Psyllid ID: psy9718


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70
MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAATDPHVLKSFK
cHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccc
MEKRRRARINNCLNELKTLILDAMkkdparhsklekADILEMTVKHLENMQRQQLALsaatdphvlksfk
mekrrrarinnCLNELKTLildamkkdparhSKLEKADILEMTVKHLENMQRQQlalsaatdphvlksfk
MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAATDPHVLKSFK
*********NNCLNELKTLILD************************************************
**KRRRARINNCLNELKTLIL****************DILEMTVKHL***********************
MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAATDPHVLKSFK
****RRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLAL*************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAATDPHVLKSFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query70 2.2.26 [Sep-21-2011]
Q26263 435 Protein deadpan OS=Drosop yes N/A 1.0 0.160 0.757 4e-25
Q04666 281 Transcription factor HES- yes N/A 1.0 0.249 0.7 3e-22
P35428 282 Transcription factor HES- yes N/A 1.0 0.248 0.7 5e-22
Q6IRB2 267 Transcription factor HES- N/A N/A 1.0 0.262 0.7 8e-22
P14003 337 Protein hairy OS=Drosophi no N/A 1.0 0.207 0.785 1e-21
P29303 378 Protein hairy OS=Drosophi N/A N/A 1.0 0.185 0.785 1e-21
Q3ZBG4 280 Transcription factor HES- yes N/A 1.0 0.25 0.7 1e-21
Q14469 280 Transcription factor HES- yes N/A 1.0 0.25 0.7 2e-21
Q8AVU4 267 Transcription factor HES- N/A N/A 1.0 0.262 0.7 2e-21
O57337 290 Transcription factor HES- no N/A 1.0 0.241 0.685 2e-21
>sp|Q26263|DPN_DROME Protein deadpan OS=Drosophila melanogaster GN=dpn PE=1 SV=2 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 53/70 (75%), Positives = 65/70 (92%)

Query: 1   MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA 60
           MEKRRRARIN+CLNELK+LIL+AMKKDPARH+KLEKADILEMTVKHL+++QRQQL ++  
Sbjct: 48  MEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQ 107

Query: 61  TDPHVLKSFK 70
           +DP V++ FK
Sbjct: 108 SDPSVVQKFK 117




Transcriptional repressor of genes that require a bHLH protein for their transcription. Likely to be involved in the functional rather than the morphological differentiation of neurons. Loss of DPN function results in weak motor activity, lethargic behavior, and death. Implicated in sex determination as Groucho-DPN complex act directly to repress SXL transcription.
Drosophila melanogaster (taxid: 7227)
>sp|Q04666|HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus GN=Hes1 PE=1 SV=1 Back     alignment and function description
>sp|P35428|HES1_MOUSE Transcription factor HES-1 OS=Mus musculus GN=Hes1 PE=1 SV=1 Back     alignment and function description
>sp|Q6IRB2|HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis GN=hes1-a PE=1 SV=1 Back     alignment and function description
>sp|P14003|HAIR_DROME Protein hairy OS=Drosophila melanogaster GN=h PE=1 SV=2 Back     alignment and function description
>sp|P29303|HAIR_DROVI Protein hairy OS=Drosophila virilis GN=h PE=2 SV=1 Back     alignment and function description
>sp|Q3ZBG4|HES1_BOVIN Transcription factor HES-1 OS=Bos taurus GN=HES1 PE=2 SV=1 Back     alignment and function description
>sp|Q14469|HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens GN=HES1 PE=1 SV=1 Back     alignment and function description
>sp|Q8AVU4|HES1B_XENLA Transcription factor HES-1-B OS=Xenopus laevis GN=hes1-b PE=2 SV=1 Back     alignment and function description
>sp|O57337|HES1_CHICK Transcription factor HES-1 OS=Gallus gallus GN=HES1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
208972121 410 Hairy protein [Periplaneta americana] 1.0 0.170 0.885 3e-29
170037964 345 hairy [Culex quinquefasciatus] gi|167881 1.0 0.202 0.871 1e-28
158296333 374 AGAP006699-PA [Anopheles gambiae str. PE 1.0 0.187 0.885 1e-28
157110092 343 hairy protein [Aedes aegypti] gi|1571309 1.0 0.204 0.885 1e-28
156550861 376 PREDICTED: protein hairy-like [Nasonia v 1.0 0.186 0.842 8e-28
166796106 249 hairy [Tribolium castaneum] gi|20269075| 1.0 0.281 0.857 1e-27
270014144 249 hypothetical protein TcasGA2_TC012851 [T 1.0 0.281 0.857 1e-27
383855344 359 PREDICTED: protein hairy-like [Megachile 1.0 0.194 0.871 2e-27
110762302 363 PREDICTED: protein hairy [Apis mellifera 1.0 0.192 0.871 3e-27
194022542 255 hairy [Tribolium confusum] 1.0 0.274 0.857 3e-27
>gi|208972121|gb|ACI32659.1| Hairy protein [Periplaneta americana] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 62/70 (88%), Positives = 67/70 (95%)

Query: 1   MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA 60
           MEKRRRARINNCLNEL+TLILDAMKKDPARHSKLEKADILEMTVKHLEN+QRQQ+A+SAA
Sbjct: 58  MEKRRRARINNCLNELRTLILDAMKKDPARHSKLEKADILEMTVKHLENLQRQQVAMSAA 117

Query: 61  TDPHVLKSFK 70
           TDP VL  F+
Sbjct: 118 TDPSVLNKFR 127




Source: Periplaneta americana

Species: Periplaneta americana

Genus: Periplaneta

Family: Blattidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170037964|ref|XP_001846824.1| hairy [Culex quinquefasciatus] gi|167881356|gb|EDS44739.1| hairy [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158296333|ref|XP_316733.3| AGAP006699-PA [Anopheles gambiae str. PEST] gi|157016460|gb|EAA11851.3| AGAP006699-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157110092|ref|XP_001650948.1| hairy protein [Aedes aegypti] gi|157130964|ref|XP_001662100.1| hairy protein [Aedes aegypti] gi|108871710|gb|EAT35935.1| AAEL011943-PA [Aedes aegypti] gi|108878802|gb|EAT43027.1| AAEL005480-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|156550861|ref|XP_001601817.1| PREDICTED: protein hairy-like [Nasonia vitripennis] gi|451936070|gb|AGF87125.1| hairy [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|166796106|ref|NP_001107765.1| hairy [Tribolium castaneum] gi|20269075|emb|CAD29886.1| helix-loop-helix transcription factor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270014144|gb|EFA10592.1| hypothetical protein TcasGA2_TC012851 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383855344|ref|XP_003703174.1| PREDICTED: protein hairy-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|110762302|ref|XP_393948.3| PREDICTED: protein hairy [Apis mellifera] Back     alignment and taxonomy information
>gi|194022542|gb|ACF32779.1| hairy [Tribolium confusum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
FB|FBgn0001168 337 h "hairy" [Drosophila melanoga 1.0 0.207 0.785 5.9e-25
FB|FBgn0010109 435 dpn "deadpan" [Drosophila mela 1.0 0.160 0.757 4.5e-24
UNIPROTKB|G3N2D5 304 HES1 "Transcription factor HES 1.0 0.230 0.7 1.9e-21
UNIPROTKB|Q3ZBG4 280 HES1 "Transcription factor HES 1.0 0.25 0.7 1.9e-21
UNIPROTKB|Q14469 280 HES1 "Transcription factor HES 1.0 0.25 0.7 1.9e-21
UNIPROTKB|I3LM61 280 HES1 "Uncharacterized protein" 1.0 0.25 0.7 1.9e-21
MGI|MGI:104853 282 Hes1 "hairy and enhancer of sp 1.0 0.248 0.7 1.9e-21
RGD|62081 281 Hes1 "hairy and enhancer of sp 1.0 0.249 0.7 1.9e-21
UNIPROTKB|Q6IRB2 267 hes1-a "Transcription factor H 1.0 0.262 0.7 2.4e-21
UNIPROTKB|Q5PPM5 267 hes1 "Transcription factor HES 1.0 0.262 0.7 3e-21
FB|FBgn0001168 h "hairy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 5.9e-25, P = 5.9e-25
 Identities = 55/70 (78%), Positives = 60/70 (85%)

Query:     1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA 60
             MEKRRRARINNCLNELKTLILDA KKDPARHSKLEKADILE TVKHL+ +QRQQ A+  A
Sbjct:    39 MEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQA 98

Query:    61 TDPHVLKSFK 70
              DP ++  FK
Sbjct:    99 ADPKIVNKFK 108




GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA;TAS
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=NAS;IMP;IDA;TAS;IPI
GO:0070888 "E-box binding" evidence=IDA
GO:0000978 "RNA polymerase II core promoter proximal region sequence-specific DNA binding" evidence=IDA
GO:0001078 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription" evidence=IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0008134 "transcription factor binding" evidence=IPI
GO:0005634 "nucleus" evidence=NAS
GO:0008407 "chaeta morphogenesis" evidence=NAS
GO:0007366 "periodic partitioning by pair rule gene" evidence=NAS;TAS
GO:0007460 "R8 cell fate commitment" evidence=NAS
GO:0007435 "salivary gland morphogenesis" evidence=IGI;IMP;TAS
GO:0000902 "cell morphogenesis" evidence=IMP
GO:0035239 "tube morphogenesis" evidence=IMP
GO:0007431 "salivary gland development" evidence=TAS
GO:0016044 "cellular membrane organization" evidence=TAS
GO:0007399 "nervous system development" evidence=TAS
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0035289 "posterior head segmentation" evidence=TAS
GO:0035290 "trunk segmentation" evidence=TAS
GO:0007424 "open tracheal system development" evidence=IMP
GO:0031323 "regulation of cellular metabolic process" evidence=IMP
GO:0001666 "response to hypoxia" evidence=IMP
FB|FBgn0010109 dpn "deadpan" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3N2D5 HES1 "Transcription factor HES-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBG4 HES1 "Transcription factor HES-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14469 HES1 "Transcription factor HES-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM61 HES1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:104853 Hes1 "hairy and enhancer of split 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|62081 Hes1 "hairy and enhancer of split 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IRB2 hes1-a "Transcription factor HES-1-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PPM5 hes1 "Transcription factor HES-1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3ZBG4HES1_BOVINNo assigned EC number0.71.00.25yesN/A
Q26263DPN_DROMENo assigned EC number0.75711.00.1609yesN/A
P35428HES1_MOUSENo assigned EC number0.71.00.2482yesN/A
Q04666HES1_RATNo assigned EC number0.71.00.2491yesN/A
Q14469HES1_HUMANNo assigned EC number0.71.00.25yesN/A
Q5PPM5HES1_XENTRNo assigned EC number0.71.00.2621yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 3e-09
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 2e-08
smart0035353 smart00353, HLH, helix loop helix domain 6e-08
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 47.1 bits (113), Expect = 3e-09
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 6/51 (11%)

Query: 1  MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQ 51
           E+RRR RIN+   EL+ L+          + KL KA+IL + +++++++Q
Sbjct: 8  RERRRRDRINDAFEELRELLP------TPPNKKLSKAEILRLAIEYIKHLQ 52


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 70
KOG4304|consensus 250 99.91
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.53
smart0035353 HLH helix loop helix domain. 99.48
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.44
KOG1318|consensus 411 99.1
KOG3561|consensus 803 99.0
KOG1319|consensus229 98.43
KOG3560|consensus 712 98.06
KOG0561|consensus 373 97.88
KOG2483|consensus 232 97.4
KOG4029|consensus228 97.07
KOG3960|consensus284 97.03
PLN0321793 transcription factor ATBS1; Provisional 96.75
KOG2588|consensus 953 96.54
KOG3558|consensus 768 95.27
KOG3910|consensus632 94.0
KOG3559|consensus 598 93.65
KOG4395|consensus285 85.17
>KOG4304|consensus Back     alignment and domain information
Probab=99.91  E-value=3.1e-25  Score=160.02  Aligned_cols=70  Identities=60%  Similarity=0.862  Sum_probs=63.6

Q ss_pred             ChhHHHHHHHHhHHHHHHHHHhhhhcCCcccchhhHHHHHHHHHHHHHHHHHHHhHhhcC-CChhhhhhcC
Q psy9718           1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA-TDPHVLKSFK   70 (70)
Q Consensus         1 iEkrRR~RIN~~l~~Lk~Llp~~~~~~~~~~~KleKA~ILe~TV~ylk~lq~~~~~~~~~-~~~~~~~~~~   70 (70)
                      ||||||+|||+||++||+||++++++++..++|||||||||+||+||+.|++.+..+... .++.+.++|+
T Consensus        39 ~EKkRRaRIN~~L~eLK~Li~e~~~~~~~~~sklEKAdILEltV~hL~~l~~~~~~~~~~~~~~~~~d~f~  109 (250)
T KOG4304|consen   39 LEKKRRARINRCLDELKDLIPEALKKDGQRHSKLEKADILELTVNHLRQLQRSQQAAAQAAPAALPVDSFR  109 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhhhHHHHHHHHHHHHHHHHhcccccccccccccccchhhh
Confidence            799999999999999999999999998888999999999999999999999988776655 6677777774



>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>KOG1319|consensus Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>KOG0561|consensus Back     alignment and domain information
>KOG2483|consensus Back     alignment and domain information
>KOG4029|consensus Back     alignment and domain information
>KOG3960|consensus Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG2588|consensus Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>KOG3910|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>KOG4395|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
1a0a_A63 BHLH, protein (phosphate system positive regulator 2e-08
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 5e-07
4f3l_A 361 Mclock, circadian locomoter output cycles protein 1e-05
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 4e-05
1hlo_A80 Protein (transcription factor MAX); transcriptiona 3e-04
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 6e-04
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
 Score = 44.4 bits (105), Expect = 2e-08
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 2  EKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQ 53
          E+ RR R+   L+EL +LI    K+     +   KA  +E   +++ ++Q+ 
Sbjct: 10 EQARRNRLAVALHELASLIPAEWKQQNVS-AAPSKATTVEAACRYIRHLQQN 60


>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.75
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.74
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.69
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.6
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.57
4ati_A118 MITF, microphthalmia-associated transcription fact 99.55
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.45
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.45
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.35
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.33
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.29
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.28
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.14
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.99
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.97
4ath_A83 MITF, microphthalmia-associated transcription fact 98.94
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.93
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.25
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=6.6e-19  Score=106.54  Aligned_cols=48  Identities=33%  Similarity=0.622  Sum_probs=43.2

Q ss_pred             ChhHHHHHHHHhHHHHHHHHHhhhhcCCcccchhhHHHHHHHHHHHHHHHHH
Q psy9718           1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQR   52 (70)
Q Consensus         1 iEkrRR~RIN~~l~~Lk~Llp~~~~~~~~~~~KleKA~ILe~TV~ylk~lq~   52 (70)
                      +||+||++||.+|++|++|||.+..    ..+|+|||+||++||+||+.|+.
T Consensus        16 ~ERrRR~rIN~~l~eL~~LvP~~~~----~~~KldKasIL~~tV~ylk~l~~   63 (73)
T 4h10_A           16 IEKRRRDKMNSFIDELASLVPTCNA----MSRKLDKLTVLRMAVQHMKTLRG   63 (73)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSHHHHT----CSSCCCHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHHHHHHHcccccc----ccccccHHHHHHHHHHHHHHHhc
Confidence            4999999999999999999999852    24799999999999999999874



>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 70
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 3e-07
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 3e-07
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 0.001
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Usf B/HLH domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.9 bits (96), Expect = 3e-07
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 1  MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQ 53
          +E+RRR +INN + +L  +I D+  +     S   K  IL     +++ +++ 
Sbjct: 12 VERRRRDKINNWIVQLSKIIPDSSMEST--KSGQSKGGILSKASDYIQELRQS 62


>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.68
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.53
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.49
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.43
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.28
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Pho4 B/HLH domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.68  E-value=5.6e-18  Score=97.47  Aligned_cols=53  Identities=26%  Similarity=0.377  Sum_probs=46.3

Q ss_pred             ChhHHHHHHHHhHHHHHHHHHhhhhcCCcccchhhHHHHHHHHHHHHHHHHHHH
Q psy9718           1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQ   54 (70)
Q Consensus         1 iEkrRR~RIN~~l~~Lk~Llp~~~~~~~~~~~KleKA~ILe~TV~ylk~lq~~~   54 (70)
                      +||+||++||.+|++|++|||.+...++ ...|++||+||++||+||+.||+++
T Consensus         9 ~Er~RR~~in~~~~~L~~llP~~~~~~~-~~~k~sKa~iL~~Av~yI~~Lq~~v   61 (63)
T d1a0aa_           9 AEQARRNRLAVALHELASLIPAEWKQQN-VSAAPSKATTVEAACRYIRHLQQNG   61 (63)
T ss_dssp             GTHHHHHHHHHHHHHHHHTSCHHHHTSS-CCCCSCTTHHHHHHHHHHHHHHTCS
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCcccccC-CcccccHHHHHHHHHHHHHHHHHhh
Confidence            5999999999999999999998754432 2489999999999999999998764



>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure