Psyllid ID: psy965

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MQLDQYNTTDFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQL
cccccccccccHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccEEEccccccc
ccccccccccHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEHHHHHcccHHHHHHHHHHHHHHHccHcHEEEEccHHHHccHHHHHHHHHHHHHccccEEEccccccc
mqldqynttdfkwvHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIdlttlsgddtEAVVETLTLKAIQPLSEELKEKVLRGFVSTvwhgsdnlktklvyqpclsqpagfpsgqYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEkcgekihmKTILAVGELKTSENIYCASMTAmfagsdfiktsgsiql
mqldqynttdfkwvhdIQINTKYLEDLTRQFEAvdlsriknkksLLLKIIEfidlttlsgdDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSlvlnnqwpeLFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQL
MQLDQYNTTDFKWVHDIQINTKYLEDLTRQFEAVDlsriknkkslllkiiEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQL
*****YNTTDFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFI********
*****YN*TDFKWVHDIQINTKYLEDLTRQF****LS*IKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQ*
MQLDQYNTTDFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQL
**L*QYNTTDFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLDQYNTTDFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q9Y315318 Putative deoxyribose-phos yes N/A 0.929 0.625 0.426 8e-38
Q91YP3318 Putative deoxyribose-phos yes N/A 0.929 0.625 0.402 4e-35
Q3T0V9318 Putative deoxyribose-phos yes N/A 0.929 0.625 0.398 2e-34
Q19264303 Putative deoxyribose-phos yes N/A 0.780 0.551 0.411 2e-26
C3LQC2259 Deoxyribose-phosphate ald yes N/A 0.761 0.629 0.321 3e-12
Q9KPL7259 Deoxyribose-phosphate ald yes N/A 0.761 0.629 0.321 3e-12
A5F5S6259 Deoxyribose-phosphate ald yes N/A 0.761 0.629 0.321 3e-12
Q7MI38258 Deoxyribose-phosphate ald yes N/A 0.761 0.631 0.317 1e-11
Q8DBT2258 Deoxyribose-phosphate ald yes N/A 0.761 0.631 0.317 1e-11
A7MUW7258 Deoxyribose-phosphate ald yes N/A 0.761 0.631 0.311 7e-11
>sp|Q9Y315|DEOC_HUMAN Putative deoxyribose-phosphate aldolase OS=Homo sapiens GN=DERA PE=1 SV=2 Back     alignment and function desciption
 Score =  156 bits (395), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 121/211 (57%), Gaps = 12/211 (5%)

Query: 10  DFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVET 69
           D  W+  IQ+N   +     Q +A    + + + + LLK + FIDLTTLSGDDT + ++ 
Sbjct: 11  DLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQR 70

Query: 70  LTLKAIQPLSEELKEKVL---RG--------FVSTVWHGSDNLKTKLVYQPCLSQPAGFP 118
           L  KA  P+ E+L + +    +G        + + V      LK      P  S  AGFP
Sbjct: 71  LCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFP 130

Query: 119 SGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKT 178
           +GQ  L+TRL EI L  +    E+D+VI RSLVL  QW  L+ E++Q ++ CGE  H+KT
Sbjct: 131 AGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGEA-HLKT 189

Query: 179 ILAVGELKTSENIYCASMTAMFAGSDFIKTS 209
           ILA GEL T  N+Y ASM AM AGSDFIKTS
Sbjct: 190 ILATGELGTLTNVYKASMIAMMAGSDFIKTS 220
Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.
Homo sapiens (taxid: 9606)
EC: 4EC: .EC: 1EC: .EC: 2EC: .EC: 4
>sp|Q91YP3|DEOC_MOUSE Putative deoxyribose-phosphate aldolase OS=Mus musculus GN=Dera PE=2 SV=1 Back     alignment and function description
>sp|Q3T0V9|DEOC_BOVIN Putative deoxyribose-phosphate aldolase OS=Bos taurus GN=DERA PE=2 SV=1 Back     alignment and function description
>sp|Q19264|DEOC_CAEEL Putative deoxyribose-phosphate aldolase OS=Caenorhabditis elegans GN=F09E5.3 PE=3 SV=1 Back     alignment and function description
>sp|C3LQC2|DEOC_VIBCM Deoxyribose-phosphate aldolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|Q9KPL7|DEOC_VIBCH Deoxyribose-phosphate aldolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|A5F5S6|DEOC_VIBC3 Deoxyribose-phosphate aldolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|Q7MI38|DEOC2_VIBVY Deoxyribose-phosphate aldolase 2 OS=Vibrio vulnificus (strain YJ016) GN=deoC2 PE=3 SV=1 Back     alignment and function description
>sp|Q8DBT2|DEOC_VIBVU Deoxyribose-phosphate aldolase OS=Vibrio vulnificus (strain CMCP6) GN=deoC PE=3 SV=1 Back     alignment and function description
>sp|A7MUW7|DEOC_VIBHB Deoxyribose-phosphate aldolase OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=deoC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
54400696 318 putative deoxyribose-phosphate aldolase 0.929 0.625 0.398 7e-37
225717636 317 deoxyribose-phosphate aldolase [Caligus 0.929 0.627 0.398 8e-37
332375705 325 unknown [Dendroctonus ponderosae] 0.929 0.612 0.425 1e-36
432942704 318 PREDICTED: putative deoxyribose-phosphat 0.929 0.625 0.417 3e-36
33989376 336 DERA protein, partial [Homo sapiens] 0.929 0.592 0.426 4e-36
62896641 326 2-deoxyribose-5-phosphate aldolase homol 0.929 0.610 0.426 4e-36
116063554 318 putative deoxyribose-phosphate aldolase 0.929 0.625 0.426 4e-36
4680691 336 CGI-26 protein [Homo sapiens] 0.929 0.592 0.426 4e-36
348536395 318 PREDICTED: putative deoxyribose-phosphat 0.943 0.635 0.397 4e-36
344266658 339 PREDICTED: putative deoxyribose-phosphat 0.929 0.587 0.417 2e-35
>gi|54400696|ref|NP_001006097.1| putative deoxyribose-phosphate aldolase [Danio rerio] gi|53733714|gb|AAH83220.1| 2-deoxyribose-5-phosphate aldolase homolog (C. elegans) [Danio rerio] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 123/211 (58%), Gaps = 12/211 (5%)

