Psyllid ID: psy9655
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 71895013 | 576 | zinc finger protein 341 [Gallus gallus] | 0.364 | 0.060 | 0.628 | 8e-06 | |
| 449486147 | 930 | PREDICTED: LOW QUALITY PROTEIN: zinc fin | 0.416 | 0.043 | 0.575 | 2e-05 | |
| 339251826 | 1292 | zinc finger protein [Trichinella spirali | 0.395 | 0.029 | 0.619 | 2e-05 | |
| 390343041 | 1918 | PREDICTED: zinc finger protein 236 [Stro | 0.510 | 0.025 | 0.519 | 2e-05 | |
| 449283980 | 778 | Zinc finger protein 341, partial [Columb | 0.375 | 0.046 | 0.611 | 2e-05 | |
| 327271656 | 834 | PREDICTED: zinc finger protein 341-like | 0.375 | 0.043 | 0.583 | 6e-05 | |
| 351710554 | 503 | Zinc finger protein 449, partial [Hetero | 0.510 | 0.097 | 0.410 | 8e-05 | |
| 260816253 | 84 | hypothetical protein BRAFLDRAFT_170751 [ | 0.427 | 0.488 | 0.512 | 9e-05 | |
| 194875605 | 308 | GG13232 [Drosophila erecta] gi|190655413 | 0.593 | 0.185 | 0.409 | 9e-05 | |
| 410905017 | 1769 | PREDICTED: zinc finger protein 236-like | 0.260 | 0.014 | 0.677 | 0.0001 |
| >gi|71895013|ref|NP_001026020.1| zinc finger protein 341 [Gallus gallus] gi|53132296|emb|CAG31891.1| hypothetical protein RCJMB04_13c20 [Gallus gallus] | Back alignment and taxonomy information |
|---|
Score = 54.3 bits (129), Expect = 8e-06, Method: Compositional matrix adjust.
Identities = 22/35 (62%), Positives = 26/35 (74%)
Query: 58 PPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
P +P L CTYC +AF K DL +HIRSHT EKPF+
Sbjct: 308 PKSPKLKCTYCDKAFTKNFDLQQHIRSHTGEKPFQ 342
|
Source: Gallus gallus Species: Gallus gallus Genus: Gallus Family: Phasianidae Order: Galliformes Class: Aves Phylum: Chordata Superkingdom: Eukaryota |
| >gi|449486147|ref|XP_004176560.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 341 [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
| >gi|339251826|ref|XP_003372935.1| zinc finger protein [Trichinella spiralis] gi|316968678|gb|EFV52931.1| zinc finger protein [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
| >gi|390343041|ref|XP_003725784.1| PREDICTED: zinc finger protein 236 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|449283980|gb|EMC90563.1| Zinc finger protein 341, partial [Columba livia] | Back alignment and taxonomy information |
|---|
| >gi|327271656|ref|XP_003220603.1| PREDICTED: zinc finger protein 341-like [Anolis carolinensis] | Back alignment and taxonomy information |
|---|
| >gi|351710554|gb|EHB13473.1| Zinc finger protein 449, partial [Heterocephalus glaber] | Back alignment and taxonomy information |
|---|
| >gi|260816253|ref|XP_002602886.1| hypothetical protein BRAFLDRAFT_170751 [Branchiostoma floridae] gi|229288199|gb|EEN58898.1| hypothetical protein BRAFLDRAFT_170751 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|194875605|ref|XP_001973630.1| GG13232 [Drosophila erecta] gi|190655413|gb|EDV52656.1| GG13232 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|410905017|ref|XP_003965988.1| PREDICTED: zinc finger protein 236-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| UNIPROTKB|F1N9E6 | 529 | ZNF341 "Uncharacterized protei | 0.364 | 0.066 | 0.628 | 6.3e-09 | |
| UNIPROTKB|F1NFT7 | 777 | ZNF341 "Uncharacterized protei | 0.364 | 0.045 | 0.628 | 1.8e-08 | |
| ZFIN|ZDB-GENE-060503-906 | 300 | si:dkey-20i20.7 "si:dkey-20i20 | 0.687 | 0.22 | 0.417 | 7.6e-08 | |
| ZFIN|ZDB-GENE-060503-623 | 228 | si:dkey-20i20.3 "si:dkey-20i20 | 0.687 | 0.289 | 0.388 | 2.1e-07 | |
| ZFIN|ZDB-GENE-060503-717 | 120 | si:dkey-20i20.4 "si:dkey-20i20 | 0.666 | 0.533 | 0.348 | 3.8e-07 | |
| ZFIN|ZDB-GENE-050208-785 | 320 | si:dkey-15h8.7 "si:dkey-15h8.7 | 0.708 | 0.212 | 0.371 | 5.2e-07 | |
| ZFIN|ZDB-GENE-060503-58 | 499 | si:dkey-20i20.11 "si:dkey-20i2 | 0.666 | 0.128 | 0.378 | 8.7e-07 | |
| ZFIN|ZDB-GENE-060503-435 | 369 | si:dkey-20i20.15 "si:dkey-20i2 | 0.729 | 0.189 | 0.36 | 8.8e-07 | |
| ZFIN|ZDB-GENE-060503-905 | 208 | si:dkey-20i20.10 "si:dkey-20i2 | 0.708 | 0.326 | 0.342 | 9.7e-07 | |
| ZFIN|ZDB-GENE-060503-245 | 215 | si:dkey-20i20.13 "si:dkey-20i2 | 0.687 | 0.306 | 0.323 | 1.1e-06 |
| UNIPROTKB|F1N9E6 ZNF341 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 128 (50.1 bits), Expect = 6.3e-09, Sum P(2) = 6.3e-09
Identities = 22/35 (62%), Positives = 26/35 (74%)
Query: 58 PPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
P +P L CTYC +AF K DL +HIRSHT EKPF+
Sbjct: 261 PKSPKLKCTYCDKAFTKNFDLQQHIRSHTGEKPFQ 295
|
|
| UNIPROTKB|F1NFT7 ZNF341 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-906 si:dkey-20i20.7 "si:dkey-20i20.7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-623 si:dkey-20i20.3 "si:dkey-20i20.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-717 si:dkey-20i20.4 "si:dkey-20i20.4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-785 si:dkey-15h8.7 "si:dkey-15h8.7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-58 si:dkey-20i20.11 "si:dkey-20i20.11" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-435 si:dkey-20i20.15 "si:dkey-20i20.15" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-905 si:dkey-20i20.10 "si:dkey-20i20.10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-245 si:dkey-20i20.13 "si:dkey-20i20.13" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| pfam00096 | 22 | pfam00096, zf-C2H2, Zinc finger, C2H2 type | 1e-04 | |
| smart00355 | 23 | smart00355, ZnF_C2H2, zinc finger | 3e-04 | |
| pfam13894 | 24 | pfam13894, zf-C2H2_4, C2H2-type zinc finger | 0.002 |
| >gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type | Back alignment and domain information |
|---|
Score = 35.4 bits (82), Expect = 1e-04
Identities = 9/22 (40%), Positives = 16/22 (72%)
Query: 64 SCTYCSRAFKKRSDLTRHIRSH 85
C C ++F ++S+L RH+R+H
Sbjct: 1 KCPDCGKSFSRKSNLKRHLRTH 22
|
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter. Length = 22 |
| >gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|206065 pfam13894, zf-C2H2_4, C2H2-type zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| KOG2462|consensus | 279 | 99.49 | ||
| KOG2462|consensus | 279 | 99.43 | ||
| KOG3623|consensus | 1007 | 99.3 | ||
| KOG3623|consensus | 1007 | 99.05 | ||
| PHA02768 | 55 | hypothetical protein; Provisional | 99.01 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 98.91 | |
| PHA00616 | 44 | hypothetical protein | 98.91 | |
| KOG3576|consensus | 267 | 98.87 | ||
| KOG1074|consensus | 958 | 98.62 | ||
| KOG1074|consensus | 958 | 98.53 | ||
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 98.23 | |
| PHA00733 | 128 | hypothetical protein | 98.08 | |
| PHA00732 | 79 | hypothetical protein | 97.88 | |
| KOG3576|consensus | 267 | 97.87 | ||
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 97.74 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 97.72 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 97.66 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 97.64 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 97.43 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 97.38 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 97.2 | |
| KOG3608|consensus | 467 | 97.15 | ||
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 96.92 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.9 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.87 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 96.41 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 96.31 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 96.27 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 95.61 | |
| KOG3608|consensus | 467 | 95.59 | ||
| PHA00733 | 128 | hypothetical protein | 95.18 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 94.68 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 94.2 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 93.81 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 93.68 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 93.32 | |
| KOG3993|consensus | 500 | 93.01 | ||
| KOG2893|consensus | 341 | 90.93 | ||
| COG1592 | 166 | Rubrerythrin [Energy production and conversion] | 90.63 | |
| KOG3993|consensus | 500 | 90.43 | ||
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 89.02 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 87.08 | |
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 87.06 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 86.75 | |
| PF02892 | 45 | zf-BED: BED zinc finger; InterPro: IPR003656 Zinc | 85.87 | |
| PF05443 | 132 | ROS_MUCR: ROS/MUCR transcriptional regulator prote | 85.68 | |
| smart00614 | 50 | ZnF_BED BED zinc finger. DNA-binding domain in chr | 84.99 | |
| KOG4167|consensus | 907 | 80.28 |
| >KOG2462|consensus | Back alignment and domain information |
|---|
Probab=99.49 E-value=1.3e-14 Score=94.29 Aligned_cols=62 Identities=19% Similarity=0.198 Sum_probs=53.0
Q ss_pred ccCCCCCCCCCCCCCCCcCCCCCCCCCceecccchhhccCCchHHHHHhhhCCCCCcccccC
Q psy9655 35 ENGQNQIVSEPPTDRTVSYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL 96 (96)
Q Consensus 35 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~f~~~~~l~~h~~~htgekp~~C~~C 96 (96)
.++....+.+...+.+..|.++|+|+|||.|..|+|+|..+++|+.|+++|.+.|+|+|..|
T Consensus 188 c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C 249 (279)
T KOG2462|consen 188 CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRC 249 (279)
T ss_pred cccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcch
Confidence 34455677888888888889999999999999999999999999999999999999999877
|
|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >COG1592 Rubrerythrin [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins | Back alignment and domain information |
|---|
| >smart00614 ZnF_BED BED zinc finger | Back alignment and domain information |
|---|
| >KOG4167|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 96 | ||||
| 2adr_A | 60 | Adr1 Dna-Binding Domain From Saccharomyces Cerevisi | 8e-04 | ||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 8e-04 |
| >pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 | Back alignment and structure |
|
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 1e-09 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 2e-09 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 9e-09 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 5e-06 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 1e-08 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 6e-07 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 7e-07 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 3e-06 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 2e-08 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-07 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 2e-06 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 4e-08 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 4e-07 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 4e-08 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 4e-07 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 4e-08 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 4e-06 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 4e-08 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 1e-06 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 1e-05 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 5e-05 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 5e-08 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-07 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 1e-06 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 8e-04 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 6e-08 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-04 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 6e-08 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 1e-07 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 1e-07 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 6e-08 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 1e-05 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 6e-08 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 9e-07 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 1e-06 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-08 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 7e-08 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 1e-07 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 1e-07 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-07 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-07 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 2e-07 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-07 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-07 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-07 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 3e-07 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 9e-07 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 4e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-07 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-07 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-07 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 3e-07 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 1e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 3e-07 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 4e-07 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 4e-05 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 4e-07 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 2e-06 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-07 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-07 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 4e-07 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 1e-06 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 5e-07 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 5e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 5e-07 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 5e-07 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 6e-07 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 3e-06 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-07 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 5e-07 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-07 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-07 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-07 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-07 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 6e-07 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 6e-07 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 6e-07 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-06 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-04 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 3e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-07 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 7e-07 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 1e-05 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 9e-05 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-07 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-07 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-07 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 8e-07 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-06 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-07 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 8e-07 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-07 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-07 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 9e-07 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-07 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-07 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-07 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-07 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-06 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-06 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-06 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-06 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 1e-06 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-06 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-06 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 1e-06 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-06 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-06 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-06 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-06 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-06 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-06 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-06 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 7e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 2e-06 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 2e-06 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 2e-06 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-06 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 2e-06 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-06 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-06 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-06 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 4e-06 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-06 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-06 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-06 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 3e-06 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 3e-06 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 4e-06 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 5e-06 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 7e-06 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 9e-06 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 4e-05 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 7e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-06 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-06 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 3e-06 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-06 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-06 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-06 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-06 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-06 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-06 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-06 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 7e-06 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 9e-06 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 2e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 3e-04 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 3e-04 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 4e-04 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-04 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 5e-04 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 8e-04 |
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
Score = 49.0 bits (118), Expect = 1e-09
Identities = 15/28 (53%), Positives = 19/28 (67%)
Query: 65 CTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
C C+RAF ++ L RH RSHT EKP+
Sbjct: 5 CEVCTRAFARQEHLKRHYRSHTNEKPYP 32
|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.62 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.61 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.61 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.61 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.61 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.61 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.6 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.6 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.6 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.6 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.6 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.6 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.6 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.6 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.6 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.6 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.6 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.6 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.6 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.6 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.6 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.6 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.6 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.6 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.6 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.6 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.6 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.6 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.6 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.6 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 99.6 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.59 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.59 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.59 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.59 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.59 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.59 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.59 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.59 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.59 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.59 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.59 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.58 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.58 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.58 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.58 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.57 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.57 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.57 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.56 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.54 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.54 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.53 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.53 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.52 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.52 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.52 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.51 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.51 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.51 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.51 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 99.51 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.51 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 99.51 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.51 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.51 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 99.51 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 99.51 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.51 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.5 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 99.5 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.5 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.5 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.5 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.5 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.5 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.5 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.5 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.49 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 99.49 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.49 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.49 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.49 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 99.49 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.48 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 99.48 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 99.48 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.48 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.48 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.48 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.48 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.48 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 99.47 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.47 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.47 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.46 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 99.46 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.46 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.46 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.43 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.43 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 99.4 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.38 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.34 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.33 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 99.33 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 99.32 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.29 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 99.28 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.28 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.28 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.28 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.28 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.25 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.25 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.25 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.24 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 99.24 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.23 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.23 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.22 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.22 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 99.21 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 99.21 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.21 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.2 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.2 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.18 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 99.18 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.17 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.16 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.15 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.14 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.13 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.12 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 99.12 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.12 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 99.11 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 99.11 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.09 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.08 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.08 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 99.07 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.07 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.07 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.07 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.07 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.06 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.05 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.04 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 99.03 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.03 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.03 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.0 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.0 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.0 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.99 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.98 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 98.98 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 98.98 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.96 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.96 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 98.95 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 98.95 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.94 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 98.93 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 98.93 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.93 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.93 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 98.92 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.92 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 98.89 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 98.89 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.87 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.86 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.86 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 98.85 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.85 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.85 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.84 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 98.84 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 98.84 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 98.83 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 98.83 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 98.83 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 98.83 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.81 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.81 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.81 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.8 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.8 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 98.8 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.29 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.8 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.79 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 98.79 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 98.79 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.78 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.22 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.73 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.73 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.73 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 98.73 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 98.72 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.71 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.71 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 98.68 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 98.66 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.65 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.64 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.63 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.6 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 98.57 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.55 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.53 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 97.93 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 98.48 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.47 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.47 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.46 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.46 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.41 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.3 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 98.3 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.26 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.25 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.24 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.23 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.04 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.0 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 97.67 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.45 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 97.44 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.42 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.42 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.41 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 97.4 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.4 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.36 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.36 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.35 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.34 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.34 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.33 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.33 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.31 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.31 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.31 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.3 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.3 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.3 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.3 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.3 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.3 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.29 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.29 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.28 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.28 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.28 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.28 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.27 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.27 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.27 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.27 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.27 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.26 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.26 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.26 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.26 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.26 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.25 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.25 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.25 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.25 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.24 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.24 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.24 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.22 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.22 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.22 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.21 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.21 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.21 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.21 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.21 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.21 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.21 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.2 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.2 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.2 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.2 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.2 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.2 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.2 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.2 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.2 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.2 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 97.19 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.19 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.19 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.19 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.18 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 97.18 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.17 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.17 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.17 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.17 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.16 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.15 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.15 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.15 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.15 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.14 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.14 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.14 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.12 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.12 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.11 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.1 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.08 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.06 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.99 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 96.92 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.91 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.78 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 96.66 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.59 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.57 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 96.55 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.52 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 96.52 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.49 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.45 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.41 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.33 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.3 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.24 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.13 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 96.11 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 96.06 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 95.8 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 95.74 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 95.68 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 95.63 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 95.57 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 94.8 | |
| 2jsp_A | 87 | Transcriptional regulatory protein ROS; prokaryoti | 94.18 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 93.75 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 89.41 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 88.87 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 88.44 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 88.08 | |
| 1yuz_A | 202 | Nigerythrin; rubrythrin, rubredoxin, hemerythrin, | 87.41 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 82.85 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 82.83 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 81.17 |
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
Probab=99.62 E-value=5.5e-16 Score=75.58 Aligned_cols=45 Identities=31% Similarity=0.444 Sum_probs=42.4
Q ss_pred cCCCCCCCCCceecccchhhccCCchHHHHHhhhCCCCCcccccC
Q psy9655 52 SYNRPVPPNPSLSCTYCSRAFKKRSDLTRHIRSHTKEKPFKVRSL 96 (96)
Q Consensus 52 ~~~~~~~~~~~~~C~~C~k~f~~~~~l~~h~~~htgekp~~C~~C 96 (96)
.+.+.|++.++|.|..|++.|.....|..|+++|++++||+|.+|
T Consensus 2 ~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C 46 (46)
T 2ely_A 2 SSGSSGTGEKPFKCVECGKGFSRRSALNVHHKLHTGEKPSGPSSG 46 (46)
T ss_dssp CCCCCCCCCCSBCCSSSCCCBSSTTHHHHHHHHHSCCSSCSCCCC
T ss_pred CCCCCCCCCCCcccCccCcccCCHHHHHHHHHHcCCCCCCCCCCC
Confidence 356789999999999999999999999999999999999999998
|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 96 | ||||
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 2e-08 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 4e-08 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 2e-07 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 3e-06 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 5e-06 | |
| d1sp2a_ | 31 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 1e-05 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 3e-05 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 9e-05 | |
| d2glia3 | 30 | g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo | 1e-04 | |
| d1zfda_ | 32 | g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye | 2e-04 | |
| d1bboa1 | 28 | g.37.1.1 (A:1-28) Enhancer binding protein {Human | 3e-04 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 4e-04 | |
| d1a1ia1 | 29 | g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) | 5e-04 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 6e-04 | |
| d1ubdc4 | 28 | g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger | 6e-04 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 7e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 0.001 | |
| d1ubdc3 | 30 | g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger | 0.001 | |
| d1ncsa_ | 47 | g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye | 0.004 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 0.004 |
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 692, ZNF692 species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.9 bits (104), Expect = 2e-08
Identities = 5/29 (17%), Positives = 13/29 (44%)
Query: 64 SCTYCSRAFKKRSDLTRHIRSHTKEKPFK 92
C ++F + L H++ H+ + +
Sbjct: 5 PEPACGKSFNFKKHLKEHMKLHSDTRDYI 33
|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 28 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 99.53 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 99.51 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.5 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.49 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 99.47 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.45 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.39 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 99.38 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 99.37 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 99.34 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 99.31 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 99.25 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 99.25 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.24 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.23 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.18 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 99.01 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.95 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.92 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.82 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.76 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.68 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.56 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 98.54 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 98.46 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.45 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.42 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.42 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.32 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.18 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.14 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 98.12 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 97.99 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.98 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.98 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 97.9 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 97.83 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.78 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.75 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 97.74 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.74 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 97.7 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.5 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 97.38 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.36 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 97.3 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.24 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.85 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.77 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.55 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.46 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 96.3 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 96.28 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.04 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.0 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 95.64 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 95.49 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 94.85 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 93.58 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 93.5 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 93.12 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 93.11 | |
| d2ghfa1 | 58 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 93.02 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 91.66 | |
| d1yuja_ | 54 | GAGA factor {Drosophila melanogaster [TaxId: 7227] | 91.02 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 90.93 | |
| d1ubdc1 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 89.54 | |
| d2drpa1 | 37 | Tramtrack protein (two zinc-finger peptide) {Droso | 86.54 | |
| d1x6fa1 | 75 | Zinc finger protein 462, ZNF462 {Human (Homo sapie | 86.46 | |
| d1tf3a3 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 82.83 |
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: PATZ1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65 E-value=2.1e-17 Score=77.09 Aligned_cols=37 Identities=30% Similarity=0.653 Sum_probs=34.0
Q ss_pred CCCceecccchhhccCCchHHHHHh-hhCCCCCccccc
Q psy9655 59 PNPSLSCTYCSRAFKKRSDLTRHIR-SHTKEKPFKVRS 95 (96)
Q Consensus 59 ~~~~~~C~~C~k~f~~~~~l~~h~~-~htgekp~~C~~ 95 (96)
.++||.|..||+.|.+.++|+.|++ +|+|||||+|++
T Consensus 2 ~~Kpy~C~~Cgk~F~~~~~L~~H~r~~Ht~ekpy~C~i 39 (39)
T d2epsa1 2 VGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39 (39)
T ss_dssp SSCCEECSSSCCEESSHHHHHHHHHHTSCCCCCCCSSS
T ss_pred CCCCccCCCCCCCcCChHHhhccCcCccCCCcCcCCcC
Confidence 3688999999999999999999975 799999999974
|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|