Psyllid ID: psy9593


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MFSAIITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGLKPPTSRP
cccHHcccccHHHHHHHHHcccEEEEccccHHHHHHHHHHHHcccEEEEEccccccccccccccEEcccccccccccccccccc
cccEEEEccHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHcccEEEEEcccccEHHcccccEEEccHHHccccccHHccccc
mfsaiitsssilpyqSRLRATKILLIGVEGVGAEIAKNIILSGVKSVclldsgvvtkedvntaqflaphedigknglkpptsrp
mfsaiitsssilpyqSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVntaqflaphedigknglkpptsrp
MFSAIITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGLKPPTSRP
****IITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLA*****************
**SA*ITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGL****S**
********SSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNG********
MFSAIITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDI************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSAIITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGLKPPTSRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q28DS0 347 SUMO-activating enzyme su yes N/A 0.845 0.204 0.472 7e-12
Q8JGT5 344 SUMO-activating enzyme su N/A N/A 0.845 0.206 0.472 1e-11
Q5NVN7 346 SUMO-activating enzyme su yes N/A 0.75 0.182 0.531 4e-11
Q9UBE0 346 SUMO-activating enzyme su no N/A 0.75 0.182 0.531 4e-11
Q6IQS6 348 SUMO-activating enzyme su yes N/A 0.845 0.204 0.472 9e-11
Q6AXQ0 349 SUMO-activating enzyme su yes N/A 0.75 0.180 0.5 1e-10
A2VE14 346 SUMO-activating enzyme su yes N/A 0.75 0.182 0.515 1e-10
Q9R1T2 350 SUMO-activating enzyme su yes N/A 0.75 0.18 0.5 2e-10
P31254 1058 Ubiquitin-like modifier-a no N/A 0.678 0.053 0.517 4e-09
P92974 1077 Ubiquitin-activating enzy yes N/A 0.690 0.053 0.525 9e-09
>sp|Q28DS0|SAE1_XENTR SUMO-activating enzyme subunit 1 OS=Xenopus tropicalis GN=sae1 PE=2 SV=1 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 51/72 (70%), Gaps = 1/72 (1%)

Query: 12 LPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHED 71
          L  Q RLR +++LL+G+ G+GAE+AKN+IL+GVK++ LLD   V+ ED + AQFL P   
Sbjct: 26 LEAQKRLRTSRVLLVGMRGLGAEVAKNLILAGVKALTLLDHEQVSSED-SRAQFLIPSGS 84

Query: 72 IGKNGLKPPTSR 83
          +G+N  +   +R
Sbjct: 85 LGQNRAEASLNR 96




The heterodimer acts as a E1 ligase for sumo1, sumo2, and sumo3. It mediates ATP-dependent activation of sumo proteins followed by formation of a thioester bond between a sumo protein and a conserved active site cysteine residue on uba2/sae2.
Xenopus tropicalis (taxid: 8364)
>sp|Q8JGT5|SAE1_XENLA SUMO-activating enzyme subunit 1 OS=Xenopus laevis GN=sae1 PE=2 SV=1 Back     alignment and function description
>sp|Q5NVN7|SAE1_PONAB SUMO-activating enzyme subunit 1 OS=Pongo abelii GN=SAE1 PE=2 SV=2 Back     alignment and function description
>sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens GN=SAE1 PE=1 SV=1 Back     alignment and function description
>sp|Q6IQS6|SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio rerio GN=sae1 PE=2 SV=1 Back     alignment and function description
>sp|Q6AXQ0|SAE1_RAT SUMO-activating enzyme subunit 1 OS=Rattus norvegicus GN=Sae1 PE=2 SV=1 Back     alignment and function description
>sp|A2VE14|SAE1_BOVIN SUMO-activating enzyme subunit 1 OS=Bos taurus GN=SAE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9R1T2|SAE1_MOUSE SUMO-activating enzyme subunit 1 OS=Mus musculus GN=Sae1 PE=2 SV=1 Back     alignment and function description
>sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Ube1ay PE=2 SV=2 Back     alignment and function description
>sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
443691790 348 hypothetical protein CAPTEDRAFT_156595 [ 0.75 0.181 0.625 2e-13
357620824 448 SUMO-1 activating enzyme [Danaus plexipp 0.75 0.140 0.640 2e-13
242017702 337 sumo-1-activating enzyme E1a, putative [ 0.726 0.181 0.677 2e-13
380010923 334 PREDICTED: SUMO-activating enzyme subuni 0.845 0.212 0.611 1e-12
156407222 342 predicted protein [Nematostella vectensi 0.845 0.207 0.513 2e-12
340710916 335 PREDICTED: SUMO-activating enzyme subuni 0.845 0.211 0.569 4e-12
307187687 334 SUMO-activating enzyme subunit 1 [Campon 0.75 0.188 0.609 5e-12
328788838 334 PREDICTED: SUMO-activating enzyme subuni 0.845 0.212 0.597 5e-12
332016374 333 SUMO-activating enzyme subunit 1 [Acromy 0.75 0.189 0.625 8e-12
350400738 335 PREDICTED: SUMO-activating enzyme subuni 0.845 0.211 0.555 1e-11
>gi|443691790|gb|ELT93541.1| hypothetical protein CAPTEDRAFT_156595 [Capitella teleta] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/64 (62%), Positives = 50/64 (78%), Gaps = 1/64 (1%)

Query: 12 LPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHED 71
          L  Q RLRA ++LLIGV G+GAE+AKNI+LSG+KS+ LLD  VVTKE   T+QFL P  +
Sbjct: 26 LDAQRRLRAARVLLIGVGGLGAEVAKNIVLSGIKSLTLLDHQVVTKEAF-TSQFLIPRSE 84

Query: 72 IGKN 75
          +GKN
Sbjct: 85 LGKN 88




Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota

>gi|357620824|gb|EHJ72871.1| SUMO-1 activating enzyme [Danaus plexippus] Back     alignment and taxonomy information
>gi|242017702|ref|XP_002429326.1| sumo-1-activating enzyme E1a, putative [Pediculus humanus corporis] gi|212514229|gb|EEB16588.1| sumo-1-activating enzyme E1a, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380010923|ref|XP_003689565.1| PREDICTED: SUMO-activating enzyme subunit 1-like [Apis florea] Back     alignment and taxonomy information
>gi|156407222|ref|XP_001641443.1| predicted protein [Nematostella vectensis] gi|156228582|gb|EDO49380.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|340710916|ref|XP_003394029.1| PREDICTED: SUMO-activating enzyme subunit 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307187687|gb|EFN72659.1| SUMO-activating enzyme subunit 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328788838|ref|XP_394348.4| PREDICTED: SUMO-activating enzyme subunit 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|332016374|gb|EGI57287.1| SUMO-activating enzyme subunit 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350400738|ref|XP_003485941.1| PREDICTED: SUMO-activating enzyme subunit 1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
UNIPROTKB|Q8JGT5 344 sae1 "SUMO-activating enzyme s 0.845 0.206 0.472 8.7e-12
UNIPROTKB|Q28DS0 347 sae1 "SUMO-activating enzyme s 0.845 0.204 0.472 8.9e-12
UNIPROTKB|B3KNJ4 299 SAE1 "cDNA FLJ14689 fis, clone 0.75 0.210 0.531 2e-11
FB|FBgn0029512 337 Aos1 "Aos1" [Drosophila melano 0.845 0.210 0.527 2.9e-11
UNIPROTKB|Q9UBE0 346 SAE1 "SUMO-activating enzyme s 0.75 0.182 0.531 3.2e-11
UNIPROTKB|Q5NVN7 346 SAE1 "SUMO-activating enzyme s 0.75 0.182 0.531 3.2e-11
UNIPROTKB|E2RSL5 346 SAE1 "Uncharacterized protein" 0.75 0.182 0.515 6.8e-11
UNIPROTKB|F1RM03 346 SAE1 "Uncharacterized protein" 0.75 0.182 0.515 8.7e-11
ZFIN|ZDB-GENE-040625-21 348 sae1 "SUMO1 activating enzyme 0.75 0.181 0.515 8.9e-11
RGD|1306098 349 Sae1 "SUMO1 activating enzyme 0.75 0.180 0.5 8.9e-11
UNIPROTKB|Q8JGT5 sae1 "SUMO-activating enzyme subunit 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 8.7e-12, P = 8.7e-12
 Identities = 34/72 (47%), Positives = 51/72 (70%)

Query:    12 LPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHED 71
             L  Q RLR +++LL+G+ G+GAE+AKN+IL+GVK++ LLD   V+ ED + AQFL P   
Sbjct:    26 LEAQKRLRTSRVLLVGMRGLGAEVAKNLILAGVKALTLLDHEQVSSED-SRAQFLIPSGS 84

Query:    72 IGKNGLKPPTSR 83
             +G+N  +   +R
Sbjct:    85 LGQNRAEASLNR 96




GO:0016925 "protein sumoylation" evidence=ISS
GO:0019948 "SUMO activating enzyme activity" evidence=ISS
UNIPROTKB|Q28DS0 sae1 "SUMO-activating enzyme subunit 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|B3KNJ4 SAE1 "cDNA FLJ14689 fis, clone NT2RP2005204, highly similar to Ubiquitin-like 1-activating enzyme E1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0029512 Aos1 "Aos1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBE0 SAE1 "SUMO-activating enzyme subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5NVN7 SAE1 "SUMO-activating enzyme subunit 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSL5 SAE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RM03 SAE1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-21 sae1 "SUMO1 activating enzyme subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306098 Sae1 "SUMO1 activating enzyme subunit 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5NVN7SAE1_PONABNo assigned EC number0.53120.750.1820yesN/A
P92974UBE12_ARATHNo assigned EC number0.52540.69040.0538yesN/A
A2VE14SAE1_BOVINNo assigned EC number0.51560.750.1820yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
cd01492 197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 3e-23
cd01491 286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 3e-16
cd01485 198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 4e-13
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 2e-12
COG0476 254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 8e-11
cd01493 425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 8e-10
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 6e-09
PTZ00245 287 PTZ00245, PTZ00245, ubiquitin activating enzyme; P 8e-08
pfam00899134 pfam00899, ThiF, ThiF family 2e-07
cd01489 312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 2e-06
cd01488 291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 4e-06
cd01484 234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 8e-06
PRK08328 231 PRK08328, PRK08328, hypothetical protein; Provisio 3e-04
cd00757 228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 0.001
cd01487 174 cd01487, E1_ThiF_like, E1_ThiF_like 0.002
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
 Score = 87.3 bits (217), Expect = 3e-23
 Identities = 36/61 (59%), Positives = 50/61 (81%), Gaps = 1/61 (1%)

Query: 15 QSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGK 74
          Q RLR+ +ILLIG++G+GAEIAKN++LSG+ S+ +LD   VT+ED+  AQFL P ED+G+
Sbjct: 16 QKRLRSARILLIGLKGLGAEIAKNLVLSGIGSLTILDDRTVTEEDLG-AQFLIPAEDLGQ 74

Query: 75 N 75
          N
Sbjct: 75 N 75


Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain. Length = 197

>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 99.92
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 99.92
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 99.92
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 99.91
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 99.91
cd01485 198 E1-1_like Ubiquitin activating enzyme (E1), repeat 99.91
PRK07411 390 hypothetical protein; Validated 99.91
PRK08223 287 hypothetical protein; Validated 99.91
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 99.91
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 99.91
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.9
cd00755 231 YgdL_like Family of activating enzymes (E1) of ubi 99.9
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 99.89
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 99.89
PTZ00245 287 ubiquitin activating enzyme; Provisional 99.88
cd01493 425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 99.88
PRK08328 231 hypothetical protein; Provisional 99.87
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 99.87
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 99.87
PRK15116 268 sulfur acceptor protein CsdL; Provisional 99.87
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.86
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.86
cd01488 291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 99.86
cd01484 234 E1-2_like Ubiquitin activating enzyme (E1), repeat 99.86
COG0476 254 ThiF Dinucleotide-utilizing enzymes involved in mo 99.86
PRK14851 679 hypothetical protein; Provisional 99.85
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 99.85
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 99.85
PRK14852 989 hypothetical protein; Provisional 99.85
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 99.85
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.84
KOG2015|consensus 422 99.84
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.83
KOG2013|consensus 603 99.82
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.82
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.81
PRK06153 393 hypothetical protein; Provisional 99.81
COG1179 263 Dinucleotide-utilizing enzymes involved in molybdo 99.8
cd01486 307 Apg7 Apg7 is an E1-like protein, that activates tw 99.8
KOG2014|consensus 331 99.78
KOG2017|consensus 427 99.78
TIGR03736 244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.76
PRK07877 722 hypothetical protein; Provisional 99.75
cd01487 174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.74
KOG2012|consensus 1013 99.74
KOG2012|consensus 1013 99.73
KOG2018|consensus 430 99.65
TIGR03603 318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 99.63
KOG2016|consensus 523 99.62
KOG2336|consensus 422 99.25
KOG2337|consensus 669 99.21
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 98.33
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.89
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 97.67
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.56
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.52
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.24
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.11
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.1
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.07
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.99
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.99
COG4015 217 Predicted dinucleotide-utilizing enzyme of the Thi 96.9
PF03949 255 Malic_M: Malic enzyme, NAD binding domain; InterPr 96.84
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.84
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.83
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.81
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 96.77
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.76
PRK13940 414 glutamyl-tRNA reductase; Provisional 96.68
PTZ00117 319 malate dehydrogenase; Provisional 96.67
PRK06719157 precorrin-2 dehydrogenase; Validated 96.66
cd00762 254 NAD_bind_malic_enz NAD(P) binding domain of malic 96.65
PTZ00082 321 L-lactate dehydrogenase; Provisional 96.64
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.64
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.6
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.54
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 96.53
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 96.49
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.48
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.47
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.46
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 96.45
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.44
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.42
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 96.38
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 96.37
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.36
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.34
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.33
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 96.32
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 96.32
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.31
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.22
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.21
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.17
PRK14982 340 acyl-ACP reductase; Provisional 96.15
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.15
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 96.15
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.14
PRK09126 392 hypothetical protein; Provisional 96.14
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 96.13
PRK12367 245 short chain dehydrogenase; Provisional 96.12
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.12
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.08
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 96.08
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 96.07
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 96.06
PLN00203 519 glutamyl-tRNA reductase 96.03
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.0
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.99
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.96
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.95
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.94
PRK06185 407 hypothetical protein; Provisional 95.94
PRK06184 502 hypothetical protein; Provisional 95.93
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 95.91
PRK08013 400 oxidoreductase; Provisional 95.91
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.91
PRK07236 386 hypothetical protein; Provisional 95.87
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.87
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 95.85
PRK06223 307 malate dehydrogenase; Reviewed 95.84
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 95.84
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.83
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 95.83
COG0281 432 SfcA Malic enzyme [Energy production and conversio 95.82
PRK13403 335 ketol-acid reductoisomerase; Provisional 95.8
PRK06753 373 hypothetical protein; Provisional 95.8
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 95.79
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.78
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.78
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.75
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.75
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.75
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 95.74
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.72
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.71
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.7
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.68
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 95.67
PRK08163 396 salicylate hydroxylase; Provisional 95.67
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 95.65
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 95.62
PRK06847 375 hypothetical protein; Provisional 95.61
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.59
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.58
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.57
PRK08264 238 short chain dehydrogenase; Validated 95.53
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.53
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 95.53
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.53
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 95.52
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 95.52
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 95.51
PRK05479 330 ketol-acid reductoisomerase; Provisional 95.5
PRK08244 493 hypothetical protein; Provisional 95.49
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 95.48
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 95.48
PRK13243 333 glyoxylate reductase; Reviewed 95.48
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 95.47
PLN02602 350 lactate dehydrogenase 95.47
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.46
PRK12480 330 D-lactate dehydrogenase; Provisional 95.46
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.45
PF13738 203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.42
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 95.41
PRK11728 393 hydroxyglutarate oxidase; Provisional 95.41
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 95.41
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.4
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 95.39
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 95.37
PRK12862 763 malic enzyme; Reviewed 95.37
PRK06834 488 hypothetical protein; Provisional 95.36
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 95.35
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.34
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.32
PRK06126 545 hypothetical protein; Provisional 95.31
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 95.3
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 95.3
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 95.3
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 95.29
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.29
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.29
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.28
PRK07045 388 putative monooxygenase; Reviewed 95.28
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 95.28
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 95.27
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 95.27
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.26
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 95.23
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.23
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.22
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 95.22
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.21
PLN02928 347 oxidoreductase family protein 95.2
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.2
PRK05868 372 hypothetical protein; Validated 95.19
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.19
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.18
PLN00106 323 malate dehydrogenase 95.18
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.17
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.17
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 95.17
PRK07588 391 hypothetical protein; Provisional 95.17
PRK08132 547 FAD-dependent oxidoreductase; Provisional 95.12
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.11
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 95.11
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 95.09
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.08
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 95.06
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 95.06
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.06
PRK12861 764 malic enzyme; Reviewed 95.06
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.05
PRK06194 287 hypothetical protein; Provisional 95.04
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 95.04
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.04
PRK06198 260 short chain dehydrogenase; Provisional 95.01
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 95.0
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 95.0
PRK07190 487 hypothetical protein; Provisional 95.0
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 94.98
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.98
PRK06475 400 salicylate hydroxylase; Provisional 94.96
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.94
PRK07417 279 arogenate dehydrogenase; Reviewed 94.93
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 94.93
PRK10157 428 putative oxidoreductase FixC; Provisional 94.91
PTZ00325 321 malate dehydrogenase; Provisional 94.9
PRK07576 264 short chain dehydrogenase; Provisional 94.89
PRK12829 264 short chain dehydrogenase; Provisional 94.89
PRK08213 259 gluconate 5-dehydrogenase; Provisional 94.89
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 94.86
PRK07538 413 hypothetical protein; Provisional 94.84
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 94.81
PLN02464 627 glycerol-3-phosphate dehydrogenase 94.79
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.76
PF00106 167 adh_short: short chain dehydrogenase alcohol dehyd 94.75
PRK06841 255 short chain dehydrogenase; Provisional 94.74
PRK08294 634 phenol 2-monooxygenase; Provisional 94.73
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 94.73
PRK10669558 putative cation:proton antiport protein; Provision 94.72
PLN03129 581 NADP-dependent malic enzyme; Provisional 94.72
PRK08265 261 short chain dehydrogenase; Provisional 94.7
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.7
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 94.68
PRK07067 257 sorbitol dehydrogenase; Provisional 94.68
PRK06057 255 short chain dehydrogenase; Provisional 94.66
PRK06523 260 short chain dehydrogenase; Provisional 94.66
PRK07523 255 gluconate 5-dehydrogenase; Provisional 94.65
KOG0685|consensus 498 94.62
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 94.62
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 94.62
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 94.61
PRK13529 563 malate dehydrogenase; Provisional 94.56
PRK06567 1028 putative bifunctional glutamate synthase subunit b 94.56
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 94.54
PLN02985 514 squalene monooxygenase 94.54
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 94.52
PLN02256 304 arogenate dehydrogenase 94.5
PRK06996 398 hypothetical protein; Provisional 94.49
PLN02253 280 xanthoxin dehydrogenase 94.47
PTZ00317 559 NADP-dependent malic enzyme; Provisional 94.46
PLN02494 477 adenosylhomocysteinase 94.45
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 94.43
PRK08507 275 prephenate dehydrogenase; Validated 94.41
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 94.41
TIGR00292 254 thiazole biosynthesis enzyme. This enzyme is invol 94.41
PRK12828 239 short chain dehydrogenase; Provisional 94.41
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 94.4
PRK05442 326 malate dehydrogenase; Provisional 94.4
PF01946 230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 94.39
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 94.38
PLN02463 447 lycopene beta cyclase 94.37
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 94.36
PRK06436 303 glycerate dehydrogenase; Provisional 94.34
PTZ00075 476 Adenosylhomocysteinase; Provisional 94.33
PRK09496 453 trkA potassium transporter peripheral membrane com 94.33
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.33
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 94.32
PRK07774 250 short chain dehydrogenase; Provisional 94.31
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.3
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 94.29
PRK09564 444 coenzyme A disulfide reductase; Reviewed 94.29
PRK05875 276 short chain dehydrogenase; Provisional 94.29
PRK07680 273 late competence protein ComER; Validated 94.29
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 94.28
PRK05257 494 malate:quinone oxidoreductase; Validated 94.27
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 94.27
PRK07856 252 short chain dehydrogenase; Provisional 94.26
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 94.25
PRK08703 239 short chain dehydrogenase; Provisional 94.25
PRK07035 252 short chain dehydrogenase; Provisional 94.25
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 94.22
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 94.22
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 94.21
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.21
PRK06487 317 glycerate dehydrogenase; Provisional 94.21
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 94.2
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 94.18
PRK08226 263 short chain dehydrogenase; Provisional 94.18
PRK07574 385 formate dehydrogenase; Provisional 94.18
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 94.18
PRK07060 245 short chain dehydrogenase; Provisional 94.17
PRK07478 254 short chain dehydrogenase; Provisional 94.17
PRK07063 260 short chain dehydrogenase; Provisional 94.16
PRK06949 258 short chain dehydrogenase; Provisional 94.16
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 94.16
PF07992 201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 94.15
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 94.15
PRK05866 293 short chain dehydrogenase; Provisional 94.14
KOG4169|consensus 261 94.11
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 94.11
PRK10015 429 oxidoreductase; Provisional 94.11
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 94.1
PRK08277 278 D-mannonate oxidoreductase; Provisional 94.1
PRK12770 352 putative glutamate synthase subunit beta; Provisio 94.1
PRK08589 272 short chain dehydrogenase; Validated 94.1
PRK09496 453 trkA potassium transporter peripheral membrane com 94.09
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.09
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 94.08
PRK07831 262 short chain dehydrogenase; Provisional 94.08
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 94.08
PRK12746 254 short chain dehydrogenase; Provisional 94.07
PLN03139 386 formate dehydrogenase; Provisional 94.06
PRK06500 249 short chain dehydrogenase; Provisional 94.06
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 94.06
PRK06124 256 gluconate 5-dehydrogenase; Provisional 94.05
PRK05717 255 oxidoreductase; Validated 94.05
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 94.01
PRK03562 621 glutathione-regulated potassium-efflux system prot 94.0
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 93.98
PRK06172 253 short chain dehydrogenase; Provisional 93.97
PRK12814 652 putative NADPH-dependent glutamate synthase small 93.97
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 93.96
PRK04148134 hypothetical protein; Provisional 93.95
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 93.95
PRK06196 315 oxidoreductase; Provisional 93.95
PTZ00431 260 pyrroline carboxylate reductase; Provisional 93.94
PRK06398 258 aldose dehydrogenase; Validated 93.92
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 93.92
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 93.91
PRK12770 352 putative glutamate synthase subunit beta; Provisio 93.91
PRK06197 306 short chain dehydrogenase; Provisional 93.9
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 93.87
PRK09072 263 short chain dehydrogenase; Provisional 93.87
PRK05876 275 short chain dehydrogenase; Provisional 93.85
PRK07890 258 short chain dehydrogenase; Provisional 93.85
PRK06545 359 prephenate dehydrogenase; Validated 93.83
PRK07814 263 short chain dehydrogenase; Provisional 93.82
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 93.78
PRK08628 258 short chain dehydrogenase; Provisional 93.78
PRK06138 252 short chain dehydrogenase; Provisional 93.78
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 93.78
PRK03659 601 glutathione-regulated potassium-efflux system prot 93.76
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 93.75
PRK12779 944 putative bifunctional glutamate synthase subunit b 93.75
PTZ00367 567 squalene epoxidase; Provisional 93.75
PRK07024 257 short chain dehydrogenase; Provisional 93.73
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 93.73
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 93.72
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 93.72
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.72
PRK10537393 voltage-gated potassium channel; Provisional 93.68
PRK08339 263 short chain dehydrogenase; Provisional 93.67
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 93.67
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 93.64
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.64
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.63
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 93.63
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 93.63
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 93.62
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 93.61
PLN02477 410 glutamate dehydrogenase 93.59
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.57
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 93.57
PRK06932 314 glycerate dehydrogenase; Provisional 93.57
PRK08085 254 gluconate 5-dehydrogenase; Provisional 93.55
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 93.52
PRK08017 256 oxidoreductase; Provisional 93.51
PRK12831 464 putative oxidoreductase; Provisional 93.51
PRK06114 254 short chain dehydrogenase; Provisional 93.51
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 93.5
PRK12939 250 short chain dehydrogenase; Provisional 93.48
PRK06125 259 short chain dehydrogenase; Provisional 93.48
PLN02572 442 UDP-sulfoquinovose synthase 93.48
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.48
PTZ00383 497 malate:quinone oxidoreductase; Provisional 93.45
PRK06940 275 short chain dehydrogenase; Provisional 93.45
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.44
PRK09242 257 tropinone reductase; Provisional 93.42
PRK08278 273 short chain dehydrogenase; Provisional 93.42
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.42
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 93.4
PRK08605 332 D-lactate dehydrogenase; Validated 93.39
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 93.38
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 93.38
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 93.38
PRK07233 434 hypothetical protein; Provisional 93.37
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 93.33
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 93.33
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 93.32
PLN02852 491 ferredoxin-NADP+ reductase 93.32
PRK12827 249 short chain dehydrogenase; Provisional 93.31
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.3
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 93.3
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 93.28
PRK06924 251 short chain dehydrogenase; Provisional 93.28
PRK07825 273 short chain dehydrogenase; Provisional 93.28
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.26
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 93.25
PRK05867 253 short chain dehydrogenase; Provisional 93.25
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.24
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 93.23
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.22
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 93.2
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 93.2
PRK05872 296 short chain dehydrogenase; Provisional 93.18
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 93.18
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 93.18
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.16
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 93.16
PRK08177 225 short chain dehydrogenase; Provisional 93.16
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 93.15
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 93.15
PLN02688 266 pyrroline-5-carboxylate reductase 93.14
PRK11883 451 protoporphyrinogen oxidase; Reviewed 93.13
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 93.12
PLN02240 352 UDP-glucose 4-epimerase 93.11
PRK07453 322 protochlorophyllide oxidoreductase; Validated 93.11
PRK07791 286 short chain dehydrogenase; Provisional 93.1
PLN02697 529 lycopene epsilon cyclase 93.09
PRK09186 256 flagellin modification protein A; Provisional 93.09
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.09
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 93.07
PRK07326 237 short chain dehydrogenase; Provisional 93.07
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 93.06
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 93.05
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 93.05
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 93.04
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 93.03
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 93.01
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 92.98
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 92.96
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 92.94
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 92.93
PRK08251 248 short chain dehydrogenase; Provisional 92.89
PRK14694 468 putative mercuric reductase; Provisional 92.86
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 92.86
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.85
PRK06701 290 short chain dehydrogenase; Provisional 92.84
PRK08643 256 acetoin reductase; Validated 92.83
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.82
PRK15059 292 tartronate semialdehyde reductase; Provisional 92.81
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.8
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 92.8
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 92.8
PRK09897 534 hypothetical protein; Provisional 92.79
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.78
PRK11445 351 putative oxidoreductase; Provisional 92.78
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 92.77
PRK13512 438 coenzyme A disulfide reductase; Provisional 92.75
PRK06720169 hypothetical protein; Provisional 92.74
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 92.71
PRK07677 252 short chain dehydrogenase; Provisional 92.71
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 92.71
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 92.71
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 92.69
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 92.68
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 92.68
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 92.67
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 92.67
PRK10262 321 thioredoxin reductase; Provisional 92.66
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.64
PRK12742 237 oxidoreductase; Provisional 92.63
PRK06370 463 mercuric reductase; Validated 92.62
PLN02712 667 arogenate dehydrogenase 92.58
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 92.57
PRK07102 243 short chain dehydrogenase; Provisional 92.56
PRK06128 300 oxidoreductase; Provisional 92.54
PRK07097 265 gluconate 5-dehydrogenase; Provisional 92.53
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 92.52
PRK07577 234 short chain dehydrogenase; Provisional 92.51
PRK07062 265 short chain dehydrogenase; Provisional 92.5
PRK11730 715 fadB multifunctional fatty acid oxidation complex 92.5
PRK05854 313 short chain dehydrogenase; Provisional 92.5
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 92.49
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 92.48
TIGR03570 201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 92.47
PRK12938 246 acetyacetyl-CoA reductase; Provisional 92.47
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.46
PRK14031 444 glutamate dehydrogenase; Provisional 92.46
PRK05993 277 short chain dehydrogenase; Provisional 92.46
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 92.45
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.42
PRK07208 479 hypothetical protein; Provisional 92.41
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 92.4
KOG0069|consensus 336 92.38
PLN02306 386 hydroxypyruvate reductase 92.36
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
Probab=99.92  E-value=8e-26  Score=154.41  Aligned_cols=74  Identities=51%  Similarity=0.773  Sum_probs=71.4

Q ss_pred             CCcHHHHHHhhcCcEEEEcCChhHHHHHHHHHHhCCCcEEEEeCCccccccCCCCcccccCCccCchhhhcccCC
Q psy9593           9 SSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGLKPPTSR   83 (84)
Q Consensus         9 ~~~~~~q~~l~~~~vlivG~gg~G~eiak~L~l~Gv~~i~l~D~d~v~~~nl~~~~~~~~~~diGk~ka~~~~~r   83 (84)
                      .++.++|++|++++|+|+|+||+|+|++|||+++||++|+++|+|.|+++|+ +||||++++|+|++|+++++++
T Consensus        10 l~G~e~Q~~L~~s~VlIiG~gglG~evak~La~~GVg~i~lvD~d~ve~snL-~rqfl~~~~diG~~Ka~a~~~~   83 (197)
T cd01492          10 LWGLEAQKRLRSARILLIGLKGLGAEIAKNLVLSGIGSLTILDDRTVTEEDL-GAQFLIPAEDLGQNRAEASLER   83 (197)
T ss_pred             HhCHHHHHHHHhCcEEEEcCCHHHHHHHHHHHHcCCCEEEEEECCcccHhhC-CCCccccHHHcCchHHHHHHHH
Confidence            4889999999999999999999999999999999999999999999999999 9999999999999999998764



Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain.

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>KOG2015|consensus Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2013|consensus Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2014|consensus Back     alignment and domain information
>KOG2017|consensus Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>KOG2012|consensus Back     alignment and domain information
>KOG2012|consensus Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>KOG2016|consensus Back     alignment and domain information
>KOG2336|consensus Back     alignment and domain information
>KOG2337|consensus Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
1y8q_A 346 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 4e-12
3cmm_A 1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 2e-07
4ii2_A 1001 Crystal Structure Of Ubiquitin Activating Enzyme 1 3e-07
1tt5_B 434 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 5e-05
1r4m_B 431 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 5e-05
3dbl_B 434 Structural Dissection Of A Gating Mechanism Prevent 5e-05
3dbh_B 434 Structural Dissection Of A Gating Mechanism Prevent 6e-05
3dbr_B 434 Structural Dissection Of A Gating Mechanism Prevent 6e-05
1yov_B 444 Insights Into The Ubiquitin Transfer Cascade From T 6e-05
2nvu_B 805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 7e-05
3gzn_B 463 Structure Of Nedd8-Activating Enzyme In Complex Wit 7e-05
2nvu_A 536 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 5e-04
3gzn_A 534 Structure Of Nedd8-Activating Enzyme In Complex Wit 5e-04
1yov_A 537 Insights Into The Ubiquitin Transfer Cascade From T 5e-04
1tt5_A 531 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 5e-04
1r4m_A 529 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 5e-04
>pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 4e-12, Method: Composition-based stats. Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 1/64 (1%) Query: 12 LPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHED 71 L Q RLRA+++LL+G++G+GAEIAKN+IL+GVK + +LD VT ED AQFL Sbjct: 28 LEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPG-AQFLIRTGS 86 Query: 72 IGKN 75 +G+N Sbjct: 87 VGRN 90
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 Back     alignment and structure
>pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 Back     alignment and structure
>pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 Back     alignment and structure
>pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 Back     alignment and structure
>pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 Back     alignment and structure
>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure
>pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 Back     alignment and structure
>pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 Back     alignment and structure
>pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 Back     alignment and structure
>pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 Back     alignment and structure
>pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 Back     alignment and structure
>pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 9e-23
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 1e-22
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 1e-22
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 1e-14
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 7e-10
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 1e-09
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 4e-07
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 6e-06
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 9e-04
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
 Score = 87.9 bits (218), Expect = 9e-23
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 1/61 (1%)

Query: 15 QSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGK 74
          Q RLRA+++LL+G++G+GAEIAKN+IL+GVK + +LD   VT ED   AQFL     +G+
Sbjct: 31 QKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPG-AQFLIRTGSVGR 89

Query: 75 N 75
          N
Sbjct: 90 N 90


>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 99.9
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 99.9
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 99.9
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 99.88
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 99.88
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 99.88
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 99.86
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 99.86
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.86
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 99.85
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.85
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 99.85
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 99.85
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 99.83
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.51
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.47
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.34
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.3
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.29
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.26
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.16
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.15
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.14
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.14
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.11
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.1
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.07
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.07
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.07
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.07
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.05
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.02
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.0
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.98
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.98
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.97
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 96.92
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.88
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.85
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.84
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 96.84
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 96.77
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.77
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.69
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.66
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.66
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.64
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 96.64
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 96.6
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.6
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 96.58
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.56
2ywl_A 180 Thioredoxin reductase related protein; uncharacter 96.54
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.53
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 96.52
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.5
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.49
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 96.49
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 96.48
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 96.47
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 96.47
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 96.47
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 96.46
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.45
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.44
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.44
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 96.43
2cul_A 232 Glucose-inhibited division protein A-related PROT 96.42
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 96.42
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.41
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.4
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 96.4
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.37
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 96.37
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.37
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 96.36
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.35
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.35
3tl2_A 315 Malate dehydrogenase; center for structural genomi 96.34
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.34
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 96.34
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 96.34
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 96.34
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.32
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 96.32
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.31
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.31
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.3
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 96.29
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 96.29
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.27
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 96.26
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.26
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.25
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 96.25
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 96.24
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 96.22
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.22
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.22
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 96.19
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.19
3dme_A 369 Conserved exported protein; structural genomics, P 96.19
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.18
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 96.16
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 96.15
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 96.15
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.14
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.13
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.13
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.12
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.12
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 96.1
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.1
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.09
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 96.07
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 96.05
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 96.05
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.04
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 96.03
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.01
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.01
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 95.99
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 95.99
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 95.98
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.98
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 95.97
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 95.95
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 95.94
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.92
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 95.91
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 95.91
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 95.91
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.9
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.9
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.89
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 95.89
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.86
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 95.86
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 95.86
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 95.85
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 95.85
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 95.84
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 95.82
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.81
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.81
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.8
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.8
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 95.79
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 95.79
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 95.76
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 95.75
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.74
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 95.73
4g65_A 461 TRK system potassium uptake protein TRKA; structur 95.72
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.72
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 95.72
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 95.71
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.7
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 95.7
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 95.69
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 95.69
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.68
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 95.68
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 95.68
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 95.67
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 95.66
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.66
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.65
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 95.65
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 95.64
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 95.64
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.62
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 95.61
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 95.61
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 95.6
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.59
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 95.59
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 95.58
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 95.58
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.57
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 95.57
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.56
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 95.56
3atr_A 453 Conserved archaeal protein; saturating double bond 95.56
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.55
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 95.55
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.54
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 95.54
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 95.54
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 95.54
3r9u_A 315 Thioredoxin reductase; structural genomics, center 95.54
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.54
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 95.53
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.52
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 95.52
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 95.51
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.51
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.5
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.48
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 95.48
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 95.47
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 95.47
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 95.47
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 95.47
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.46
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 95.44
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 95.43
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.43
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 95.43
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 95.42
4ezb_A 317 Uncharacterized conserved protein; structural geno 95.42
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 95.41
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 95.41
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 95.41
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 95.4
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 95.4
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 95.4
3qha_A 296 Putative oxidoreductase; seattle structural genomi 95.4
2bry_A 497 NEDD9 interacting protein with calponin homology a 95.39
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 95.39
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 95.39
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 95.39
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 95.39
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 95.38
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 95.37
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 95.36
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 95.36
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 95.35
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 95.34
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 95.34
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 95.33
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.32
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 95.32
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.32
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.31
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.31
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 95.31
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.31
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.27
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 95.26
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.26
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.26
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.26
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 95.25
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 95.24
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 95.24
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 95.23
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 95.23
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.22
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.22
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 95.21
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 95.19
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 95.19
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 95.18
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 95.17
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 95.17
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 95.17
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 95.17
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.16
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.15
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 95.15
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 95.15
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.15
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 95.15
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 95.14
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 95.14
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 95.14
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.14
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 95.13
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 95.13
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.13
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 95.13
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 95.12
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 95.12
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.1
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 95.1
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 95.09
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 95.09
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 95.09
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 95.09
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 95.08
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.08
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 95.06
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 95.05
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 95.05
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.05
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 95.03
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 95.03
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 95.02
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 95.01
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 95.01
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 95.01
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 95.01
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.01
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.0
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 94.99
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 94.99
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 94.99
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 94.99
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 94.99
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 94.98
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 94.98
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 94.97
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 94.97
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 94.95
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 94.95
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 94.94
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 94.94
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.93
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 94.93
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 94.93
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 94.93
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.92
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 94.91
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 94.9
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.9
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.88
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 94.88
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 94.87
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.87
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 94.86
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 94.86
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 94.85
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 94.85
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.85
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 94.84
4ea9_A 220 Perosamine N-acetyltransferase; beta helix, acetyl 94.84
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 94.84
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 94.83
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 94.82
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 94.82
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 94.82
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 94.82
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 94.81
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.81
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 94.8
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 94.8
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 94.78
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 94.78
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 94.77
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 94.77
3imf_A 257 Short chain dehydrogenase; structural genomics, in 94.76
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 94.76
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 94.74
4fk1_A 304 Putative thioredoxin reductase; structural genomic 94.74
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 94.74
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 94.73
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 94.73
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 94.73
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 94.72
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 94.72
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 94.71
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 94.71
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.71
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 94.71
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.71
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 94.71
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 94.7
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 94.69
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.68
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 94.68
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 94.68
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 94.67
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 94.67
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 94.67
4dqx_A 277 Probable oxidoreductase protein; structural genomi 94.67
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 94.66
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 94.66
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 94.65
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 94.65
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 94.65
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 94.65
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.65
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 94.64
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 94.64
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 94.64
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 94.64
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 94.63
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 94.63
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 94.63
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 94.63
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 94.63
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 94.63
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 94.62
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 94.61
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 94.61
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 94.6
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 94.6
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 94.59
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 94.59
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 94.59
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 94.59
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 94.59
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.58
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 94.57
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 94.57
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 94.56
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 94.56
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.56
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 94.55
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 94.55
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 94.55
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 94.54
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 93.56
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 94.54
3rih_A 293 Short chain dehydrogenase or reductase; structural 94.53
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 94.53
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 94.53
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 94.52
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.52
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.51
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.51
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 94.51
1spx_A 278 Short-chain reductase family member (5L265); paral 94.5
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 94.49
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 94.49
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 94.49
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 94.49
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 94.48
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 94.48
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 94.48
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 94.48
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 94.47
2duw_A145 Putative COA-binding protein; ligand binding prote 94.47
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 94.47
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 94.47
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 94.47
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 94.46
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 94.46
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 94.45
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 94.45
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.45
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 94.45
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 94.44
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 94.44
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 94.44
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 94.43
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 94.43
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 94.42
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.42
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 94.41
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 94.41
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 94.4
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 94.4
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 94.4
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 94.39
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 94.39
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 94.38
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.37
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 94.37
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 94.37
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 94.36
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 94.34
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 94.33
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 94.33
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 94.33
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 94.32
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 94.31
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 94.31
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 94.31
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 94.3
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 94.3
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 94.3
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 94.29
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 94.29
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 94.29
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 94.28
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 94.28
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 94.28
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 94.28
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 94.27
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 94.26
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 94.26
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 94.25
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 94.25
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 94.25
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.24
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 94.24
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 94.23
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 94.23
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 94.22
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 94.22
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 94.21
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 94.2
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 94.2
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 94.2
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 94.2
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 94.19
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 94.18
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 94.18
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 94.18
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.16
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.15
1xkq_A 280 Short-chain reductase family member (5D234); parra 94.15
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 94.14
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 94.14
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 94.12
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 94.11
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 94.1
1xq1_A 266 Putative tropinone reducatse; structural genomics, 94.1
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
Probab=99.90  E-value=1.7e-24  Score=156.75  Aligned_cols=73  Identities=48%  Similarity=0.705  Sum_probs=70.5

Q ss_pred             CcHHHHHHhhcCcEEEEcCChhHHHHHHHHHHhCCCcEEEEeCCccccccCCCCcccccCCccCchhhhcccCC
Q psy9593          10 SILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGLKPPTSR   83 (84)
Q Consensus        10 ~~~~~q~~l~~~~vlivG~gg~G~eiak~L~l~Gv~~i~l~D~d~v~~~nl~~~~~~~~~~diGk~ka~~~~~r   83 (84)
                      ++.++|++|++++|+|+|+||+|+++++||+++||++|+|+|+|.|+++|| +||||++++|+|++||++++++
T Consensus        26 ~G~~~q~~L~~~~VlivG~GGlG~~ia~~La~~Gvg~itlvD~d~V~~sNL-~rq~~~~~~diG~~Ka~~~~~~   98 (346)
T 1y8q_A           26 WGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDP-GAQFLIRTGSVGRNRAEASLER   98 (346)
T ss_dssp             HCHHHHHHHHTCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBCCSSCG-GGCTTSCSSCTTSBHHHHHHHH
T ss_pred             hCHHHHHHHhCCeEEEECCCHHHHHHHHHHHHcCCCEEEEEECCCcchhhC-CCCCccccccCcCCHHHHHHHH
Confidence            578999999999999999999999999999999999999999999999999 9999999999999999998764



>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1yova1 529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 3e-17
d1yovb1 426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 1e-15
d1jw9b_ 247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 1e-10
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.3 bits (177), Expect = 3e-17
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 15 QSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGK 74
          Q  L +  + LI     G EI KN++L G+ S  ++D   V+ ED     F      IGK
Sbjct: 20 QEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAG-NNFFLQRSSIGK 78

Query: 75 N 75
          N
Sbjct: 79 N 79


>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 99.94
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 99.88
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 97.78
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.76
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.59
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.56
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.56
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.55
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.52
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.49
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.46
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.42
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.37
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.34
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.32
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.32
d1ks9a2 167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.28
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.28
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.28
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.27
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.26
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.24
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.21
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.21
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.15
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.15
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.15
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.14
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.14
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.13
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.13
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.09
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.09
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.09
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.05
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.04
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.03
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 97.03
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.03
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.01
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.99
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.98
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.98
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.97
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.97
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 96.94
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.93
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.87
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.87
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.85
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.78
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.78
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.78
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.76
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.75
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.73
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.71
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.7
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.68
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.68
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.67
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.67
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.66
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.65
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.61
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.61
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.58
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.56
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.55
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.55
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.49
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.48
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.46
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.44
d1pgja2 178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.44
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.43
d1d7ya1 183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.43
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.41
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.4
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.38
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.37
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.36
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 96.36
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.36
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.34
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.33
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.32
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.31
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.3
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.29
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.28
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.28
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.25
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.23
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 96.21
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.2
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.15
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.15
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.11
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.1
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 96.1
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.04
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 96.04
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.02
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.02
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.98
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 95.98
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.97
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 95.96
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.93
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.9
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 95.9
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.89
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 95.87
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 95.86
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 95.84
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 95.82
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 95.8
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.78
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 95.77
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.76
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.75
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.73
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 95.71
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.69
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.69
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.68
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 95.68
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 95.67
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.67
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 95.66
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 95.65
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.65
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.65
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 95.61
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 95.59
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 95.57
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.57
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 95.56
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 95.56
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 95.55
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 95.54
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 95.52
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.52
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.51
d1aoga1 238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 95.46
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 95.45
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.45
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.44
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 95.44
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 95.44
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.42
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.35
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.35
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.34
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.31
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 95.31
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.3
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.3
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 95.3
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 95.3
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.26
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.22
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.2
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.15
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 95.11
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 95.08
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 95.07
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 95.05
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.04
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 95.04
d1fl2a1 184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.02
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 94.99
d1xdia1 233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 94.99
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 94.98
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 94.97
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.96
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 94.95
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 94.92
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.91
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.89
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 94.87
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.81
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 94.81
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 94.8
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.78
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 94.77
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 94.73
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.71
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 94.66
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.66
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.62
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 94.62
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 94.59
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 94.55
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 94.53
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.52
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 94.47
d1txga2 180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.41
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 94.41
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 94.37
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.31
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 94.3
d1feca1 240 Trypanothione reductase {Crithidia fasciculata [Ta 94.3
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 94.29
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 94.29
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 94.29
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.27
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 94.27
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 94.27
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 94.23
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 94.17
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 94.1
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.1
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 94.09
d1m6ia1 213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.08
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.01
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 93.97
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.92
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 93.91
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 93.91
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 93.91
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.88
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 93.85
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 93.85
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 93.81
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.81
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 93.79
d2vapa1 209 Cell-division protein FtsZ {Archaeon Methanococcus 93.77
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.75
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 93.74
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 93.51
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 93.46
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 93.45
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.44
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.43
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 93.39
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.39
d2cula1 230 GidA-related protein TTHA1897 {Thermus thermophilu 93.38
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 93.35
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.33
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 93.22
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 93.2
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.17
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.07
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 93.0
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 92.97
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.96
d3bswa1 193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 92.94
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 92.93
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.75
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.74
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 92.67
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.64
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 92.59
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 92.57
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.56
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 92.56
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 92.54
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 92.51
d1ofua1 198 Cell-division protein FtsZ {Pseudomonas aeruginosa 92.45
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 92.44
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 92.42
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 92.4
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 92.27
d1w5fa1 194 Cell-division protein FtsZ {Thermotoga maritima [T 92.19
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 92.07
d1np3a2 182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 92.03
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 91.98
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 91.95
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.65
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 91.63
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 91.47
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 91.38
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.37
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.31
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 91.29
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 91.08
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 91.03
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 91.03
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.91
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 90.33
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 90.28
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 90.14
d1xeaa1 167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 90.07
d1rq2a1 198 Cell-division protein FtsZ {Mycobacterium tubercul 90.03
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 89.87
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.8
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.59
d1f06a1 170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 89.51
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 89.35
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 89.23
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 88.56
d1ydwa1 184 Probable oxidoreductase At4g09670 {Thale cress (Ar 88.21
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 87.67
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 87.66
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 87.45
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 87.42
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 87.12
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 86.92
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 86.89
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 86.15
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 86.05
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 85.85
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 85.41
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 84.99
d1zh8a1 181 Hypothetical protein TM0312 {Thermotoga maritima [ 84.56
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 84.39
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.24
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 84.21
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 84.12
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 83.72
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 83.53
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 83.46
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 83.33
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 82.86
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 82.76
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.26
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 80.34
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 80.05
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Molybdenum cofactor biosynthesis protein MoeB
domain: Molybdenum cofactor biosynthesis protein MoeB
species: Escherichia coli [TaxId: 562]
Probab=99.94  E-value=4.9e-28  Score=165.09  Aligned_cols=77  Identities=21%  Similarity=0.385  Sum_probs=73.9

Q ss_pred             ccCCCcHHHHHHhhcCcEEEEcCChhHHHHHHHHHHhCCCcEEEEeCCccccccCCCCcccccCCccCchhhhcccCC
Q psy9593           6 ITSSSILPYQSRLRATKILLIGVEGVGAEIAKNIILSGVKSVCLLDSGVVTKEDVNTAQFLAPHEDIGKNGLKPPTSR   83 (84)
Q Consensus         6 ~~~~~~~~~q~~l~~~~vlivG~gg~G~eiak~L~l~Gv~~i~l~D~d~v~~~nl~~~~~~~~~~diGk~ka~~~~~r   83 (84)
                      .+++.+.++|+||++++|+|+|+||+|++++++|+++||++|+|+|+|.|+++|| +||++|+++|+|++|+++++++
T Consensus        16 ~l~~~g~~~Q~kL~~~~VliiG~GglGs~va~~La~~Gvg~i~lvD~D~Ve~sNL-~RQ~l~~~~diG~~K~~~a~~~   92 (247)
T d1jw9b_          16 ILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNL-QRQTLHSDATVGQPKVESARDA   92 (247)
T ss_dssp             TSTTTHHHHHHHHHHCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBCCGGGG-GTCTTCCGGGTTSBHHHHHHHH
T ss_pred             ccccCCHHHHHHHhCCCEEEECCCHHHHHHHHHHHHcCCCeEEEECCcccchhhh-hhhccccHhhcCchHHHHHHHH
Confidence            4688899999999999999999999999999999999999999999999999999 9999999999999999998764



>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure