Psyllid ID: psy9606


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MYLKKDQKKGSSTQSYRNSLNRQEDNQHSSSNQLSETQLQQHHQAVLEDLRRDDRHRQDRQSNEQQIIPKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPKNAKRELSGGESPGYAFGGATRRAKWCATRAASTIASTVDRVPCPCDATTFTRANDARRTPNVGNVEHSHHHSHHHHDSGDNKSLSSGDESSSISLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAEHSHHHSHHHHDSGDNKSLSSGDESSSISLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAGELAR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccEEccccccccccEEcccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccEEEEEcccccccccccccccccccHHHcc
mylkkdqkkgsstqSYRNSlnrqednqhsssnqlSETQLQQHHQAVLEDLrrddrhrqdrqsneqqiipkradltctncntkvttiwrrypsgemvcnacglyyrlhcrprpvsmrrdnihprkrrpknakrelsggespgyafggaTRRAKWCATRAAstiastvdrvpcpcdattftrandarrtpnvgnvehshhhshhhhdsgdnkslssgdesssisLHSFISaslhhapfnvgapggnsppshyalnlsplcednlplnlaagppaehshhhshhhhdsgdnkslssgdesssisLHSFISaslhhapfnvgapggnsppshyalnlsplcednlplnlaagppagelar
mylkkdqkkgsstqsyrnslnrqeDNQHSSSNQLSETQLQQHHQAVLEDLRRDDRhrqdrqsneqqiipkradltctncntkvttiwrrypsgeMVCNACGLYYRlhcrprpvsmrrdnihprkrrpknakrelsggespgyafggATRRAKWCATRAAstiastvdrvpcpcdattftrandarrtPNVGNVEHSHHHSHHHHDSGDNKSLSSGDESSSISLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAEHSHHHSHHHHDSGDNKSLSSGDESSSISLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAGELAR
MYLKKDQKKGSSTQSYRNSLNRQEDNQHSSSNQLSETQLQQHHQAVLEdlrrddrhrqdrqSNEQQIIPKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPKNAKRELSGGESPGYAFGGATRRAKWCATRAASTIASTVDRVPCPCDATTFTRANDARRTPNVGNVEhshhhshhhhDSGDNKslssgdesssislhsfisaslhhaPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAEhshhhshhhhDSGDNKslssgdesssislhsfisaslhhaPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAGELAR
*********************************************************************KRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCR********************************YAFGGATRRAKWCATRAASTIASTVDRVPCPCDATTFT*********************************************************************************************************************************************************************************
****************************************************************************TNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRP************************************************************************************************************************************************************************************************HSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGP*******
********************************************AVLEDLRR************QQIIPKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHP**************GESPGYAFGGATRRAKWCATRAASTIASTVDRVPCPCDATTFTRANDARRTPNVGN*****************************SLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAG*******************************SLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAGELAR
***************YR*SLNRQEDNQHSSSNQLSETQLQQHHQAVLEDLRRDDRHRQDRQSNEQQIIPKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVS*RR******************************************************************************************************************************************PLCEDNLPLNLAAG***********************************************V**PGGNSPPSHYALNLSPLCEDNLPLNLAAGP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLKKDQKKGSSTQSYRNSLNRQEDNQHSSSNQLSETQLQQHHQAVLEDLRRDDRHRQDRQSNEQQIIPKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPKNAKRELSGGESPGYAFGGATRRAKWCATRAASTIASTVDRVPCPCDATTFTRANDARRTPNVGNVEHSHHHSHHHHDSGDNKSLSSGDESSSISLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAEHSHHHSHHHHDSGDNKSLSSGDESSSISLHSFISASLHHAPFNVGAPGGNSPPSHYALNLSPLCEDNLPLNLAAGPPAGELAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
P52172 1264 Box A-binding factor OS=D yes N/A 0.165 0.046 0.627 6e-19
P46152440 Transcription factor GATA yes N/A 0.185 0.15 0.513 6e-17
P43695390 GATA-binding factor 5-A O N/A N/A 0.196 0.179 0.563 7e-17
Q0Q0E4442 Transcription factor GATA yes N/A 0.193 0.156 0.527 8e-17
P43696388 GATA-binding factor 5-B O N/A N/A 0.196 0.180 0.563 9e-17
P52168540 GATA-binding factor A OS= no N/A 0.148 0.098 0.610 9e-17
P43694442 Transcription factor GATA yes N/A 0.160 0.128 0.555 1e-16
Q08369440 Transcription factor GATA yes N/A 0.160 0.129 0.555 2e-16
Q92908595 Transcription factor GATA no N/A 0.191 0.114 0.514 3e-16
P43691380 Transcription factor GATA yes N/A 0.176 0.165 0.555 3e-16
>sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 70  KRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPK 128
           KRA L+C+NC+T  T++WRR P+GE VCNACGLYY+LH  PRP++M++D I  RKR+PK
Sbjct: 797 KRAGLSCSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPLTMKKDTIQKRKRKPK 855




May function as a transcriptional activator protein and may play a key role in the organogenesis of the fat body. Binds a sequence element (5'-[TA]GATAA-3') found in the larval promoters of all known alcohol dehydrogenase (ADH) genes. Acts as a homeotic gene downstream of the terminal gap gene HKB to promote morphogenesis and differentiation of anterior and posterior midgut.
Drosophila melanogaster (taxid: 7227)
>sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 Back     alignment and function description
>sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 Back     alignment and function description
>sp|Q0Q0E4|GATA4_CANFA Transcription factor GATA-4 OS=Canis familiaris GN=GATA4 PE=2 SV=1 Back     alignment and function description
>sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 Back     alignment and function description
>sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 Back     alignment and function description
>sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 Back     alignment and function description
>sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=3 Back     alignment and function description
>sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 Back     alignment and function description
>sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
307172112 595 GATA-binding factor A [Camponotus florid 0.219 0.131 0.592 5e-21
332023110 595 GATA-binding factor A [Acromyrmex echina 0.219 0.131 0.580 1e-20
380022377 588 PREDICTED: uncharacterized protein LOC10 0.179 0.108 0.671 3e-19
328785124 588 PREDICTED: hypothetical protein LOC72442 0.179 0.108 0.671 3e-19
322789591 547 hypothetical protein SINV_01115 [Solenop 0.179 0.117 0.656 3e-19
383865617 586 PREDICTED: uncharacterized protein LOC10 0.339 0.206 0.406 5e-19
345486907 647 PREDICTED: hypothetical protein LOC10067 0.174 0.095 0.677 5e-19
350398203 588 PREDICTED: hypothetical protein LOC10074 0.179 0.108 0.656 8e-19
340724648 588 PREDICTED: hypothetical protein LOC10064 0.179 0.108 0.656 8e-19
307197634 594 GATA-binding factor A [Harpegnathos salt 0.219 0.131 0.560 9e-19
>gi|307172112|gb|EFN63680.1| GATA-binding factor A [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  108 bits (269), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (71%), Gaps = 3/81 (3%)

Query: 51  RRDDRHRQDRQSNEQQIIPKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRP 110
           + DD+ + D+QS     I K+ D++CTNC T  TTIWRR   GEMVCNACGLYY+LH   
Sbjct: 402 KMDDQKQFDQQSGN---IAKKVDMSCTNCGTMTTTIWRRNMKGEMVCNACGLYYKLHGVN 458

Query: 111 RPVSMRRDNIHPRKRRPKNAK 131
           RPV+MRRD IH R+RRPK  K
Sbjct: 459 RPVTMRRDTIHTRRRRPKGEK 479




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332023110|gb|EGI63371.1| GATA-binding factor A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380022377|ref|XP_003695026.1| PREDICTED: uncharacterized protein LOC100864759 [Apis florea] Back     alignment and taxonomy information
>gi|328785124|ref|XP_001120276.2| PREDICTED: hypothetical protein LOC724420 [Apis mellifera] Back     alignment and taxonomy information
>gi|322789591|gb|EFZ14817.1| hypothetical protein SINV_01115 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383865617|ref|XP_003708269.1| PREDICTED: uncharacterized protein LOC100877935 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345486907|ref|XP_003425585.1| PREDICTED: hypothetical protein LOC100678172 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350398203|ref|XP_003485118.1| PREDICTED: hypothetical protein LOC100747914 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724648|ref|XP_003400693.1| PREDICTED: hypothetical protein LOC100646437 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307197634|gb|EFN78813.1| GATA-binding factor A [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
UNIPROTKB|Q3SZJ5403 GATA5 "Transcription factor GA 0.196 0.173 0.577 8.8e-21
FB|FBgn0003507 1264 srp "serpent" [Drosophila mela 0.196 0.055 0.585 1.2e-20
UNIPROTKB|B3KUF4236 GATA4 "cDNA FLJ39741 fis, clon 0.25 0.377 0.458 3.6e-20
UNIPROTKB|F1RIZ4424 GATA5 "Uncharacterized protein 0.196 0.165 0.563 6.3e-20
UNIPROTKB|Q0Q0E4442 GATA4 "Transcription factor GA 0.258 0.208 0.437 3.3e-19
ZFIN|ZDB-GENE-980526-340383 gata5 "GATA-binding protein 5" 0.323 0.300 0.420 5.1e-19
UNIPROTKB|I3LUZ9442 GATA4 "Uncharacterized protein 0.196 0.158 0.549 5.5e-19
UNIPROTKB|P43694442 GATA4 "Transcription factor GA 0.25 0.201 0.458 7.1e-19
UNIPROTKB|B7ZKZ4443 GATA4 "Transcription factor GA 0.25 0.200 0.458 7.2e-19
FB|FBgn0032223842 GATAd "GATAd" [Drosophila mela 0.182 0.077 0.621 2e-18
UNIPROTKB|Q3SZJ5 GATA5 "Transcription factor GATA-5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 8.8e-21, Sum P(2) = 8.8e-21
 Identities = 41/71 (57%), Positives = 53/71 (74%)

Query:    70 KRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPKN 129
             +RA L CTNC+T  TT+WRR   GE VCNACGLY +LH  PRP++M++++I  RKR+PKN
Sbjct:   242 RRAGLCCTNCHTTTTTLWRRNVDGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKN 301

Query:   130 -AKRELSGGES 139
              AK + S G S
Sbjct:   302 IAKTKGSSGSS 312


GO:0005634 "nucleus" evidence=IEA
GO:0071773 "cellular response to BMP stimulus" evidence=IEA
GO:0060575 "intestinal epithelial cell differentiation" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0001158 "enhancer sequence-specific DNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
FB|FBgn0003507 srp "serpent" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3KUF4 GATA4 "cDNA FLJ39741 fis, clone SMINT2016544, highly similar to TRANSCRIPTION FACTOR GATA-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIZ4 GATA5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0Q0E4 GATA4 "Transcription factor GATA-4" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-340 gata5 "GATA-binding protein 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUZ9 GATA4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P43694 GATA4 "Transcription factor GATA-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZKZ4 GATA4 "Transcription factor GATA-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0032223 GATAd "GATAd" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 2e-14
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 4e-11
pfam0032036 pfam00320, GATA, GATA zinc finger 1e-10
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
 Score = 66.2 bits (162), Expect = 2e-14
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 75  TCTNCNTKVTTIWRRYPS-GEMVCNACGLYYRLHCRPRPVSMRR-DNIHPRKRR 126
            C+NC T  T +WRR PS G  +CNACGLY++ H   RP+S R+ D I  R R+
Sbjct: 1   ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRKKDQIKRRNRK 54


Length = 54

>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.56
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.48
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.34
KOG1601|consensus340 98.75
COG5641498 GAT1 GATA Zn-finger-containing transcription facto 98.75
COG5641498 GAT1 GATA Zn-finger-containing transcription facto 91.62
KOG3554|consensus693 85.26
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
Probab=99.56  E-value=1.7e-15  Score=113.49  Aligned_cols=50  Identities=52%  Similarity=1.089  Sum_probs=43.4

Q ss_pred             ccccCCCCCCcceeeCCCC-CcccchhhHHHHHhCCCCCCcccc-CCCCCCC
Q psy9606          75 TCTNCNTKVTTIWRRYPSG-EMVCNACGLYYRLHCRPRPVSMRR-DNIHPRK  124 (356)
Q Consensus        75 ~CsnCgTt~TP~WRRgp~G-~~LCNACGL~~k~~g~~RP~slkk-~~i~kRk  124 (356)
                      .|+||++++||+||+++.| .+|||||||||++++..||..++. ..++.++
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~~~~~~~~~   52 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRKKDQIKRRN   52 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCccccccccc
Confidence            5999999999999999965 689999999999999999999877 4444443



>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1gat_A60 Solution Structure Of The Specific Dna Complex Of T 5e-14
3gat_A66 Solution Nmr Structure Of The C-Terminal Domain Of 6e-14
3dfv_D63 Adjacent Gata Dna Binding Length = 63 4e-12
4hc7_A115 Crystal Structure Of The Full Dna Binding Domain Of 9e-12
7gat_A66 Solution Nmr Structure Of The L22v Mutant Dna Bindi 9e-11
4gat_A66 Solution Nmr Structure Of The Wild Type Dna Binding 1e-10
3vd6_C119 Both Zn Fingers Of Gata1 Bound To Palindromic Dna R 7e-09
2vus_I43 Crystal Structure Of Unliganded Nmra-Area Zinc Fing 8e-08
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 2e-04
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 2e-04
>pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 Back     alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 33/57 (57%), Positives = 41/57 (71%) Query: 70 KRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRR 126 KRA C+NC T TT+WRR P G+ VCNACGLYY+LH RP++MR+D I R R+ Sbjct: 1 KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRK 57
>pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 Back     alignment and structure
>pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 Back     alignment and structure
>pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 Back     alignment and structure
>pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 Back     alignment and structure
>pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 Back     alignment and structure
>pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 Back     alignment and structure
>pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
3dfx_A63 Trans-acting T-cell-specific transcription factor 6e-21
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 2e-20
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 2e-17
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 8e-17
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 1e-16
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 8e-09
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
 Score = 84.3 bits (208), Expect = 6e-21
 Identities = 29/61 (47%), Positives = 42/61 (68%)

Query: 69  PKRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPK 128
            +RA  +C NC T  TT+WRR  +G+ VCNACGLYY+LH   RP++M+++ I  R R+  
Sbjct: 3   ARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMS 62

Query: 129 N 129
           +
Sbjct: 63  S 63


>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.82
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.81
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.72
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.7
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.66
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.64
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.45
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
Probab=99.82  E-value=8.3e-21  Score=145.73  Aligned_cols=59  Identities=49%  Similarity=1.070  Sum_probs=52.7

Q ss_pred             CCCCcccccCCCCCCcceeeCCCCCcccchhhHHHHHhCCCCCCccccCCCCCCCCCCC
Q psy9606          70 KRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPK  128 (356)
Q Consensus        70 ~~~~~~CsnCgTt~TP~WRRgp~G~~LCNACGL~~k~~g~~RP~slkk~~i~kRkRk~K  128 (356)
                      .+....|.+|+|++||+||+|++|.+|||||||||+++++.||+.+++++|++|+|+.+
T Consensus         4 ~~~~~~C~~C~tt~Tp~WR~gp~G~~LCNACGl~~~~~~~~RP~~~~~~~i~~R~Rk~~   62 (63)
T 3dfx_A            4 RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMS   62 (63)
T ss_dssp             CCTTCCCTTTCCSCCSSCCCCTTSCCCCHHHHHHHHHHSSCCCGGGCCSSCCCCC----
T ss_pred             CCCCCcCCCcCCCCCCccCCCCCCCchhhHHHHHHHHcCCCCCcCcCCCccccccCCCC
Confidence            45678999999999999999999999999999999999999999999999999999864



>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 5e-20
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 4e-15
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 6e-13
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score = 80.4 bits (198), Expect = 5e-20
 Identities = 33/63 (52%), Positives = 43/63 (68%)

Query: 70  KRADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPKN 129
           KRA   C+NC T  TT+WRR P G+ VCNACGLYY+LH   RP++MR+D I  R R+  +
Sbjct: 1   KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS 60

Query: 130 AKR 132
             +
Sbjct: 61  KGK 63


>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.81
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.75
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.65
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 84.55
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 80.12
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.81  E-value=7e-21  Score=145.58  Aligned_cols=59  Identities=53%  Similarity=1.078  Sum_probs=55.1

Q ss_pred             CCcccccCCCCCCcceeeCCCCCcccchhhHHHHHhCCCCCCccccCCCCCCCCCCCcc
Q psy9606          72 ADLTCTNCNTKVTTIWRRYPSGEMVCNACGLYYRLHCRPRPVSMRRDNIHPRKRRPKNA  130 (356)
Q Consensus        72 ~~~~CsnCgTt~TP~WRRgp~G~~LCNACGL~~k~~g~~RP~slkk~~i~kRkRk~Kn~  130 (356)
                      ...+|+||+|++||+|||+++|.+|||||||||+++++.||+.+++++|++|+|+....
T Consensus         3 ~g~~C~nCgt~~Tp~WRr~~~G~~lCNACGl~~~~~~~~RP~~~~~~~i~~r~r~~~~~   61 (66)
T d3gata_           3 AGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSK   61 (66)
T ss_dssp             TTCCCTTTCCCCCSSEEECTTSCEEEHHHHHHHHHHCSCCCGGGCCSSCCCCSCCCCCC
T ss_pred             CCCCCCCCCCCCCcccccCCCCCcccchhHHHHHHhCCcCCccccccccccccCCCCCc
Confidence            45789999999999999999999999999999999999999999999999999887654



>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure