLVTKNVIVITFNYRLNVFGFLSMNT 181




JH esterase plays a crucial role in the decrease of JH activity in lepidopteran insects, by hydrolyzing the methyl ester of JH. It is also involved in the transport of JH.
Heliothis virescens (taxid: 7102)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 5EC: 9
>sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 Back     alignment and function description
>sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 Back     alignment and function description
>sp|P86325|EST1_THEFU Carboxylesterase OS=Thermomonospora fusca PE=1 SV=1 Back     alignment and function description
>sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 Back     alignment and function description
>sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 Back     alignment and function description
>sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 Back     alignment and function description
>sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 Back     alignment and function description
>sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 Back     alignment and function description
>sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
339283876 538 antennal esterase CXE10 [Spodoptera exig 0.802 0.105 0.631 1e-14
167466284 543 alpha-esterase like protein E3 [Triboliu 0.746 0.097 0.641 3e-14
257480047 538 antennal esterase CXE10 [Spodoptera litt 0.760 0.100 0.666 5e-14
91086429 514 PREDICTED: similar to putative esterase 0.788 0.108 0.607 2e-13
342731430 525 carboxylesterase CXE26 [Spodoptera litto 0.718 0.097 0.647 3e-13
332023789 535 Bile salt-activated lipase [Acromyrmex e 0.676 0.089 0.645 4e-13
195542222 740 carboxylesterase 4 variant 2 [Bombyx man 0.732 0.070 0.576 4e-13
195542220 756 carboxylesterase 4 variant 1 [Bombyx man 0.732 0.068 0.576 4e-13
284520932 740 alpha-esterase 48 isoform s1 [Bombyx mor 0.732 0.070 0.576 5e-13
284002384 756 carboxyl/cholinesterase 5BL [Bombyx mori 0.732 0.068 0.576 5e-13
>gi|339283876|gb|AEJ38207.1| antennal esterase CXE10 [Spodoptera exigua] Back     alignment and taxonomy information
 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 43/57 (75%)

Query: 11  VAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILST 67
           +   T LPVMVWIHGGGF +G GN D YGPEFL+  NV+LVT+NYRL +LG + L T
Sbjct: 91  IKPATPLPVMVWIHGGGFVWGSGNDDLYGPEFLIRHNVVLVTLNYRLEVLGFLCLDT 147




Source: Spodoptera exigua

Species: Spodoptera exigua

Genus: Spodoptera

Family: Noctuidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|167466284|ref|NP_001107862.1| alpha-esterase like protein E3 [Tribolium castaneum] gi|270008669|gb|EFA05117.1| hypothetical protein TcasGA2_TC015230 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|257480047|gb|ACV60237.1| antennal esterase CXE10 [Spodoptera littoralis] Back     alignment and taxonomy information
>gi|91086429|ref|XP_967916.1| PREDICTED: similar to putative esterase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|342731430|gb|AEL33699.1| carboxylesterase CXE26 [Spodoptera littoralis] Back     alignment and taxonomy information
>gi|332023789|gb|EGI64013.1| Bile salt-activated lipase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195542222|gb|ACF98321.1| carboxylesterase 4 variant 2 [Bombyx mandarina] gi|195542226|gb|ACF98323.1| carboxylesterase 4 variant 4 [Bombyx mandarina] gi|195542228|gb|ACF98324.1| carboxylesterase 4 variant 5 [Bombyx mandarina] Back     alignment and taxonomy information
>gi|195542220|gb|ACF98320.1| carboxylesterase 4 variant 1 [Bombyx mandarina] gi|195542224|gb|ACF98322.1| carboxylesterase 4 variant 3 [Bombyx mandarina] Back     alignment and taxonomy information
>gi|284520932|ref|NP_001165227.1| alpha-esterase 48 isoform s1 [Bombyx mori] gi|284002386|dbj|BAI66486.1| carboxyl/cholinesterase 5BS [Bombyx mori] gi|284002388|dbj|BAI66487.1| carboxyl/cholinesterase 5BS [Bombyx mori] Back     alignment and taxonomy information
>gi|284002384|dbj|BAI66485.1| carboxyl/cholinesterase 5BL [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
FB|FBgn0039084 664 CG10175 [Drosophila melanogast 0.704 0.075 0.58 6.7e-13
FB|FBgn0000326 562 clt "cricklet" [Drosophila mel 0.788 0.099 0.614 4.3e-12
UNIPROTKB|Q4JSA2 573 D2.9 "Putative esterase" [Anop 0.760 0.094 0.607 1.2e-11
FB|FBgn0015575 572 alpha-Est7 "alpha-Esterase-7" 0.704 0.087 0.56 3.2e-11
UNIPROTKB|Q4JSA3 562 D2.8 "Putative esterase" [Anop 0.619 0.078 0.659 6.6e-11
FB|FBgn0034736 566 CG6018 [Drosophila melanogaste 0.690 0.086 0.530 2.3e-10
FB|FBgn0015569 567 alpha-Est10 "alpha-Esterase-10 0.704 0.088 0.56 2.3e-10
FB|FBgn0015568 565 alpha-Est1 "alpha-Esterase-1" 0.704 0.088 0.5 7.9e-10
FB|FBgn0015577 572 alpha-Est9 "alpha-Esterase-9" 0.676 0.083 0.479 8.1e-10
FB|FBgn0015576 574 alpha-Est8 "alpha-Esterase-8" 0.704 0.087 0.5 1e-09
FB|FBgn0039084 CG10175 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 174 (66.3 bits), Expect = 6.7e-13, Sum P(2) = 6.7e-13
 Identities = 29/50 (58%), Positives = 42/50 (84%)

Query:    12 AQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILG 61
             A+   LPVMVW+HGGGF++G GN+  YGP++L+ ++++LVT+NYRLG LG
Sbjct:   208 AEQPKLPVMVWLHGGGFSFGSGNSFLYGPDYLVAEDIVLVTLNYRLGPLG 257


GO:0004091 "carboxylesterase activity" evidence=ISS;IBA
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0000326 clt "cricklet" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q4JSA2 D2.9 "Putative esterase" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0015575 alpha-Est7 "alpha-Esterase-7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q4JSA3 D2.8 "Putative esterase" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0034736 CG6018 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015569 alpha-Est10 "alpha-Esterase-10" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015568 alpha-Est1 "alpha-Esterase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015577 alpha-Est9 "alpha-Esterase-9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015576 alpha-Est8 "alpha-Esterase-8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P37967PNBA_BACSU3, ., 1, ., 1, ., -0.51920.71830.1042yesN/A
P12337EST1_RABIT3, ., 1, ., 1, ., 10.53330.61970.0778yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 8e-22
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 9e-16
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 5e-15
COG0657 312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 0.002
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
 Score = 86.2 bits (214), Expect = 8e-22
 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 3/52 (5%)

Query: 17  LPVMVWIHGGGFAYGHGNADAY-GPEFLMNKNVILVTVNYRLGILGHVILST 67
           LPVMVWIHGGGF  G  + D Y GP+   +++V++VT+NYRLG LG   LST
Sbjct: 100 LPVMVWIHGGGFQSGSASLDDYDGPDLAASEDVVVVTINYRLGALGF--LST 149


Length = 510

>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.76
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.76
KOG1515|consensus 336 99.68
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.61
KOG4389|consensus 601 99.59
KOG1516|consensus 545 99.56
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 99.51
PRK10162 318 acetyl esterase; Provisional 99.4
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.3
KOG4388|consensus 880 98.78
KOG4627|consensus 270 98.73
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 98.08
TIGR01840 212 esterase_phb esterase, PHB depolymerase family. Th 97.9
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.74
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.35
PRK10566 249 esterase; Provisional 97.18
PLN00021 313 chlorophyllase 96.95
PRK10115 686 protease 2; Provisional 96.87
PLN02442 283 S-formylglutathione hydrolase 96.81
KOG3847|consensus 399 96.55
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 96.34
PF10503 220 Esterase_phd: Esterase PHB depolymerase 96.04
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 95.99
PLN02385 349 hydrolase; alpha/beta fold family protein 95.94
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 95.92
PLN02298 330 hydrolase, alpha/beta fold family protein 95.85
PF039918 Prion_octapep: Copper binding octapeptide repeat; 95.66
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 95.45
PHA02857 276 monoglyceride lipase; Provisional 95.41
PLN02211 273 methyl indole-3-acetate methyltransferase 95.1
PRK10985 324 putative hydrolase; Provisional 94.88
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 94.57
PLN02652 395 hydrolase; alpha/beta fold family protein 94.53
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 94.04
PRK00870 302 haloalkane dehalogenase; Provisional 94.03
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 93.5
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 93.29
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 93.16
KOG3101|consensus 283 92.43
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 92.41
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 92.14
KOG1455|consensus 313 92.09
PRK10749 330 lysophospholipase L2; Provisional 92.01
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 91.92
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 91.89
PLN02511 388 hydrolase 91.71
COG4099 387 Predicted peptidase [General function prediction o 91.61
PRK05077 414 frsA fermentation/respiration switch protein; Revi 91.48
PLN02965 255 Probable pheophorbidase 91.47
PLN02872 395 triacylglycerol lipase 91.19
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 91.02
PRK10673 255 acyl-CoA esterase; Provisional 90.64
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 90.33
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 89.38
KOG2100|consensus 755 89.01
PLN02894 402 hydrolase, alpha/beta fold family protein 88.91
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 88.48
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 88.42
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 88.2
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 88.12
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 87.29
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 87.09
PRK03592 295 haloalkane dehalogenase; Provisional 86.87
PRK05855 582 short chain dehydrogenase; Validated 86.86
PRK07581 339 hypothetical protein; Validated 86.78
PF01738 218 DLH: Dienelactone hydrolase family; InterPro: IPR0 86.78
PRK10439 411 enterobactin/ferric enterobactin esterase; Provisi 86.36
PF00756 251 Esterase: Putative esterase; InterPro: IPR000801 T 86.03
PRK03204 286 haloalkane dehalogenase; Provisional 85.98
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 85.75
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 84.84
PRK10349 256 carboxylesterase BioH; Provisional 84.71
PLN02679 360 hydrolase, alpha/beta fold family protein 84.53
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 84.48
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 83.87
KOG4391|consensus 300 83.86
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 83.49
PRK13604 307 luxD acyl transferase; Provisional 82.57
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 82.07
PF02230 216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 81.5
PRK06489 360 hypothetical protein; Provisional 81.2
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 80.45
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
Probab=99.76  E-value=8.4e-19  Score=116.87  Aligned_cols=66  Identities=41%  Similarity=0.718  Sum_probs=56.3

Q ss_pred             cccCCc-----cCCCCCCceEEEEEeCCccccCCCCCCCchHHHHhcCC-cEEEEeCCCCCCcccccCCCcc
Q psy9478           4 DTKCQV-----KVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKN-VILVTVNYRLGILGHVILSTAL   69 (71)
Q Consensus         4 ~~~~~~-----~~~~~~~~pviv~iHGGg~~~g~~~~~~~~~~~~~~~g-~~vvsv~YRlap~Gf~~~~~~~   69 (71)
                      +|||+.     +....+++|||||||||+|..|+.....+....++++| +++|++||||+++|||..++..
T Consensus        76 sEDCL~LNIwaP~~~a~~~PVmV~IHGG~y~~Gs~s~~~ydgs~La~~g~vVvVSvNYRLG~lGfL~~~~~~  147 (491)
T COG2272          76 SEDCLYLNIWAPEVPAEKLPVMVYIHGGGYIMGSGSEPLYDGSALAARGDVVVVSVNYRLGALGFLDLSSLD  147 (491)
T ss_pred             cccceeEEeeccCCCCCCCcEEEEEeccccccCCCcccccChHHHHhcCCEEEEEeCcccccceeeehhhcc
Confidence            566765     22356778999999999999999998889999999995 9999999999999999987543



>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF03991 Prion_octapep: Copper binding octapeptide repeat; InterPro: IPR020949 Prion protein (PrP-c) [, , ] is a small glycoprotein found in high quantity in the brain of animals infected with certain degenerative neurological diseases, such as sheep scrapie and bovine spongiform encephalopathy (BSE), and the human dementias Creutzfeldt-Jacob disease (CJD) and Gerstmann-Straussler syndrome (GSS) Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2fj0_A 551 Crystal Structure Of Juvenile Hormone Esterase From 1e-13
1qe3_A 489 Pnb Esterase Length = 489 2e-08
1c7j_A 489 Pnb Esterase 56c8 Length = 489 2e-08
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 2e-08
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 2e-07
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 2e-07
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 3e-07
4ey4_A 542 Crystal Structure Of Recombinant Human Acetylcholin 3e-07
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 3e-07
3lii_A 540 Recombinant Human Acetylcholinesterase Length = 540 3e-07
1b41_A 539 Human Acetylcholinesterase Complexed With Fasciculi 3e-07
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 3e-07
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 5e-07
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 5e-07
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 5e-07
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 5e-07
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 7e-07
1jmy_A 522 Truncated Recombinant Human Bile Salt Stimulated Li 7e-07
1f6w_A 533 Structure Of The Catalytic Domain Of Human Bile Sal 7e-07
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 9e-07
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 9e-07
1ku6_A 549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 9e-07
1mah_A 543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 9e-07
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 9e-07
2xuf_A 544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 9e-07
2xud_A 543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 9e-07
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 9e-07
3dl7_B 534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 9e-07
3dl7_A 538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 9e-07
2jgj_B 535 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-07
2jge_A 536 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-07
2jge_B 533 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-07
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-07
2ha4_A 543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 9e-07
1c2o_A 539 Electrophorus Electricus Acetylcholinesterase Lengt 9e-07
1c2b_A 540 Electrophorus Electricus Acetylcholinesterase Lengt 9e-07
1n5m_A 541 Crystal Structure Of The Mouse Acetylcholinesterase 9e-07
1maa_A 547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 9e-07
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 1e-06
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 1e-06
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 1e-06
1thg_A 544 1.8 Angstroms Refined Structure Of The Lipase From 4e-06
1akn_A 579 Structure Of Bile-salt Activated Lipase Length = 57 5e-06
1aql_A 532 Crystal Structure Of Bovine Bile-Salt Activated Lip 5e-06
2bce_A 579 Cholesterol Esterase From Bos Taurus Length = 579 5e-06
2dfp_A 534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 5e-06
1gqr_A 532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 5e-06
3gel_A 532 O-Methylphosphorylated Torpedo Acetylcholinesterase 5e-06
3i6m_A 534 3d Structure Of Torpedo Californica Acetylcholinest 5e-06
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 5e-06
2c58_A 537 Torpedo Californica Acetylcholinesterase In Complex 5e-06
2cek_A 535 Conformational Flexibility In The Peripheral Site O 5e-06
1som_A 543 Torpedo Californica Acetylcholinesterase Inhibited 5e-06
1eea_A 534 Acetylcholinesterase Length = 534 5e-06
1ut6_A 537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 5e-06
1fss_A 537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 5e-06
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 8e-06
1p0i_A 529 Crystal Structure Of Human Butyryl Cholinesterase L 9e-06
4b0o_A 529 Crystal Structure Of Soman-Aged Human Butyrylcholin 9e-06
4axb_A 527 Crystal Structure Of Soman-aged Human Butyrylcholin 9e-06
4aqd_A 531 Crystal Structure Of Fully Glycosylated Human Butyr 9e-06
2y1k_A 529 Structure Of Human Butyrylcholinesterase Inhibited 9e-06
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 9e-06
2xqf_A 527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 9e-06
2wsl_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 9e-06
2wil_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 9e-06
2wif_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 9e-06
2wid_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 9e-06
3djy_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 9e-06
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 9e-06
2j4c_A 529 Structure Of Human Butyrylcholinesterase In Complex 9e-06
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 1e-05
2xmb_A 529 G117h Mutant Of Human Butyrylcholinesterase In Comp 8e-05
1llf_A 534 Cholesterol Esterase (Candida Cylindracea) Crystal 4e-04
1cle_A 534 Structure Of Uncomplexed And Linoleate-Bound Candid 4e-04
>pdb|2FJ0|A Chain A, Crystal Structure Of Juvenile Hormone Esterase From Manduca Sexta, With Otfp Covalently Attached Length = 551 Back     alignment and structure

Iteration: 1

Score = 71.6 bits (174), Expect = 1e-13, Method: Composition-based stats. Identities = 28/51 (54%), Positives = 44/51 (86%) Query: 17 LPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILGHVILST 67 LPV+V+IHGGGFA+G G++D +GPE+L++K+VI++T NYRL + G + L++ Sbjct: 115 LPVLVFIHGGGFAFGSGDSDLHGPEYLVSKDVIVITFNYRLNVYGFLSLNS 165
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure
>pdb|1JMY|A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase Length = 522 Back     alignment and structure
>pdb|1F6W|A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase Length = 533 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|3DL7|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun- Update Length = 538 Back     alignment and structure
>pdb|2JGE|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Methamidophos Length = 536 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1AKN|A Chain A, Structure Of Bile-salt Activated Lipase Length = 579 Back     alignment and structure
>pdb|1AQL|A Chain A, Crystal Structure Of Bovine Bile-Salt Activated Lipase Complexed With Taurocholate Length = 532 Back     alignment and structure
>pdb|2BCE|A Chain A, Cholesterol Esterase From Bos Taurus Length = 579 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 6e-27
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 5e-23
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 8e-23
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 1e-22
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 2e-22
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 2e-22
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 1e-21
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 7e-21
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 4e-20
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 2e-19
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 6e-17
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 8e-17
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 2e-16
3h04_A 275 Uncharacterized protein; protein with unknown func 4e-08
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 4e-07
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 1e-06
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 2e-06
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 4e-06
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 9e-06
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 9e-06
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 1e-05
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 1e-05
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 3e-05
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 1e-04
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 2e-04
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 3e-04
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 3e-04
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 4e-04
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 6e-04
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 6e-04
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 8e-04
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
 Score =  100 bits (250), Expect = 6e-27
 Identities = 27/49 (55%), Positives = 41/49 (83%)

Query: 13  QTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMNKNVILVTVNYRLGILG 61
           +   LPV+V+IHGGGFA+G G++D +GPE+L++K+VI++T NYRL + G
Sbjct: 111 RFAGLPVLVFIHGGGFAFGSGDSDLHGPEYLVSKDVIVITFNYRLNVYG 159


>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.63
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.63
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.6
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.6
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.6
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.59
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.58
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.58
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.58
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.57
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.56
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.51
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.5
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 99.34
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.2
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 99.17
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.11
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.1
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.1
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 99.03
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 98.96
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.95
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.93
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.91
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.9
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.88
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 98.87
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.85
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.83
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 98.79
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 98.77
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 98.74
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 98.66
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.64
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 98.55
3h04_A 275 Uncharacterized protein; protein with unknown func 98.42
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 98.07
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.95
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.86
2fuk_A 220 XC6422 protein; A/B hydrolase, structural genomics 97.85
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 97.82
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.79
3trd_A 208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.77
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.74
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 97.71
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.71
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 97.68
4ao6_A 259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 97.67
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 97.67
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 97.65
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 97.64
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.64
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 97.61
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.6
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.56
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.55
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.54
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.52
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.46
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.45
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.44
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.43
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 97.43
1jjf_A 268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.42
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.38
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 97.33
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 97.3
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 97.29
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.27
2qjw_A 176 Uncharacterized protein XCC1541; putative hydrolas 97.27
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.25
1auo_A 218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.22
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.2
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 97.2
3cn9_A 226 Carboxylesterase; alpha/beta hydrolase fold super- 97.19
3bdi_A 207 Uncharacterized protein TA0194; NP_393672.1, predi 97.17
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.16
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.16
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 97.12
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.11
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.09
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.07
3c8d_A 403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.06
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.05
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.04
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.03
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.02
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.01
2qm0_A 275 BES; alpha-beta structure, structural genomics, PS 96.98
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 96.97
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 96.93
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 96.92
2qs9_A 194 Retinoblastoma-binding protein 9; B5T overexpresse 96.92
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 96.9
2o2g_A 223 Dienelactone hydrolase; YP_324580.1, structural ge 96.7
1imj_A 210 CIB, CCG1-interacting factor B; alpha/beta hydrola 96.66
3llc_A 270 Putative hydrolase; structural genomics, joint cen 96.62
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 96.62
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 96.6
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 96.55
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 96.46
1uxo_A 192 YDEN protein; hydrolase, A/B hydrolase, esterase, 96.44
3b5e_A 223 MLL8374 protein; NP_108484.1, carboxylesterase, st 96.42
1fj2_A 232 Protein (acyl protein thioesterase 1); alpha/beta 96.38
2h1i_A 226 Carboxylesterase; structural genomics, PSI-2, prot 96.36
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 96.25
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 96.25
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 96.25
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 96.24
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 96.2
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 96.18
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.11
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 96.09
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 96.09
3og9_A 209 Protein YAHD A copper inducible hydrolase; alpha/b 96.01
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 96.0
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 95.99
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.97
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 95.94
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.89
1isp_A 181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.76
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 95.67
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 95.64
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 95.62
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 95.62
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 95.58
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 95.56
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 95.55
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 95.53
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 95.46
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 95.45
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 95.35
4h0c_A 210 Phospholipase/carboxylesterase; PSI-biology, midwe 95.32
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.27
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 95.25
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 95.19
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 95.14
1r3d_A 264 Conserved hypothetical protein VC1974; structural 95.11
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 95.1
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 95.09
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 95.08
2r8b_A 251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 95.05
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 95.03
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 95.02
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 94.94
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 94.89
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 94.88
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 94.79
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 94.74
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 94.73
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 94.73
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.64
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 94.63
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 94.57
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 94.51
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 94.41
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.4
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 94.39
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 94.35
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 94.34
3u0v_A 239 Lysophospholipase-like protein 1; alpha, beta hydr 94.32
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 94.18
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 94.12
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 94.09
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.07
4fhz_A 285 Phospholipase/carboxylesterase; alpha/beta hydrola 94.05
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 94.01
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 93.69
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 93.64
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 93.58
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 93.43
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 93.28
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 92.39
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 93.27
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 93.25
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 93.16
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 93.12
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 93.05
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 93.01
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 92.98
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 92.98
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 92.9
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 92.89
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 92.66
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 92.44
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 92.29
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 92.27
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 92.07
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 92.06
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 91.94
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 91.83
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 91.82
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 91.55
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 91.11
4f21_A 246 Carboxylesterase/phospholipase family protein; str 91.06
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 90.91
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 90.89
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 90.71
1iup_A 282 META-cleavage product hydrolase; aromatic compound 90.66
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 90.54
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 90.44
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 90.35
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 90.29
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 90.26
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 90.24
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 90.24
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 90.16
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 90.11
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 89.84
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 89.66
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 89.57
3uws_A126 Hypothetical protein; clostripain family protein, 89.32
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 87.72
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 87.54
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 87.54
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 87.19
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 86.91
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 86.63
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 85.83
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 84.53
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 84.46
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 83.09
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 82.88
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 82.69
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 82.48
1whs_A 255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 81.86
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 81.42
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
Probab=99.63  E-value=1.4e-16  Score=106.61  Aligned_cols=52  Identities=40%  Similarity=0.821  Sum_probs=45.9

Q ss_pred             CCCceEEEEEeCCccccCCCCCCCchHHHHh-cCCcEEEEeCCCCCCcccccC
Q psy9478          14 TTLLPVMVWIHGGGFAYGHGNADAYGPEFLM-NKNVILVTVNYRLGILGHVIL   65 (71)
Q Consensus        14 ~~~~pviv~iHGGg~~~g~~~~~~~~~~~~~-~~g~~vvsv~YRlap~Gf~~~   65 (71)
                      .+++|||||||||||..|+.....+....++ +.|++||++||||+++||+.+
T Consensus       106 ~~~~Pv~v~iHGG~~~~g~~~~~~~~~~~la~~~~~vvv~~nYRlg~~Gf~~~  158 (537)
T 1ea5_A          106 PKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLAL  158 (537)
T ss_dssp             CSSEEEEEEECCSTTTCCCTTCGGGCTHHHHHHHTCEEEECCCCCHHHHHCCC
T ss_pred             CCCCeEEEEECCCcccCCCCCCCccChHHHHhcCCEEEEEeccCccccccccC
Confidence            3678999999999999999987666677777 559999999999999999998



>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3uws_A Hypothetical protein; clostripain family protein, peptidase_C11, structural genomi center for structural genomics, JCSG; HET: MSE; 1.70A {Parabacteroides merdae} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 71
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 2e-11
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 5e-10
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 8e-09
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 1e-07
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 1e-06
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 1e-05
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 9e-05
d1jjia_ 311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 3e-04
d1p0ia_ 526 c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo 4e-04
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 8e-04
d1vkha_ 263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 0.003
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Bile-salt activated lipase (cholesterol esterase)
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 55.0 bits (131), Expect = 2e-11
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 14  TTLLPVMVWIHGGGFAYGHGNADAYGPEFLMN-------KNVILVTVNYRLGILGH 62
           +  LPVM+WI+GG F  G      +   +L +        NVI+VT NYR+G LG 
Sbjct: 95  SHDLPVMIWIYGGAFLMGASQGANFLSNYLYDGEEIATRGNVIVVTFNYRVGPLGF 150


>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Length = 526 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.77
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.77
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.76
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.76
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.76
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.76
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.73
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.73
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.73
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.72
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.55
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 99.52
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.5
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.45
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.45
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.39
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 98.77
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.7
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.69
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.21
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.04
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 97.85
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 97.77
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 97.56
d2gzsa1 265 Enterobactin and salmochelin hydrolase IroE {Esche 97.51
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 97.43
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.43
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 97.38
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.25
d2h1ia1 202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.23
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.16
d1wb4a1 273 Feruloyl esterase domain of the cellulosomal xylan 96.94
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 96.93
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 96.71
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.67
d2i3da1 218 Hypothetical protein Atu1826 {Agrobacterium tumefa 96.66
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 96.5
d2fuka1 218 XC6422 protein {Xanthomonas campestris [TaxId: 339 96.48
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 96.38
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 96.38
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 96.28
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 96.03
d3b5ea1 209 Uncharacterized protein Mll8374 {Mesorhizobium lot 95.99
d1dina_ 233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 95.73
d1imja_ 208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 95.65
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 95.59
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.32
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 95.31
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 95.08
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 95.0
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 95.0
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.93
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 94.88
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.88
d1jjfa_ 255 Feruloyl esterase domain of the cellulosomal xylan 94.65
d1uxoa_ 186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 94.59
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 94.47
d3c8da2 246 Enterochelin esterase, catalytic domain {Shigella 94.41
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 94.0
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 93.9
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 93.78
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 93.76
d1auoa_ 218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 93.75
d2r8ba1 203 Uncharacterized protein Atu2452 {Agrobacterium tum 93.67
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 93.65
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 93.17
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 93.09
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 93.03
d1fj2a_ 229 Acyl protein thioesterase 1 {Human (Homo sapiens) 90.7
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 90.52
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 90.42
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 90.17
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 89.7
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 87.92
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 87.4
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 85.07
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 84.92
d1ispa_ 179 Lipase A {Bacillus subtilis [TaxId: 1423]} 81.16
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 80.24
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Acetylcholinesterase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.77  E-value=6.7e-20  Score=119.57  Aligned_cols=65  Identities=34%  Similarity=0.723  Sum_probs=52.2

Q ss_pred             cccCCc------cCCCCCCceEEEEEeCCccccCCCCCCCchHHHHhc-CCcEEEEeCCCCCCcccccCCCc
Q psy9478           4 DTKCQV------KVAQTTLLPVMVWIHGGGFAYGHGNADAYGPEFLMN-KNVILVTVNYRLGILGHVILSTA   68 (71)
Q Consensus         4 ~~~~~~------~~~~~~~~pviv~iHGGg~~~g~~~~~~~~~~~~~~-~g~~vvsv~YRlap~Gf~~~~~~   68 (71)
                      +|||+.      ....++++|||||||||||..|+.....+....++. ++++||++||||++||||+++++
T Consensus        93 sEDCL~LnI~~P~~~~~~~lPV~v~ihGG~~~~gs~~~~~~~~~~~~~~~~vvvVt~nYRlg~~Gfl~~~~~  164 (542)
T d2ha2a1          93 SEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGS  164 (542)
T ss_dssp             ESCCCEEEEEEESSCCSSCEEEEEEECCSTTTCCCTTSGGGCTHHHHHHHCCEEEEECCCCHHHHHCCCTTC
T ss_pred             CCcCCEEEEEecCCCCCCCCcEEEEEEECccccccCcccccCchhhhhhccceeEeeeeeccceeeeccccc
Confidence            567765      223457889999999999999998876666655554 59999999999999999998743



>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure