Psyllid ID: psy9568
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| 321454596 | 335 | hypothetical protein DAPPUDRAFT_116992 [ | 0.572 | 0.423 | 0.488 | 2e-36 | |
| 156546349 | 342 | PREDICTED: protein shifted-like [Nasonia | 0.532 | 0.385 | 0.611 | 8e-36 | |
| 328700417 | 394 | PREDICTED: protein shifted-like [Acyrtho | 0.657 | 0.413 | 0.476 | 5e-35 | |
| 383863725 | 338 | PREDICTED: protein shifted-like isoform | 0.532 | 0.390 | 0.597 | 3e-34 | |
| 340714439 | 358 | PREDICTED: protein shifted-like isoform | 0.532 | 0.368 | 0.589 | 4e-34 | |
| 350399172 | 338 | PREDICTED: protein shifted-like isoform | 0.532 | 0.390 | 0.589 | 5e-34 | |
| 340714437 | 338 | PREDICTED: protein shifted-like isoform | 0.532 | 0.390 | 0.589 | 7e-34 | |
| 328788311 | 352 | PREDICTED: protein shifted isoform 1 [Ap | 0.532 | 0.375 | 0.589 | 7e-34 | |
| 328788309 | 338 | PREDICTED: protein shifted isoform 3 [Ap | 0.532 | 0.390 | 0.589 | 1e-33 | |
| 157129179 | 379 | hypothetical protein AaeL_AAEL011386 [Ae | 0.693 | 0.453 | 0.430 | 4e-33 |
| >gi|321454596|gb|EFX65761.1| hypothetical protein DAPPUDRAFT_116992 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 158 bits (399), Expect = 2e-36, Method: Compositional matrix adjust.
Identities = 86/176 (48%), Positives = 104/176 (59%), Gaps = 34/176 (19%)
Query: 18 SGICTEKCLNGGKCVQKDTCECQKGFYGLRCEFCICTEKCLNGGKCVQKDTCECQKGFYG 77
+ +C +C+NGG C C C GF G CE IC +KCLNGGKC+QKDTC+C KGFYG
Sbjct: 193 TALCYPQCMNGGSCTSPGMCSCPSGFQGRHCEGGICKDKCLNGGKCIQKDTCDCPKGFYG 252
Query: 78 LRCEFSKCIIPCLNGGRCKGVNKCRCPPGFLGDYCEIWQRPYISKCIIPCLNGGRCKGVN 137
LRCEF+KC+IPCLNGGRCKGVNKCRC PGF GD+CE+
Sbjct: 253 LRCEFTKCVIPCLNGGRCKGVNKCRCSPGFKGDHCEV----------------------- 289
Query: 138 KCRCPPGFLGDYCEIWQRPYICPKPCKQGVCSAARTCACYEGWFGRTCSQRSDSGE 193
PPG L QR ++C +PC+ G C C C+EGW G+ C RS + E
Sbjct: 290 ---TPPGRLA------QR-HLCQRPCRHGTCVGQNRCLCHEGWHGKLC-HRSMTNE 334
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156546349|ref|XP_001606619.1| PREDICTED: protein shifted-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328700417|ref|XP_003241249.1| PREDICTED: protein shifted-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383863725|ref|XP_003707330.1| PREDICTED: protein shifted-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340714439|ref|XP_003395736.1| PREDICTED: protein shifted-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350399172|ref|XP_003485441.1| PREDICTED: protein shifted-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340714437|ref|XP_003395735.1| PREDICTED: protein shifted-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328788311|ref|XP_003251103.1| PREDICTED: protein shifted isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|328788309|ref|XP_625183.2| PREDICTED: protein shifted isoform 3 [Apis mellifera] gi|380025843|ref|XP_003696673.1| PREDICTED: protein shifted-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|157129179|ref|XP_001655311.1| hypothetical protein AaeL_AAEL011386 [Aedes aegypti] gi|108872308|gb|EAT36533.1| AAEL011386-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| UNIPROTKB|F1NHY7 | 384 | WIF1 "Uncharacterized protein" | 0.637 | 0.411 | 0.455 | 5.2e-42 | |
| MGI|MGI:1344332 | 379 | Wif1 "Wnt inhibitory factor 1" | 0.637 | 0.416 | 0.449 | 4.6e-41 | |
| RGD|619774 | 379 | Wif1 "Wnt inhibitory factor 1" | 0.637 | 0.416 | 0.449 | 4.6e-41 | |
| UNIPROTKB|Q9Y5W5 | 379 | WIF1 "Wnt inhibitory factor 1" | 0.649 | 0.424 | 0.441 | 1.2e-40 | |
| UNIPROTKB|E2R4E3 | 379 | WIF1 "Uncharacterized protein" | 0.637 | 0.416 | 0.455 | 1.6e-40 | |
| UNIPROTKB|E1BNM8 | 381 | WIF1 "Uncharacterized protein" | 0.637 | 0.414 | 0.449 | 1.6e-40 | |
| FB|FBgn0003390 | 456 | shf "shifted" [Drosophila mela | 0.552 | 0.300 | 0.503 | 4.2e-40 | |
| ZFIN|ZDB-GENE-990712-17 | 378 | wif1 "wnt inhibitory factor 1" | 0.669 | 0.439 | 0.429 | 1.1e-39 | |
| UNIPROTKB|F1NA43 | 866 | F1NA43 "Uncharacterized protei | 0.649 | 0.185 | 0.424 | 8.5e-37 | |
| ZFIN|ZDB-GENE-050208-577 | 1983 | si:ch211-246m6.5 "si:ch211-246 | 0.649 | 0.081 | 0.430 | 8.8e-37 |
| UNIPROTKB|F1NHY7 WIF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 445 (161.7 bits), Expect = 5.2e-42, P = 5.2e-42
Identities = 77/169 (45%), Positives = 95/169 (56%)
Query: 21 CTEKCLNGGKCVQKDTCECQKGFYGLRCEFCICTEKCLNGGKCVQKDTCECQKGFYGLRC 80
C C NGG C ++ CEC GFYG CE +C +C+NGG C+ C C GFYG+ C
Sbjct: 187 CPGGCRNGGFCNERHVCECPDGFYGPHCEKALCAPRCMNGGLCITPGLCICPPGFYGINC 246
Query: 81 EFSKCIIPCLNGGRCKGVNKCRCPPGFLGDYCEIWQRPYISKCIIPCLNGGRCKGVNKCR 140
+ + C C NGG C + KC CP GF GD CEI SKC PC NGG+C G NKC+
Sbjct: 247 DKANCTTTCFNGGTCFYLGKCICPSGFEGDQCEI------SKCHQPCRNGGKCMGKNKCK 300
Query: 141 CPPGFLGDYCEIWQRPYICPKPCK-QGVCSAARTCACYEGWFGRTCSQR 188
C G+ GD C +P +C C G C+ C C EGW GR C++R
Sbjct: 301 CSKGYQGDLCS---KP-VCEPGCGLYGTCAEPNKCHCKEGWHGRHCNKR 345
|
|
| MGI|MGI:1344332 Wif1 "Wnt inhibitory factor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619774 Wif1 "Wnt inhibitory factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y5W5 WIF1 "Wnt inhibitory factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4E3 WIF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNM8 WIF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003390 shf "shifted" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990712-17 wif1 "wnt inhibitory factor 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NA43 F1NA43 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-577 si:ch211-246m6.5 "si:ch211-246m6.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| KOG1225|consensus | 525 | 99.68 | ||
| KOG1225|consensus | 525 | 99.67 | ||
| KOG1226|consensus | 783 | 99.41 | ||
| KOG1226|consensus | 783 | 99.21 | ||
| KOG1219|consensus | 4289 | 99.11 | ||
| KOG1219|consensus | 4289 | 99.08 | ||
| KOG4289|consensus | 2531 | 98.91 | ||
| KOG4289|consensus | 2531 | 98.89 | ||
| KOG1217|consensus | 487 | 98.51 | ||
| KOG1217|consensus | 487 | 98.35 | ||
| KOG1214|consensus | 1289 | 98.19 | ||
| KOG1214|consensus | 1289 | 98.12 | ||
| KOG4260|consensus | 350 | 98.08 | ||
| KOG0994|consensus | 1758 | 97.86 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.8 | |
| KOG4260|consensus | 350 | 97.75 | ||
| KOG0994|consensus | 1758 | 97.49 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 97.29 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.25 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 96.98 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.89 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.85 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 96.73 | |
| smart00051 | 63 | DSL delta serrate ligand. | 96.58 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 96.27 | |
| KOG1836|consensus | 1705 | 96.13 | ||
| KOG1218|consensus | 316 | 96.06 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.86 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 95.84 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 95.39 | |
| KOG1218|consensus | 316 | 95.12 | ||
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 94.75 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 94.51 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 94.46 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 94.29 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 94.07 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 93.37 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 93.34 | |
| KOG1836|consensus | 1705 | 93.17 | ||
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 93.07 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 92.88 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 92.83 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 92.61 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 92.29 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 91.94 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 90.99 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 90.98 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 90.46 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 89.64 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 85.57 | |
| KOG3607|consensus | 716 | 85.48 | ||
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 80.57 | |
| PF01683 | 52 | EB: EB module; InterPro: IPR006149 The EB domain h | 80.19 |
| >KOG1225|consensus | Back alignment and domain information |
|---|
Probab=99.68 E-value=4.4e-16 Score=137.81 Aligned_cols=130 Identities=35% Similarity=0.987 Sum_probs=66.2
Q ss_pred ceeeCCCCcCCCCCcCCCCCCCCCCCeecCCCceeeCCCCccCCCCcCCCCCCCCCCceecCCCceeCCCCcccCCCCcc
Q psy9568 36 TCECQKGFYGLRCEFCICTEKCLNGGKCVQKDTCECQKGFYGLRCEFSKCIIPCLNGGRCKGVNKCRCPPGFLGDYCEIW 115 (248)
Q Consensus 36 ~C~C~~G~~G~~C~~~~c~~~C~~~g~C~~~~~C~C~~g~~G~~C~~~~C~~~C~~~g~C~~~~~C~C~~g~~g~~C~~~ 115 (248)
.|.|+.+|+|+.|....|...|.++|.|++ ++|+|++||.|..|+...|...|++++.+.. +.|+|++||.|..|++.
T Consensus 235 ic~c~~~~~g~~c~~~~C~~~c~~~g~c~~-G~CIC~~Gf~G~dC~e~~Cp~~cs~~g~~~~-g~CiC~~g~~G~dCs~~ 312 (525)
T KOG1225|consen 235 ICECPEGYFGPLCSTIYCPGGCTGRGQCVE-GRCICPPGFTGDDCDELVCPVDCSGGGVCVD-GECICNPGYSGKDCSIR 312 (525)
T ss_pred eeecCCceeCCccccccCCCCCcccceEeC-CeEeCCCCCcCCCCCcccCCcccCCCceecC-CEeecCCCccccccccc
Confidence 455555555555554445555555555554 5555555555555554445544555555543 35555555555555432
Q ss_pred CCCCCCCCCCCCCCCceeeCCCeeeCCCCCCCCCCCcCCCCCCCCCCCCC-CccCCCCeeecCCCCccCC
Q psy9568 116 QRPYISKCIIPCLNGGRCKGVNKCRCPPGFLGDYCEIWQRPYICPKPCKQ-GVCSAARTCACYEGWFGRT 184 (248)
Q Consensus 116 ~~~~~~~c~~~C~~~g~C~~~~~C~C~~g~~g~~C~~~~~~~~c~~~C~~-g~C~~~~~C~C~~g~~G~~ 184 (248)
. |...|.++|.|+ .++|.|.+||+|..|+.. . |.+ |.|+ .+ |.|..||.|.+
T Consensus 313 ~------cpadC~g~G~Ci-~G~C~C~~Gy~G~~C~~~-------~-C~~~g~cv-~g-C~C~~Gw~G~d 365 (525)
T KOG1225|consen 313 R------CPADCSGHGKCI-DGECLCDEGYTGELCIQR-------A-CSGGGQCV-NG-CKCKKGWRGPD 365 (525)
T ss_pred c------CCccCCCCCccc-CCceEeCCCCcCCccccc-------c-cCCCceec-cC-ceeccCccCCC
Confidence 1 223455555555 355555555555555541 1 444 3444 23 55555555554
|
|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3607|consensus | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 248 | ||||
| 2ygq_A | 324 | Wif Domain-Epidermal Growth Factor (Egf)-Like Domai | 2e-31 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 4e-07 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 2e-06 | ||
| 2vj2_A | 169 | Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 | 6e-05 | ||
| 2wft_A | 458 | Crystal Structure Of The Human Hip Ectodomain Lengt | 5e-04 | ||
| 3ho3_A | 481 | Crystal Structure Of Hedgehog-interacting Protein ( | 7e-04 | ||
| 2wg3_C | 463 | Crystal Structure Of The Complex Between Human Hedg | 7e-04 | ||
| 2wg4_B | 457 | Crystal Structure Of The Complex Between Human Hedg | 7e-04 | ||
| 3ho4_A | 481 | Crystal Structure Of Hedgehog-Interacting Protein ( | 7e-04 |
| >pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 | Back alignment and structure |
|
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
| >pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 | Back alignment and structure |
| >pdb|2WFT|A Chain A, Crystal Structure Of The Human Hip Ectodomain Length = 458 | Back alignment and structure |
| >pdb|3HO3|A Chain A, Crystal Structure Of Hedgehog-interacting Protein (hhip) Length = 481 | Back alignment and structure |
| >pdb|2WG3|C Chain C, Crystal Structure Of The Complex Between Human Hedgehog- Interacting Protein Hip And Desert Hedgehog Without Calcium Length = 463 | Back alignment and structure |
| >pdb|3HO4|A Chain A, Crystal Structure Of Hedgehog-Interacting Protein (Hhip) Length = 481 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 8e-42 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 4e-34 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-26 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 8e-22 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-18 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 5e-18 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-17 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-15 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-12 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 3e-07 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 3e-16 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 1e-14 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 1e-10 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 5e-16 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-13 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 1e-14 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 1e-12 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 5e-14 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 1e-09 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 4e-11 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-07 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 5e-04 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 5e-11 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 6e-09 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-08 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-05 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-04 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 2e-09 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 3e-09 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 1e-08 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 3e-07 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 4e-09 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 6e-09 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 1e-07 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-08 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 2e-08 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 6e-06 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-05 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 4e-08 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-07 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 7e-07 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-05 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 2e-05 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 2e-04 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 8e-04 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 9e-04 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 2e-04 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 2e-04 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 3e-04 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 6e-04 |
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
Score = 144 bits (364), Expect = 8e-42
Identities = 75/175 (42%), Positives = 94/175 (53%), Gaps = 11/175 (6%)
Query: 20 ICTEKCLNGGKCVQKDTCECQKGFYGLRCEFCICTEKCLNGGKCVQKDTCECQKGFYGLR 79
C C NGG C ++ CEC GF+G CE +CT +C+NGG CV C C GFYG+
Sbjct: 150 ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN 209
Query: 80 CEFSKCIIPCLNGGRCKGVNKCRCPPGFLGDYCEIWQRPYISKCIIPCLNGGRCKGVNKC 139
C+ + C C NGG C KC CPPG G+ CE ISKC PC NGG+C G +KC
Sbjct: 210 CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCE------ISKCPQPCRNGGKCIGKSKC 263
Query: 140 RCPPGFLGDYCEIWQRPYICPKPCKQ-GVCSAARTCACYEGWFGRTCSQRSDSGE 193
+C G+ GD C +C C G C C C EGW GR C++R ++
Sbjct: 264 KCSKGYQGDLCSK----PVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASL 314
|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.95 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.84 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.83 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.83 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.76 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.75 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.62 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.58 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.57 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.54 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.54 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.53 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.5 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.48 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.48 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.46 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 99.4 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.39 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.35 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.27 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.17 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.15 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 99.13 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.05 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.04 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 99.01 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.96 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.84 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.8 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.79 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.76 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.68 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.6 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.5 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.49 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.44 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.31 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.21 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.2 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.19 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.15 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.13 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.12 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.09 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.09 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.08 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.07 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.05 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.0 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.96 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.93 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.87 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.82 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.81 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.8 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.78 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.77 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.73 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.73 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.72 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.71 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.66 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.6 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.55 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.55 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.53 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.43 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.43 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.39 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.38 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.38 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.37 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.32 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.26 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.18 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.08 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.05 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 96.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.93 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.82 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.73 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.68 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.66 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 96.65 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.57 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.55 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.47 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 96.37 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.31 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.17 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 96.08 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.06 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 95.94 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 95.86 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 95.6 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 95.59 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 95.4 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 95.4 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 95.33 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 95.16 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 95.12 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 94.97 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 94.93 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 94.18 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 93.9 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 93.71 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 93.64 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 93.46 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 92.76 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 92.7 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 92.3 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 92.02 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 91.29 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 91.28 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 91.1 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 91.02 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 90.16 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 90.05 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 89.88 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 88.85 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 88.59 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 86.16 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 84.48 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 83.94 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 83.69 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 81.87 | |
| 3g5c_A | 510 | ADAM 22; alpha/beta fold, cross-linked domain, cel | 80.37 |
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=2.9e-28 Score=206.93 Aligned_cols=163 Identities=45% Similarity=1.161 Sum_probs=89.7
Q ss_pred CCCCcCCCCCCEeecCCceeeCCCCcCCCCCcCCCCCCCCCCCeecCCCceeeCCCCccCCCCcCCCCCCCCCCceecCC
Q psy9568 19 GICTEKCLNGGKCVQKDTCECQKGFYGLRCEFCICTEKCLNGGKCVQKDTCECQKGFYGLRCEFSKCIIPCLNGGRCKGV 98 (248)
Q Consensus 19 ~~C~~~C~~~g~C~~~~~C~C~~G~~G~~C~~~~c~~~C~~~g~C~~~~~C~C~~g~~G~~C~~~~C~~~C~~~g~C~~~ 98 (248)
..|+++|.++|.|++.+.|.|++||+|..|+...|..+|.++|+|+..+.|.|++||.|..|+.+.|..+|.++|+|...
T Consensus 149 ~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~G~C~~~ 228 (324)
T 2ygq_A 149 AECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYP 228 (324)
T ss_dssp CCCSSCCCSSCEECTTSCEECCTTEESSSSCEESSSSCCCTTCEECSSCCEECCTTCBTTTTCBCCCSSCCCSSCCBSCS
T ss_pred CCCCCCCCCCCEECCCCeEECCCCCcCCCCCCCCCCCCCCCCCEEcCCCEEeCCCCccCCCcccCcCCCCCCCCCeeCCC
Confidence 57888999999999889999999999999998788889999999999999999999999999988899999999999988
Q ss_pred CceeCCCCcccCCCCccCCCCCCCCCCCCCCCceeeCCCeeeCCCCCCCCCCCcCCCCCCCCCCCCC-CccCCCCeeecC
Q psy9568 99 NKCRCPPGFLGDYCEIWQRPYISKCIIPCLNGGRCKGVNKCRCPPGFLGDYCEIWQRPYICPKPCKQ-GVCSAARTCACY 177 (248)
Q Consensus 99 ~~C~C~~g~~g~~C~~~~~~~~~~c~~~C~~~g~C~~~~~C~C~~g~~g~~C~~~~~~~~c~~~C~~-g~C~~~~~C~C~ 177 (248)
+.|.|.+||+|..|+.. .|..+|.++|.|...++|.|.+||+|..|+. +.|..+|.+ |+|...++|.|+
T Consensus 229 ~~C~C~~G~~G~~C~~~------~C~~~C~~~g~C~~~~~C~C~~G~~G~~C~~----~~C~~~C~~~g~C~~~~~C~C~ 298 (324)
T 2ygq_A 229 GKCICPPGLEGEQCEIS------KCPQPCRNGGKCIGKSKCKCSKGYQGDLCSK----PVCEPGCGAHGTCHEPNKCQCQ 298 (324)
T ss_dssp SCBCCCTTCCTTTTC-----------------------------------------------------------------
T ss_pred CeeeCCCCccCCCCCcC------cCCCcCCCCCEECCCCEEECCCCCcCCCCcC----CCCCCCCCCCCEECCCCEeECC
Confidence 99999999999999852 3446899999999888999999999999985 456678865 999988999999
Q ss_pred CCCccCCCCCCCCC
Q psy9568 178 EGWFGRTCSQRSDS 191 (248)
Q Consensus 178 ~g~~G~~C~~~~~~ 191 (248)
+||+|..|+.....
T Consensus 299 ~G~~G~~C~~~~~~ 312 (324)
T 2ygq_A 299 EGWHGRHCNKRYEA 312 (324)
T ss_dssp --------------
T ss_pred CCCcCCCCCCCCcc
Confidence 99999999876544
|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 248 | ||||
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 0.002 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 0.002 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 0.003 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 0.003 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 0.004 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 0.004 |
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Factor X, N-terminal module species: Human (Homo sapiens) [TaxId: 9606]
Score = 32.7 bits (75), Expect = 0.002
Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%)
Query: 88 PCLNGGRCK-GVN--KCRCPPGFLGDYCEIWQR 117
PC N G+CK G+ C C GF G CE++ R
Sbjct: 7 PCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTR 39
|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.34 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.28 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.19 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.16 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.14 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.13 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.13 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.08 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.07 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.04 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.0 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.99 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.95 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.95 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.9 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.9 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.82 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.81 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.67 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.58 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.44 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.43 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.42 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.31 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.03 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.98 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.97 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.65 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.6 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.59 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 96.52 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 96.52 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 96.48 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 96.22 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 96.12 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.76 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 95.74 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.73 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 95.7 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 95.58 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.39 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 95.34 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 95.1 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.04 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.78 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 94.72 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.57 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.52 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 93.97 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 93.66 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 93.59 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 93.3 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.27 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.21 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.42 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.14 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.07 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 90.21 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 89.37 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 87.11 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 86.98 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 85.56 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 80.05 |
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Activated protein c (autoprothrombin IIa) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.34 E-value=1.5e-07 Score=54.37 Aligned_cols=35 Identities=31% Similarity=0.851 Sum_probs=28.0
Q ss_pred CCCC-CCCCCCCccC---CCCeeecCCCCccCCCCCCCC
Q psy9568 156 PYIC-PKPCKQGVCS---AARTCACYEGWFGRTCSQRSD 190 (248)
Q Consensus 156 ~~~c-~~~C~~g~C~---~~~~C~C~~g~~G~~C~~~~~ 190 (248)
.+.| +++|.||+|. ++|+|.|++||+|..|++++.
T Consensus 8 ~~~C~~~PC~nG~C~~~~~~y~C~C~~G~~G~~Ce~~I~ 46 (48)
T d1autl1 8 EHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVS 46 (48)
T ss_dssp CCSSSSTTTTSEEECCCSSCCCEEECTTEESTTSCEECC
T ss_pred CCcccCCCCCCCEEECCCCCCeEeCCCCCcCCCcccccC
Confidence 3455 6888888887 688999999999999987653
|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|