Query: 10  DFKWVHDIQINTKYLEDLTRQFEAVDLSRIKNKKSLLLKIIEFIDLTTLSGDDTEAVVET 69
           D +WV  +++NT+ +    +Q +   +++ + + + LLK +  IDLTTL+GDDT + V  
Sbjct: 11  DLEWVSKVRVNTQAVHKRAQQIQGRKVAKKQWQAAWLLKAVTCIDLTTLAGDDTPSNVHR 70

Query: 70  LTLKAIQPLSEEL-----------KEKVLRGFVSTVWHGSDNLKTKLVYQPCLSQPAGFP 118
           L +KA QP+  +L               +  + S V     +LK      P  S   GFP
Sbjct: 71  LCMKATQPIRHDLLKSMDMHDKGISTAAVCVYPSRVADAVKSLKAANSSLPVASVATGFP 130

Query: 119 SGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKT 178
           +GQ  L+TRL E+++  K    E+DIVI R+L L  QW  L+ E++Q +E CG+  HMK+
Sbjct: 131 AGQTPLKTRLEEVQMAVKDGAAEIDIVINRTLALTGQWAALYDEIRQFREACGDA-HMKS 189

Query: 179 ILAVGELKTSENIYCASMTAMFAGSDFIKTS 209
           ILAVGEL T  N+Y AS+ +M AGSDFIKTS
Sbjct: 190 ILAVGELGTFTNVYKASLVSMMAGSDFIKTS 220

Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|225717636|gb|ACO14664.1| deoxyribose-phosphate aldolase [Caligus clemensi] Back     alignment and taxonomy information
>gi|332375705|gb|AEE62993.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|432942704|ref|XP_004083042.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|33989376|gb|AAH56234.1| DERA protein, partial [Homo sapiens] Back     alignment and taxonomy information
>gi|62896641|dbj|BAD96261.1| 2-deoxyribose-5-phosphate aldolase homolog [Homo sapiens] Back     alignment and taxonomy information
>gi|116063554|ref|NP_057038.2| putative deoxyribose-phosphate aldolase [Homo sapiens] gi|24636817|sp|Q9Y315.2|DEOC_HUMAN RecName: Full=Putative deoxyribose-phosphate aldolase; Short=DERA; AltName: Full=2-deoxy-D-ribose 5-phosphate aldolase; AltName: Full=Phosphodeoxyriboaldolase; Short=Deoxyriboaldolase gi|119616764|gb|EAW96358.1| 2-deoxyribose-5-phosphate aldolase homolog (C. elegans), isoform CRA_b [Homo sapiens] gi|157170050|gb|AAI52914.1| 2-deoxyribose-5-phosphate aldolase homolog (C. elegans) [synthetic construct] Back     alignment and taxonomy information
>gi|4680691|gb|AAD27735.1|AF132960_1 CGI-26 protein [Homo sapiens] Back     alignment and taxonomy information
>gi|348536395|ref|XP_003455682.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|344266658|ref|XP_003405397.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Loxodonta africana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
UNIPROTKB|Q9Y315318 DERA "Putative deoxyribose-pho 0.929 0.625 0.412 2.9e-32
ZFIN|ZDB-GENE-041010-200318 dera "2-deoxyribose-5-phosphat 0.929 0.625 0.388 4.7e-32
UNIPROTKB|F1PPB6318 DERA "Uncharacterized protein" 0.929 0.625 0.412 9.8e-32
UNIPROTKB|F1NT21318 DERA "Uncharacterized protein" 0.728 0.490 0.494 2.3e-30
UNIPROTKB|F1SQY2318 DERA "Uncharacterized protein" 0.915 0.616 0.394 3e-30
MGI|MGI:1913762318 Dera "2-deoxyribose-5-phosphat 0.929 0.625 0.393 7.9e-30
UNIPROTKB|E9PML7236 DERA "Putative deoxyribose-pho 0.906 0.822 0.398 1e-29
UNIPROTKB|Q3T0V9318 DERA "Putative deoxyribose-pho 0.971 0.654 0.384 2.1e-29
RGD|1589836308 Dera "deoxyribose-phosphate al 0.925 0.642 0.398 5.6e-29
UNIPROTKB|E9PMH9163 DERA "Putative deoxyribose-pho 0.467 0.613 0.574 5.9e-25
UNIPROTKB|Q9Y315 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 2.9e-32, P = 2.9e-32
 Identities = 87/211 (41%), Positives = 112/211 (53%)

Query:    10 DFKWVHDIQINTKYLEDLTRQFEAVDXXXXXXXXXXXXXXXEFIDLTTLSGDDTEAVVET 69
             D  W+  IQ+N   +     Q +A                  FIDLTTLSGDDT + ++ 
Sbjct:    11 DLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQR 70

Query:    70 LTLKAIQPLSEELKEKVL---RGFVST--------VWHGSDNLKTKLVYQPCLSQPAGFP 118
             L  KA  P+ E+L + +    +G  +         V      LK      P  S  AGFP
Sbjct:    71 LCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFP 130

Query:   119 SGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKT 178
             +GQ  L+TRL EI L  +    E+D+VI RSLVL  QW  L+ E++Q ++ CGE  H+KT
Sbjct:   131 AGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGEA-HLKT 189

Query:   179 ILAVGELKTSENIYCASMTAMFAGSDFIKTS 209
             ILA GEL T  N+Y ASM AM AGSDFIKTS
Sbjct:   190 ILATGELGTLTNVYKASMIAMMAGSDFIKTS 220
GO:0005737 "cytoplasm" evidence=IEA
GO:0009264 "deoxyribonucleotide catabolic process" evidence=IEA
GO:0046386 "deoxyribose phosphate catabolic process" evidence=IEA
GO:0004139 "deoxyribose-phosphate aldolase activity" evidence=IDA
GO:0046121 "deoxyribonucleoside catabolic process" evidence=IDA
GO:0005575 "cellular_component" evidence=ND
ZFIN|ZDB-GENE-041010-200 dera "2-deoxyribose-5-phosphate aldolase homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPB6 DERA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT21 DERA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQY2 DERA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913762 Dera "2-deoxyribose-5-phosphate aldolase homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E9PML7 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0V9 DERA "Putative deoxyribose-phosphate aldolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1589836 Dera "deoxyribose-phosphate aldolase (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PMH9 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C3LQC2DEOC_VIBCM4, ., 1, ., 2, ., 40.32140.76160.6293yesN/A
Q8EHK4DEOC_SHEON4, ., 1, ., 2, ., 40.30240.73830.6171yesN/A
Q8DBT2DEOC_VIBVU4, ., 1, ., 2, ., 40.31730.76160.6317yesN/A
Q086G0DEOC_SHEFN4, ., 1, ., 2, ., 40.31250.73360.6108yesN/A
A1RH87DEOC_SHESW4, ., 1, ., 2, ., 40.30240.73830.6171yesN/A
B3H1P7DEOC_ACTP74, ., 1, ., 2, ., 40.30430.73360.6085yesN/A
B7VJF8DEOC_VIBSL4, ., 1, ., 2, ., 40.31950.75230.6240yesN/A
Q3T0V9DEOC_BOVIN4, ., 1, ., 2, ., 40.39810.92990.6257yesN/A
A3N123DEOC_ACTP24, ., 1, ., 2, ., 40.30430.73360.6085yesN/A
Q7NRS9DEOC_CHRVO4, ., 1, ., 2, ., 40.31480.73830.6196yesN/A
Q9KPL7DEOC_VIBCH4, ., 1, ., 2, ., 40.32140.76160.6293yesN/A
A5F5S6DEOC_VIBC34, ., 1, ., 2, ., 40.32140.76160.6293yesN/A
Q7MI38DEOC2_VIBVY4, ., 1, ., 2, ., 40.31730.76160.6317yesN/A
Q9Y315DEOC_HUMAN4, ., 1, ., 2, ., 40.42650.92990.6257yesN/A
A4Y9A8DEOC_SHEPC4, ., 1, ., 2, ., 40.30240.73830.6171yesN/A
A8FYQ9DEOC_SHESH4, ., 1, ., 2, ., 40.31900.73830.6147yesN/A
B2VH50DEOC_ERWT94, ., 1, ., 2, ., 40.31810.78030.6447yesN/A
A7MUW7DEOC_VIBHB4, ., 1, ., 2, ., 40.31130.76160.6317yesN/A
A1S474DEOC_SHEAM4, ., 1, ., 2, ., 40.30860.74290.6186yesN/A
B8F671DEOC_HAEPS4, ., 1, ., 2, ., 40.31950.76160.6293yesN/A
Q6LUH4DEOC_PHOPR4, ., 1, ., 2, ., 40.30530.76160.6342yesN/A
Q6A8F1DEOC1_PROAC4, ., 1, ., 2, ., 40.31360.68690.6774yesN/A
Q91YP3DEOC_MOUSE4, ., 1, ., 2, ., 40.40280.92990.6257yesN/A
Q0HXQ4DEOC_SHESR4, ., 1, ., 2, ., 40.30240.73830.6171yesN/A
Q87M22DEOC_VIBPA4, ., 1, ., 2, ., 40.30530.76160.6317yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.20.691
4th Layer4.1.2.40.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
cd00959203 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase 1e-32
COG0274228 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nuc 5e-29
cd00945201 cd00945, Aldolase_Class_I, Class I aldolases 3e-24
PRK05283257 PRK05283, PRK05283, deoxyribose-phosphate aldolase 3e-17
TIGR00126211 TIGR00126, deoC, deoxyribose-phosphate aldolase 4e-13
PRK00507221 PRK00507, PRK00507, deoxyribose-phosphate aldolase 2e-12
pfam01791231 pfam01791, DeoC, DeoC/LacD family aldolase 2e-09
>gnl|CDD|188646 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information 
 Score =  116 bits (293), Expect = 1e-32
 Identities = 48/175 (27%), Positives = 68/175 (38%), Gaps = 38/175 (21%)

Query: 49  IIEFIDLTTLSGDDTEAVVETLTLKAIQP--------------LSEELKEKVLRGFVSTV 94
           +   ID T L  D TE  +  L  +A +                 E LK   ++  V TV
Sbjct: 1   LASLIDHTLLKPDATEEDIRKLCDEAKEYGFAAVCVNPCFVPLAREALKGSGVK--VCTV 58

Query: 95  WHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNN 154
                                GFP G    E ++ E         DE+D+VI    + + 
Sbjct: 59  --------------------IGFPLGATTTEVKVAEAREAIADGADEIDMVINIGALKSG 98

Query: 155 QWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTS 209
            +  ++ E+  + E CG    +K IL  G L T E I  A   A+ AG+DFIKTS
Sbjct: 99  DYEAVYEEIAAVVEACGGA-PLKVILETGLL-TDEEIIKACEIAIEAGADFIKTS 151

2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family. DERA belongs to the class I aldolases and catalyzes a reversible aldol reaction between acetaldehyde and glyceraldehyde 3-phosphate to generate 2-deoxyribose 5-phosphate. DERA is unique in catalyzing the aldol reaction between two aldehydes, and its broad substrate specificity confers considerable utility as a biocatalyst, offering an environmentally benign alternative to chiral transition metal catalysis of the asymmetric aldol reaction. Length = 203
>gnl|CDD|223351 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|188634 cd00945, Aldolase_Class_I, Class I aldolases Back     alignment and domain information
>gnl|CDD|235387 PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|232838 TIGR00126, deoC, deoxyribose-phosphate aldolase Back     alignment and domain information
>gnl|CDD|234784 PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|216703 pfam01791, DeoC, DeoC/LacD family aldolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 100.0
KOG3981|consensus326 100.0
PRK05283257 deoxyribose-phosphate aldolase; Provisional 100.0
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 100.0
PRK00507221 deoxyribose-phosphate aldolase; Provisional 100.0
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 100.0
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 100.0
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 99.89
PRK07226267 fructose-bisphosphate aldolase; Provisional 99.88
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 99.82
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 99.48
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 97.36
PRK08227264 autoinducer 2 aldolase; Validated 97.15
PRK09250 348 fructose-bisphosphate aldolase; Provisional 96.82
PRK06852304 aldolase; Validated 96.34
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 95.95
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 95.9
PRK02227 238 hypothetical protein; Provisional 95.66
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 95.38
PRK12858 340 tagatose 1,6-diphosphate aldolase; Reviewed 95.18
PF04476 235 DUF556: Protein of unknown function (DUF556); Inte 94.56
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 94.24
COG1891 235 Uncharacterized protein conserved in archaea [Func 94.24
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 93.78
cd02930 353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 93.07
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 92.48
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 92.05
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 91.46
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 91.41
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 91.35
cd07945 280 DRE_TIM_CMS Leptospira interrogans citramalate syn 91.08
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 90.93
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 90.9
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 90.86
COG0042 323 tRNA-dihydrouridine synthase [Translation, ribosom 90.79
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 90.7
PRK07259 301 dihydroorotate dehydrogenase 1B; Reviewed 90.4
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 90.34
cd04740 296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 89.4
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 89.27
PLN02746 347 hydroxymethylglutaryl-CoA lyase 89.21
TIGR00742 318 yjbN tRNA dihydrouridine synthase A. Members of th 89.2
PRK10550 312 tRNA-dihydrouridine synthase C; Provisional 89.05
PF00809 210 Pterin_bind: Pterin binding enzyme This Prosite en 88.98
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 88.82
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 88.72
PRK05692 287 hydroxymethylglutaryl-CoA lyase; Provisional 88.41
PRK10415 321 tRNA-dihydrouridine synthase B; Provisional 88.22
cd00954 288 NAL N-Acetylneuraminic acid aldolase, also called 88.07
TIGR01496 257 DHPS dihydropteroate synthase. This model represen 87.17
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 87.04
COG0502 335 BioB Biotin synthase and related enzymes [Coenzyme 87.03
cd04747 361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 86.83
PLN02417 280 dihydrodipicolinate synthase 86.83
PLN02746347 hydroxymethylglutaryl-CoA lyase 86.75
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 86.62
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 86.47
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 86.31
cd00945 201 Aldolase_Class_I Class I aldolases. The class I al 86.07
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 85.75
TIGR00737 319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 85.69
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 85.53
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 85.34
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 85.14
TIGR00674 285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 85.03
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 84.7
PLN02274 505 inosine-5'-monophosphate dehydrogenase 84.69
PRK11815 333 tRNA-dihydrouridine synthase A; Provisional 84.58
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 84.35
cd00950 284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 84.21
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 84.0
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 83.96
TIGR00284 499 dihydropteroate synthase-related protein. This pro 83.81
PRK09389 488 (R)-citramalate synthase; Provisional 83.71
PRK05481 289 lipoyl synthase; Provisional 83.39
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 83.02
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 83.01
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 82.82
cd07947 279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 82.8
PRK12928 290 lipoyl synthase; Provisional 82.74
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 82.54
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 82.51
PF01207 309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 82.49
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 82.43
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synth 82.02
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 81.62
PRK13523337 NADPH dehydrogenase NamA; Provisional 81.53
TIGR01037 300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 81.33
cd04739 325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 81.14
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 81.01
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 80.95
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 80.62
cd07937 275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 80.57
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 80.51
cd03316 357 MR_like Mandelate racemase (MR)-like subfamily of 80.5
PRK05437 352 isopentenyl pyrophosphate isomerase; Provisional 80.47
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 80.29
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 80.11
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-57  Score=389.23  Aligned_cols=157  Identities=27%  Similarity=0.354  Sum_probs=148.8

Q ss_pred             HHhhhhhcccCCCCCCCHHHHHHHHHHhhcc-CchhhhccccccCcccHHHHHHhhhcCCC-CCCeEEEecCCCCCCCCH
Q psy965           47 LKIIEFIDLTTLSGDDTEAVVETLTLKAIQP-LSEELKEKVLRGFVSTVWHGSDNLKTKLV-YQPCLSQPAGFPSGQYLL  124 (214)
Q Consensus        47 ~~~~~~ID~TlL~~~~T~~~I~~lc~eA~~~-f~~~~~~~~~cv~P~~V~~a~~~L~~~gs-~v~vatV~igFP~G~~~~  124 (214)
                      .+++++||||+|+|++|+++|.+||++|.+| |.      .+|+||+||+.|++.|+  |+ .++||+| +|||+|.+++
T Consensus         6 ~~~~~~IDhT~Lk~~~T~~~I~~l~~eA~~~~f~------avCV~P~~V~~A~~~l~--g~~~~~v~tV-igFP~G~~~t   76 (228)
T COG0274           6 MQLAKLIDHTLLKPDATEEDIARLCAEAKEYGFA------AVCVNPSYVPLAKEALK--GSTVVRVCTV-IGFPLGANTT   76 (228)
T ss_pred             HHHHHHhhhhcCCCCCCHHHHHHHHHHHHhhCce------EEEECcchHHHHHHHhc--cCCCeEEEEe-cCCCCCCChH
Confidence            5789999999999999999999999999986 55      67999999999999999  65 4569999 8999999999


Q ss_pred             HHHHHHHHHHHHCCCCEEEEecChhHhhcCChhHHHHHHHHHHHHhcCCceEEEEEeccCCCCHHHHHHHHHHHHHcCCC
Q psy965          125 ETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENIYCASMTAMFAGSD  204 (214)
Q Consensus       125 ~~K~~E~~~Ai~~GAdEID~Vin~~~l~sg~~~~v~~Ei~~v~~a~~~~~~lKvIlEt~~L~t~e~i~~A~~ia~~aGaD  204 (214)
                      ++|++|+++|+++||||||||||+|++|+|+|++|++||++++++|++..+||||||||+| +++++++||++|+++|||
T Consensus        77 ~~K~~Ea~~ai~~GAdEiDmVinig~~k~g~~~~V~~eI~~v~~a~~~~~~lKVIlEt~~L-t~ee~~~A~~i~~~aGAd  155 (228)
T COG0274          77 AVKAAEAREAIENGADEIDMVINIGALKSGNWEAVEREIRAVVEACADAVVLKVILETGLL-TDEEKRKACEIAIEAGAD  155 (228)
T ss_pred             HHHHHHHHHHHHcCCCeeeeeeeHHHHhcCCHHHHHHHHHHHHHHhCCCceEEEEEecccc-CHHHHHHHHHHHHHhCCC
Confidence            9999999999999999999999999999999999999999999999974599999999999 779999999999999999


Q ss_pred             EEEcCCCCC
Q psy965          205 FIKTSGSIQ  213 (214)
Q Consensus       205 FIKTSTGf~  213 (214)
                      ||||||||.
T Consensus       156 FVKTSTGf~  164 (228)
T COG0274         156 FVKTSTGFS  164 (228)
T ss_pred             EEEcCCCCC
Confidence            999999996

>KOG3981|consensus Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1ktn_A250 Structural Genomics, Protein Ec1535 Length = 250 7e-07
1jcj_A260 Observation Of Covalent Intermediates In An Enzyme 8e-07
1jcl_A260 Observation Of Covalent Intermediates In An Enzyme 8e-07
2a4a_A281 Deoxyribose-Phosphate Aldolase From P. Yoelii Lengt 1e-05
3r12_A260 Crystal Structure Of A Deoxyribose-Phosphate Aldola 1e-05
3ng3_A227 Crystal Structure Of Deoxyribose Phosphate Aldolase 2e-04
1j2w_A220 Tetrameric Structure Of Aldolase From Thermus Therm 5e-04
3ngj_A239 Crystal Structure Of A Putative Deoxyribose-Phospha 9e-04
>pdb|1KTN|A Chain A, Structural Genomics, Protein Ec1535 Length = 250 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 4/160 (2%)
Query: 51  EFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLVYQPC 110
           + +DLTTL+ DDT+  V  L  +A  P+       +   F+         LK +   +  
Sbjct: 13  KLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARK---TLKEQGTPEIR 69
Query: 111 LSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQ-RSLVLNNQWPELFSEVKQMKEK 169
           ++    FP G   ++  L E         DEVD+V   R+L+  N+           +  
Sbjct: 70  IATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEAC 129
Query: 170 CGEKIHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTS 209
               + +K I+  GELK    I  AS  ++ AG+DFIKTS
Sbjct: 130 AAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTS 169
>pdb|1JCJ|A Chain A, Observation Of Covalent Intermediates In An Enzyme Mechanism At Atomic Resolution Length = 260 Back     alignment and structure
>pdb|1JCL|A Chain A, Observation Of Covalent Intermediates In An Enzyme Mechanism At Atomic Resolution Length = 260 Back     alignment and structure
>pdb|2A4A|A Chain A, Deoxyribose-Phosphate Aldolase From P. Yoelii Length = 281 Back     alignment and structure
>pdb|3R12|A Chain A, Crystal Structure Of A Deoxyribose-Phosphate Aldolase (Tm_1559) From Thermotoga Maritima At 1.75 A Resolution Length = 260 Back     alignment and structure
>pdb|3NG3|A Chain A, Crystal Structure Of Deoxyribose Phosphate Aldolase From Mycobacterium Avium 104 In A Schiff Base With An Unknown Aldehyde Length = 227 Back     alignment and structure
>pdb|1J2W|A Chain A, Tetrameric Structure Of Aldolase From Thermus Thermophilus Hb8 Length = 220 Back     alignment and structure
>pdb|3NGJ|A Chain A, Crystal Structure Of A Putative Deoxyribose-Phosphate Aldolase From Entamoeba Histolytica Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 3e-41
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 2e-37
4eiv_A 297 Deoxyribose-phosphate aldolase; chemotherapy, brai 1e-36
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 2e-31
3oa3_A288 Aldolase; structural genomics, seattle structural 1e-28
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 1e-28
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 1e-26
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 2e-26
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 2e-25
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 4e-25
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 6e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Length = 260 Back     alignment and structure
 Score =  139 bits (353), Expect = 3e-41
 Identities = 52/185 (28%), Positives = 76/185 (41%), Gaps = 38/185 (20%)

Query: 43  KSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQPL----------------SEELKEKV 86
           K+  L+ ++ +DLTTL+ DDT+  V  L  +A  P+                 + LKE+ 
Sbjct: 6   KASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQG 65

Query: 87  LRGF-VSTVWHGSDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIV 145
                ++TV                      FP G   ++  L E         DEVD+V
Sbjct: 66  TPEIRIATV--------------------TNFPHGNDDIDIALAETRAAIAYGADEVDVV 105

Query: 146 IQRSLVLNNQWPELFSEVKQMKEKCGEK-IHMKTILAVGELKTSENIYCASMTAMFAGSD 204
                ++       F  VK  KE C    + +K I+  GELK    I  AS  ++ AG+D
Sbjct: 106 FPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGAD 165

Query: 205 FIKTS 209
           FIKTS
Sbjct: 166 FIKTS 170
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Length = 281 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Length = 297 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} PDB: 1o0y_A* 3r13_A* Length = 260 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Length = 288 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Length = 231 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Length = 239 Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Length = 226 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Length = 225 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Length = 220 Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Length = 234 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
4eiv_A 297 Deoxyribose-phosphate aldolase; chemotherapy, brai 100.0
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 100.0
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 100.0
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 100.0
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 100.0
3oa3_A288 Aldolase; structural genomics, seattle structural 100.0
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 100.0
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 100.0
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 100.0
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 100.0
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 100.0
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 99.92
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 99.47
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 99.18
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 97.88
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.85
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 97.34
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 97.31
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 97.06
1to3_A 304 Putative aldolase YIHT; beta-alpha barrel, structu 96.34
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 95.5
1jub_A 311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.29
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 95.25
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.43
2e6f_A 314 Dihydroorotate dehydrogenase; chagas disease, pyri 94.01
1ydn_A 295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 93.89
3iv3_A 332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 93.21
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 92.72
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 91.44
2ftp_A 302 Hydroxymethylglutaryl-COA lyase; structural genomi 90.44
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 90.42
1ep3_A 311 Dihydroorotate dehydrogenase B (PYRD subunit); het 90.29
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 89.96
1rd5_A 262 Tryptophan synthase alpha chain, chloroplast; hydr 89.74
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 89.68
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 89.67
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 88.85
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 88.58
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 88.49
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 88.29
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 88.11
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 88.1
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 88.03
2cw6_A 298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 87.85
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 87.42
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 87.36
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.35
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 86.98
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 86.95
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 86.76
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 86.6
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 86.41
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 86.29
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 86.25
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 86.12
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 86.04
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 85.98
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 85.93
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 85.77
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 85.76
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 85.55
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 85.51
2yr1_A 257 3-dehydroquinate dehydratase; amino acid biosynthe 85.44
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 85.34
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 85.28
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 85.28
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 85.1
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 85.07
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 85.04
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 85.03
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 85.01
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 84.98
3zwt_A 367 Dihydroorotate dehydrogenase (quinone), mitochond; 84.76
3ble_A 337 Citramalate synthase from leptospira interrogans; 84.6
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 84.57
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 84.42
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 84.34
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 84.32
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 83.81
3ozy_A 389 Putative mandelate racemase; beta-alpha barrel, en 83.78
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 83.39
1ydo_A 307 HMG-COA lyase; TIM-barrel protein, structural geno 83.17
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 82.79
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 82.38
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 82.32
4ef8_A 354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 82.29
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 82.03
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 81.84
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 81.59
1xi3_A 215 Thiamine phosphate pyrophosphorylase; structural g 81.52
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 81.35
1eye_A 280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 81.01
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 80.87
2h9a_B 310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 80.61
3ewb_X 293 2-isopropylmalate synthase; LEUA, structural genom 80.58
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
Probab=100.00  E-value=2e-55  Score=390.62  Aligned_cols=166  Identities=20%  Similarity=0.232  Sum_probs=154.6

Q ss_pred             HhHHHHHHHhhhhhcccCCCCCCCHHHHHHHHHHhh-cc-CchhhhccccccCcccHHHHHHhhhcCC---CCCCeEEEe
Q psy965           40 KNKKSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAI-QP-LSEELKEKVLRGFVSTVWHGSDNLKTKL---VYQPCLSQP  114 (214)
Q Consensus        40 ~~~~~~l~~~~~~ID~TlL~~~~T~~~I~~lc~eA~-~~-f~~~~~~~~~cv~P~~V~~a~~~L~~~g---s~v~vatV~  114 (214)
                      -.|..|.++++++||||+|+|++|+++|+++|++|+ +| |.      .+|+||+||+.+++.|++.+   ++++||+| 
T Consensus        17 ~~~~~~~~~la~~IDhTlL~p~~T~e~I~~lc~eA~~~~~~a------aVCV~P~~V~~a~~~L~~~~~~~s~v~V~tV-   89 (297)
T 4eiv_A           17 IYKQFTSRTLLNFFEVAALTDGETNESVAAVCKIAAKDPAIV------GVSVRPAFVRFIRQELVKSAPEVAGIKVCAA-   89 (297)
T ss_dssp             HHHHHHHHHHHTTEEEEECSTTCCHHHHHHHHHHHHSSSCCS------EEEECGGGHHHHHHTGGGTCGGGGGSEEEEE-
T ss_pred             ehhhhhHHHHHHhcCccCCCCCCCHHHHHHHHHHHHhhcCcE------EEEECHHHHHHHHHHhcccCcCCCCCeEEEE-
Confidence            346788899999999999999999999999999999 55 54      67999999999999998322   68999999 


Q ss_pred             cCCCCCCCCHHHHHHHHHHHHHCCCCEEEEecChhHhhc---CChhHHHHHHHHHHHHhcCCceEEEEEeccCCCCHHHH
Q psy965          115 AGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLN---NQWPELFSEVKQMKEKCGEKIHMKTILAVGELKTSENI  191 (214)
Q Consensus       115 igFP~G~~~~~~K~~E~~~Ai~~GAdEID~Vin~~~l~s---g~~~~v~~Ei~~v~~a~~~~~~lKvIlEt~~L~t~e~i  191 (214)
                      +|||+|++++++|++|+++|+++||+|||||||++++++   |+|+++++||++++++|++ .+||||||||+|+++|+|
T Consensus        90 igFP~G~~~~e~K~~Ea~~Av~~GAdEIDmVinig~lk~~~~g~~~~V~~eI~~v~~a~~~-~~lKVIlEt~~Lt~~e~i  168 (297)
T 4eiv_A           90 VNFPEGTGTPDTVSLEAVGALKDGADEIECLIDWRRMNENVADGESRIRLLVSEVKKVVGP-KTLKVVLSGGELQGGDII  168 (297)
T ss_dssp             ESTTTCCCCHHHHHHHHHHHHHTTCSEEEEECCTHHHHHCHHHHHHHHHHHHHHHHHHHTT-SEEEEECCSSCCCCHHHH
T ss_pred             ecCCCCCCCHHHHHHHHHHHHHcCCCEEEeeeeHHHHhcccCCcHHHHHHHHHHHHHHhcC-CceEEEEecccCCcHHHH
Confidence            799999999999999999999999999999999999999   9999999999999999986 899999999999666668


Q ss_pred             HHHHHHHHHcCCCEEEcCCCCC
Q psy965          192 YCASMTAMFAGSDFIKTSGSIQ  213 (214)
Q Consensus       192 ~~A~~ia~~aGaDFIKTSTGf~  213 (214)
                      ++||++|+++|||||||||||.
T Consensus       169 ~~A~~ia~~AGADFVKTSTGf~  190 (297)
T 4eiv_A          169 SRAAVAALEGGADFLQTSSGLG  190 (297)
T ss_dssp             HHHHHHHHHHTCSEEECCCSSS
T ss_pred             HHHHHHHHHhCCCEEEcCCCCC
Confidence            9999999999999999999995
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1p1xa_250 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 7e-29
d2a4aa1256 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldol 2e-23
d1o0ya_251 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 2e-22
d1mzha_225 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 6e-22
d1ub3a_211 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 2e-19
d1vcva1226 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase 3e-18
d1n7ka_234 c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC 1e-15
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Deoxyribose-phosphate aldolase DeoC
species: Escherichia coli [TaxId: 562]

 Score =  106 bits (265), Expect = 7e-29
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 4/166 (2%)

Query: 47  LKIIEFIDLTTLSGDDTEAVVETLTLKAIQPLSEELKEKVLRGFVSTVWHGSDNLKTKLV 106
           L+ ++ +DLTTL+ DDT+  V  L  +A  P+       +   F+         LK +  
Sbjct: 9   LRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIA---RKTLKEQGT 65

Query: 107 YQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQM 166
            +  ++    FP G   ++  L E         DEVD+V     ++       F  VK  
Sbjct: 66  PEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKAC 125

Query: 167 KEKCGEK-IHMKTILAVGELKTSENIYCASMTAMFAGSDFIKTSGS 211
           KE C    + +K I+  GELK    I  AS  ++ AG+DFIKTS  
Sbjct: 126 KEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTG 171
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 256 Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Length = 225 Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Length = 211 Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 226 Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 234 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 100.0
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 100.0
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 100.0
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 100.0
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 100.0
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 100.0
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 100.0
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 95.75
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 89.64
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 89.09
d1gqna_ 252 Type I 3-dehydroquinate dehydratase {Salmonella ty 85.24
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 85.23
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 84.97
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 84.07
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 83.65
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 83.34
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 83.22
d1hl2a_ 295 N-acetylneuraminate lyase {Escherichia coli [TaxId 81.33
d1vhna_ 305 Putative flavin oxidoreducatase TM0096 {Thermotoga 81.3
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Deoxyribose-phosphate aldolase DeoC
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=9.5e-56  Score=384.46  Aligned_cols=176  Identities=20%  Similarity=0.276  Sum_probs=162.1

Q ss_pred             HHHHHHHHhhhhhhhhhHhH----HHHHHHhhhhhcccCCCCCCCHHHHHHHHHHhhcc-CchhhhccccccCcccHHHH
Q psy965           23 YLEDLTRQFEAVDLSRIKNK----KSLLLKIIEFIDLTTLSGDDTEAVVETLTLKAIQP-LSEELKEKVLRGFVSTVWHG   97 (214)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~~----~~~l~~~~~~ID~TlL~~~~T~~~I~~lc~eA~~~-f~~~~~~~~~cv~P~~V~~a   97 (214)
                      .+++|.+.+..   ++ +.+    ..++.+++++||||+|+|++|+++|+++|++|+++ |+      .+||||+||+.+
T Consensus         9 ~~~~~~~~~~~---~~-~~~~~~~~~~~~~la~~ID~TlL~p~~t~e~i~~lc~~A~~~~~a------aVcV~P~~v~~a   78 (251)
T d1o0ya_           9 RIEEAVAKYRE---FY-EFKPVRESAGIEDVKSAIEHTNLKPFATPDDIKKLCLEARENRFH------GVCVNPCYVKLA   78 (251)
T ss_dssp             HHHHHHHHHHH---HC-CCCCSSSCCCHHHHHHHEEEEECCTTCCHHHHHHHHHHHHHHTCS------EEEECGGGHHHH
T ss_pred             HHHHHHHHhhh---cc-cccchhhhhCHHHHHHhccccCCCCCCCHHHHHHHHHHHhhcCce------EEEECHHHHHHH
Confidence            56666666654   22 222    67889999999999999999999999999999975 65      679999999999


Q ss_pred             HHhhhcCCCCCCeEEEecCCCCCCCCHHHHHHHHHHHHHCCCCEEEEecChhHhhcCChhHHHHHHHHHHHHhcCCceEE
Q psy965           98 SDNLKTKLVYQPCLSQPAGFPSGQYLLETRLHEIELLAKQKVDEVDIVIQRSLVLNNQWPELFSEVKQMKEKCGEKIHMK  177 (214)
Q Consensus        98 ~~~L~~~gs~v~vatV~igFP~G~~~~~~K~~E~~~Ai~~GAdEID~Vin~~~l~sg~~~~v~~Ei~~v~~a~~~~~~lK  177 (214)
                      ++.|+  |+++++|+| +|||+|+++++.|++|+++|+++||||||||+|++++++|+|+++++||++++++|++ .++|
T Consensus        79 ~~~L~--gs~v~v~tV-igFP~G~~~~~~K~~Ea~~Ai~~GAdEID~Vin~~~l~~g~~~~v~~ei~~v~~~~~~-~~lK  154 (251)
T d1o0ya_          79 REELE--GTDVKVVTV-VGFPLGANETRTKAHEAIFAVESGADEIDMVINVGMLKAKEWEYVYEDIRSVVESVKG-KVVK  154 (251)
T ss_dssp             HHHHT--TSCCEEEEE-ESTTTCCSCHHHHHHHHHHHHHHTCSEEEEECCHHHHHTTCHHHHHHHHHHHHHHTTT-SEEE
T ss_pred             HHHhc--CCCceEEee-ccCCCCCCcHHHHHHHHHHHHHcCCceEEEEeccchhhcCCHHHHHHHHHHHHHHhcc-ccee
Confidence            99998  899999999 7999999999999999999999999999999999999999999999999999999986 8999


Q ss_pred             EEEeccCCCCHHHHHHHHHHHHHcCCCEEEcCCCCC
Q psy965          178 TILAVGELKTSENIYCASMTAMFAGSDFIKTSGSIQ  213 (214)
Q Consensus       178 vIlEt~~L~t~e~i~~A~~ia~~aGaDFIKTSTGf~  213 (214)
                      |||||++| +++++.+||++|+++|||||||||||.
T Consensus       155 VIlEt~~L-~~~e~~~a~~ia~~aGadfvKTSTGf~  189 (251)
T d1o0ya_         155 VIIETCYL-DTEEKIAACVISKLAGAHFVKTSTGFG  189 (251)
T ss_dssp             EECCGGGC-CHHHHHHHHHHHHHTTCSEEECCCSSS
T ss_pred             eeeccccc-CcHHHHHHHHHHHHhCcceeeccCCCC
Confidence            99999999 778999999999999999999999995
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure