Psyllid ID: psy9655


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MVRDLTSVTYVTQRSARLSSGVQRSMESSEKENRENGQNQIVSEPPTDRTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL
cccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccEEEEEccccHHHccccccccccccHHHHHcHHccccccccccccEEccccccccccccccccccEEccHHHHHHHHHHHHccccEEcccc
MVRDLTSVTYVTQRSARlssgvqrsmessekenrengqnqivsepptdrtvsynrpvppnpslsctycsrAFKKRSDLTRHirshtkekpfkvrsl
mvrdltsvtyvtqrsarlssgvqrsmessekenrengqnqivsepptdrtvsynrpvppnpslsctyCSRAFKKRSDltrhirshtkekpfkvrsl
MVRDLTSVTYVTQRSARLSSGVQRSMESSEKENRENGQNQIVSEPPTDRTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL
****************************************************************CTYC****************************
*V*D**S*********************************************************CTYCSRAFKKRSDLTRHIRSHTKEKPFKVRS*
MVRDLTSVTYVTQ**************************QIVSEPPTDRTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHT**********
***DLTSVT*VTQR**********************************RTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKV**L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRDLTSVTYVTQRSARLSSGVQRSMESSEKENRENGQNQIVSEPPTDRTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q9UL36 1845 Zinc finger protein 236 O yes N/A 0.354 0.018 0.571 9e-06
Q4V8R6 719 Transcription factor E4F1 yes N/A 0.281 0.037 0.642 3e-05
Q9BYN7 854 Zinc finger protein 341 O no N/A 0.322 0.036 0.580 3e-05
Q8CCE9 783 Transcription factor E4F1 no N/A 0.260 0.031 0.571 5e-05
Q96MU6 729 Zinc finger protein 778 O no N/A 0.281 0.037 0.516 0.0002
Q9NQX0595 Putative histone-lysine N no N/A 0.322 0.052 0.548 0.0002
A6QPM3590 Putative histone-lysine N no N/A 0.322 0.052 0.548 0.0002
Q3UZD5596 Putative histone-lysine N no N/A 0.322 0.052 0.548 0.0002
Q5T5D7 378 Zinc finger protein 684 O no N/A 0.479 0.121 0.367 0.0002
Q04545 1251 Probable transcription fa yes N/A 0.541 0.041 0.375 0.0003
>sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 Back     alignment and function desciption
 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%)

Query: 59   PNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKV 93
            P  +  CTYC ++FKK SDL RH+R HT EKP+K 
Sbjct: 1163 PKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKC 1197




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=2 SV=2 Back     alignment and function description
>sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 Back     alignment and function description
>sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=2 SV=3 Back     alignment and function description
>sp|Q9NQX0|PRDM6_HUMAN Putative histone-lysine N-methyltransferase PRDM6 OS=Homo sapiens GN=PRDM6 PE=2 SV=2 Back     alignment and function description
>sp|A6QPM3|PRDM6_BOVIN Putative histone-lysine N-methyltransferase PRDM6 OS=Bos taurus GN=PRDM6 PE=2 SV=1 Back     alignment and function description
>sp|Q3UZD5|PRDM6_MOUSE Putative histone-lysine N-methyltransferase PRDM6 OS=Mus musculus GN=Prdm6 PE=1 SV=1 Back     alignment and function description
>sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 Back     alignment and function description
>sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
71895013 576 zinc finger protein 341 [Gallus gallus] 0.364 0.060 0.628 8e-06
449486147 930 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.416 0.043 0.575 2e-05
339251826 1292 zinc finger protein [Trichinella spirali 0.395 0.029 0.619 2e-05
390343041 1918 PREDICTED: zinc finger protein 236 [Stro 0.510 0.025 0.519 2e-05
449283980 778 Zinc finger protein 341, partial [Columb 0.375 0.046 0.611 2e-05
327271656 834 PREDICTED: zinc finger protein 341-like 0.375 0.043 0.583 6e-05
351710554 503 Zinc finger protein 449, partial [Hetero 0.510 0.097 0.410 8e-05
26081625384 hypothetical protein BRAFLDRAFT_170751 [ 0.427 0.488 0.512 9e-05
194875605 308 GG13232 [Drosophila erecta] gi|190655413 0.593 0.185 0.409 9e-05
410905017 1769 PREDICTED: zinc finger protein 236-like 0.260 0.014 0.677 0.0001
>gi|71895013|ref|NP_001026020.1| zinc finger protein 341 [Gallus gallus] gi|53132296|emb|CAG31891.1| hypothetical protein RCJMB04_13c20 [Gallus gallus] Back     alignment and taxonomy information
 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/35 (62%), Positives = 26/35 (74%)

Query: 58  PPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
           P +P L CTYC +AF K  DL +HIRSHT EKPF+
Sbjct: 308 PKSPKLKCTYCDKAFTKNFDLQQHIRSHTGEKPFQ 342




Source: Gallus gallus

Species: Gallus gallus

Genus: Gallus

Family: Phasianidae

Order: Galliformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota

>gi|449486147|ref|XP_004176560.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 341 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|339251826|ref|XP_003372935.1| zinc finger protein [Trichinella spiralis] gi|316968678|gb|EFV52931.1| zinc finger protein [Trichinella spiralis] Back     alignment and taxonomy information
>gi|390343041|ref|XP_003725784.1| PREDICTED: zinc finger protein 236 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|449283980|gb|EMC90563.1| Zinc finger protein 341, partial [Columba livia] Back     alignment and taxonomy information
>gi|327271656|ref|XP_003220603.1| PREDICTED: zinc finger protein 341-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|351710554|gb|EHB13473.1| Zinc finger protein 449, partial [Heterocephalus glaber] Back     alignment and taxonomy information
>gi|260816253|ref|XP_002602886.1| hypothetical protein BRAFLDRAFT_170751 [Branchiostoma floridae] gi|229288199|gb|EEN58898.1| hypothetical protein BRAFLDRAFT_170751 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|194875605|ref|XP_001973630.1| GG13232 [Drosophila erecta] gi|190655413|gb|EDV52656.1| GG13232 [Drosophila erecta] Back     alignment and taxonomy information
>gi|410905017|ref|XP_003965988.1| PREDICTED: zinc finger protein 236-like [Takifugu rubripes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
UNIPROTKB|F1N9E6 529 ZNF341 "Uncharacterized protei 0.364 0.066 0.628 6.3e-09
UNIPROTKB|F1NFT7 777 ZNF341 "Uncharacterized protei 0.364 0.045 0.628 1.8e-08
ZFIN|ZDB-GENE-060503-906 300 si:dkey-20i20.7 "si:dkey-20i20 0.687 0.22 0.417 7.6e-08
ZFIN|ZDB-GENE-060503-623 228 si:dkey-20i20.3 "si:dkey-20i20 0.687 0.289 0.388 2.1e-07
ZFIN|ZDB-GENE-060503-717120 si:dkey-20i20.4 "si:dkey-20i20 0.666 0.533 0.348 3.8e-07
ZFIN|ZDB-GENE-050208-785 320 si:dkey-15h8.7 "si:dkey-15h8.7 0.708 0.212 0.371 5.2e-07
ZFIN|ZDB-GENE-060503-58 499 si:dkey-20i20.11 "si:dkey-20i2 0.666 0.128 0.378 8.7e-07
ZFIN|ZDB-GENE-060503-435 369 si:dkey-20i20.15 "si:dkey-20i2 0.729 0.189 0.36 8.8e-07
ZFIN|ZDB-GENE-060503-905 208 si:dkey-20i20.10 "si:dkey-20i2 0.708 0.326 0.342 9.7e-07
ZFIN|ZDB-GENE-060503-245 215 si:dkey-20i20.13 "si:dkey-20i2 0.687 0.306 0.323 1.1e-06
UNIPROTKB|F1N9E6 ZNF341 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 6.3e-09, Sum P(2) = 6.3e-09
 Identities = 22/35 (62%), Positives = 26/35 (74%)

Query:    58 PPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
             P +P L CTYC +AF K  DL +HIRSHT EKPF+
Sbjct:   261 PKSPKLKCTYCDKAFTKNFDLQQHIRSHTGEKPFQ 295


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1NFT7 ZNF341 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-906 si:dkey-20i20.7 "si:dkey-20i20.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-623 si:dkey-20i20.3 "si:dkey-20i20.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-717 si:dkey-20i20.4 "si:dkey-20i20.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-785 si:dkey-15h8.7 "si:dkey-15h8.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-58 si:dkey-20i20.11 "si:dkey-20i20.11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-435 si:dkey-20i20.15 "si:dkey-20i20.15" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-905 si:dkey-20i20.10 "si:dkey-20i20.10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-245 si:dkey-20i20.13 "si:dkey-20i20.13" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 1e-04
smart0035523 smart00355, ZnF_C2H2, zinc finger 3e-04
pfam1389424 pfam13894, zf-C2H2_4, C2H2-type zinc finger 0.002
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
 Score = 35.4 bits (82), Expect = 1e-04
 Identities = 9/22 (40%), Positives = 16/22 (72%)

Query: 64 SCTYCSRAFKKRSDLTRHIRSH 85
           C  C ++F ++S+L RH+R+H
Sbjct: 1  KCPDCGKSFSRKSNLKRHLRTH 22


The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter. Length = 22

>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information
>gnl|CDD|206065 pfam13894, zf-C2H2_4, C2H2-type zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG2462|consensus279 99.49
KOG2462|consensus279 99.43
KOG3623|consensus1007 99.3
KOG3623|consensus 1007 99.05
PHA0276855 hypothetical protein; Provisional 99.01
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.91
PHA0061644 hypothetical protein 98.91
KOG3576|consensus267 98.87
KOG1074|consensus 958 98.62
KOG1074|consensus 958 98.53
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.23
PHA00733128 hypothetical protein 98.08
PHA0073279 hypothetical protein 97.88
KOG3576|consensus267 97.87
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.74
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.72
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.66
PRK04860160 hypothetical protein; Provisional 97.64
smart0035526 ZnF_C2H2 zinc finger. 97.43
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.38
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.2
KOG3608|consensus 467 97.15
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.92
PLN03086567 PRLI-interacting factor K; Provisional 96.9
PLN03086567 PRLI-interacting factor K; Provisional 96.87
COG5189423 SFP1 Putative transcriptional repressor regulating 96.41
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.31
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.27
PHA0276855 hypothetical protein; Provisional 95.61
KOG3608|consensus 467 95.59
PHA00733128 hypothetical protein 95.18
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.68
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.2
COG5189423 SFP1 Putative transcriptional repressor regulating 93.81
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 93.68
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.32
KOG3993|consensus 500 93.01
KOG2893|consensus 341 90.93
COG1592166 Rubrerythrin [Energy production and conversion] 90.63
KOG3993|consensus 500 90.43
COG5048 467 FOG: Zn-finger [General function prediction only] 89.02
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 87.08
COG404965 Uncharacterized protein containing archaeal-type C 87.06
COG5048 467 FOG: Zn-finger [General function prediction only] 86.75
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 85.87
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 85.68
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 84.99
KOG4167|consensus907 80.28
>KOG2462|consensus Back     alignment and domain information
Probab=99.49  E-value=1.3e-14  Score=94.29  Aligned_cols=62  Identities=19%  Similarity=0.198  Sum_probs=53.0

Q ss_pred             ccCCCCCCCCCCCCCCCcCCCCCCCCCceecccchhhccCCchHHHHHhhhCCCCCcccccC
Q psy9655          35 ENGQNQIVSEPPTDRTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL   96 (96)
Q Consensus        35 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~f~~~~~l~~h~~~htgekp~~C~~C   96 (96)
                      .++....+.+...+.+..|.++|+|+|||.|..|+|+|..+++|+.|+++|.+.|+|+|..|
T Consensus       188 c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C  249 (279)
T KOG2462|consen  188 CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRC  249 (279)
T ss_pred             cccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcch
Confidence            34455677888888888889999999999999999999999999999999999999999877



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 8e-04
2i13_A 190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-04
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure

Iteration: 1

Score = 38.9 bits (89), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 16/30 (53%), Positives = 20/30 (66%) Query: 62 SLSCTYCSRAFKKRSDLTRHIRSHTKEKPF 91 S C C+RAF ++ L RH RSHT EKP+ Sbjct: 2 SFVCEVCTRAFARQEHLKRHYRSHTNEKPY 31
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-06
2gli_A 155 Protein (five-finger GLI); protein/DNA complex, tr 1e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
1ard_A29 Yeast transcription factor ADR1; transcription reg 7e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 6e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-07
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-06
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 3e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-06
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 7e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-05
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 7e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 3e-04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-04
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
 Score = 49.0 bits (118), Expect = 1e-09
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 65 CTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
          C  C+RAF ++  L RH RSHT EKP+ 
Sbjct: 5  CEVCTRAFARQEHLKRHYRSHTNEKPYP 32


>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.62
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.61
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.61
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.61
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.61
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.61
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.6
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.6
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.6
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.6
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.6
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.6
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.6
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.6
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.6
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.6
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.6
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.6
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.6
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.6
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.6
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.59
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.59
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.58
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.58
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.58
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.57
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.57
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.57
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.56
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.54
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.54
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.52
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.51
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.51
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.51
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.51
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.51
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.51
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.51
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.5
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.5
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.5
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.5
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.5
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.5
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.49
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.49
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.48
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.48
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.48
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.47
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.47
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.47
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.46
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.46
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.38
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.34
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.33
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.33
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.32
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.29
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.28
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.28
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.28
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.28
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.28
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.25
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.25
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.24
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.24
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.23
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.22
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.22
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.21
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.21
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.2
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.2
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.18
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.16
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.15
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.12
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.12
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.12
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.08
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.07
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.07
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.07
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.07
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 99.03
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.0
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.0
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.0
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.99
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.98
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.98
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.98
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.96
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.96
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.95
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.95
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 98.93
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.93
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.93
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.92
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.89
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.89
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.87
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.86
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.85
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.85
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.84
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.84
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.83
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.83
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.83
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.83
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.81
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.81
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.8
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.29
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.8
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.79
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.78
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.22
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.73
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.73
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.73
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.73
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.72
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.71
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.71
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.66
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.65
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.64
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.6
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.57
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.55
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.53
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.93
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.47
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.47
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.46
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.46
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.41
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.3
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.3
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.25
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.24
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.23
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.0
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.67
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 97.45
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.44
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 97.42
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.42
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.41
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 97.4
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 97.4
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.36
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.36
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.35
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.34
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.34
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.33
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.33
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.31
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.31
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.31
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.3
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.3
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.3
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 97.3
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.3
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.3
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.29
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.29
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.28
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.28
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.28
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.28
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.27
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.27
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.27
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.27
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.27
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.26
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.26
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.26
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.26
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.26
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.25
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.25
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.25
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.25
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.24
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.24
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.22
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.22
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 97.22
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.21
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.21
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.21
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.21
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.21
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.21
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 97.21
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.2
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.2
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.2
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 97.2
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.2
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.2
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.2
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.2
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.2
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.2
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 97.19
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.19
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.19
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.19
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.18
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 97.18
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.17
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.17
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.17
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.16
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 97.14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 97.08
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 96.92
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.91
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.78
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 96.66
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.59
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.57
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.55
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 96.52
1vd4_A62 Transcription initiation factor IIE, alpha subunit 96.52
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.49
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 96.45
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.41
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.33
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.3
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.24
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 96.13
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 96.11
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 96.06
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.8
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 95.74
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 95.68
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 95.63
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.57
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 94.8
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 94.18
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 93.75
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 89.41
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.87
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.44
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 88.08
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 87.41
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 82.85
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 82.83
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 81.17
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
Probab=99.62  E-value=5.5e-16  Score=75.58  Aligned_cols=45  Identities=31%  Similarity=0.444  Sum_probs=42.4

Q ss_pred             cCCCCCCCCCceecccchhhccCCchHHHHHhhhCCCCCcccccC
Q psy9655          52 SYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL   96 (96)
Q Consensus        52 ~~~~~~~~~~~~~C~~C~k~f~~~~~l~~h~~~htgekp~~C~~C   96 (96)
                      .+.+.|++.++|.|..|++.|.....|..|+++|++++||+|.+|
T Consensus         2 ~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C   46 (46)
T 2ely_A            2 SSGSSGTGEKPFKCVECGKGFSRRSALNVHHKLHTGEKPSGPSSG   46 (46)
T ss_dssp             CCCCCCCCCCSBCCSSSCCCBSSTTHHHHHHHHHSCCSSCSCCCC
T ss_pred             CCCCCCCCCCCcccCccCcccCCHHHHHHHHHHcCCCCCCCCCCC
Confidence            356789999999999999999999999999999999999999998



>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1bboa128 g.37.1.1 (A:1-28) Enhancer binding protein {Human 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 5e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 6e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 6e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.004
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.9 bits (104), Expect = 2e-08
 Identities = 5/29 (17%), Positives = 13/29 (44%)

Query: 64 SCTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
              C ++F  +  L  H++ H+  + + 
Sbjct: 5  PEPACGKSFNFKKHLKEHMKLHSDTRDYI 33


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.53
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.51
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.5
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.49
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.47
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.45
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.39
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.38
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.34
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.31
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.25
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.25
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.24
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.23
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.18
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.01
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.95
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.92
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.82
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.76
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.68
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.56
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.54
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.46
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.45
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.42
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.42
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.32
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.18
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.12
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.99
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.98
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.98
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 97.9
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.83
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.78
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.75
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.74
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.74
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.7
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.5
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.38
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.36
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.3
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.24
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.85
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.77
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.55
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.46
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.3
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.28
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.04
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.0
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.64
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.49
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.85
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.58
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 93.5
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.12
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 93.11
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 93.02
d1y0jb136 U-shaped transcription factor, different fingers { 91.66
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.02
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.93
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.54
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.54
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 86.46
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.83
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65  E-value=2.1e-17  Score=77.09  Aligned_cols=37  Identities=30%  Similarity=0.653  Sum_probs=34.0

Q ss_pred             CCCceecccchhhccCCchHHHHHh-hhCCCCCccccc
Q psy9655          59 PNPSLSCTYCSRAFKKRSDLTRHIR-SHTKEKPFKVRS   95 (96)
Q Consensus        59 ~~~~~~C~~C~k~f~~~~~l~~h~~-~htgekp~~C~~   95 (96)
                      .++||.|..||+.|.+.++|+.|++ +|+|||||+|++
T Consensus         2 ~~Kpy~C~~Cgk~F~~~~~L~~H~r~~Ht~ekpy~C~i   39 (39)
T d2epsa1           2 VGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV   39 (39)
T ss_dssp             SSCCEECSSSCCEESSHHHHHHHHHHTSCCCCCCCSSS
T ss_pred             CCCCccCCCCCCCcCChHHhhccCcCccCCCcCcCCcC
Confidence            3688999999999999999999975 799999999974



>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure