Psyllid ID: psy9718
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| 208972121 | 410 | Hairy protein [Periplaneta americana] | 1.0 | 0.170 | 0.885 | 3e-29 | |
| 170037964 | 345 | hairy [Culex quinquefasciatus] gi|167881 | 1.0 | 0.202 | 0.871 | 1e-28 | |
| 158296333 | 374 | AGAP006699-PA [Anopheles gambiae str. PE | 1.0 | 0.187 | 0.885 | 1e-28 | |
| 157110092 | 343 | hairy protein [Aedes aegypti] gi|1571309 | 1.0 | 0.204 | 0.885 | 1e-28 | |
| 156550861 | 376 | PREDICTED: protein hairy-like [Nasonia v | 1.0 | 0.186 | 0.842 | 8e-28 | |
| 166796106 | 249 | hairy [Tribolium castaneum] gi|20269075| | 1.0 | 0.281 | 0.857 | 1e-27 | |
| 270014144 | 249 | hypothetical protein TcasGA2_TC012851 [T | 1.0 | 0.281 | 0.857 | 1e-27 | |
| 383855344 | 359 | PREDICTED: protein hairy-like [Megachile | 1.0 | 0.194 | 0.871 | 2e-27 | |
| 110762302 | 363 | PREDICTED: protein hairy [Apis mellifera | 1.0 | 0.192 | 0.871 | 3e-27 | |
| 194022542 | 255 | hairy [Tribolium confusum] | 1.0 | 0.274 | 0.857 | 3e-27 |
| >gi|208972121|gb|ACI32659.1| Hairy protein [Periplaneta americana] | Back alignment and taxonomy information |
|---|
Score = 132 bits (331), Expect = 3e-29, Method: Composition-based stats.
Identities = 62/70 (88%), Positives = 67/70 (95%)
Query: 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA 60
MEKRRRARINNCLNEL+TLILDAMKKDPARHSKLEKADILEMTVKHLEN+QRQQ+A+SAA
Sbjct: 58 MEKRRRARINNCLNELRTLILDAMKKDPARHSKLEKADILEMTVKHLENLQRQQVAMSAA 117
Query: 61 TDPHVLKSFK 70
TDP VL F+
Sbjct: 118 TDPSVLNKFR 127
|
Source: Periplaneta americana Species: Periplaneta americana Genus: Periplaneta Family: Blattidae Order: Blattodea Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170037964|ref|XP_001846824.1| hairy [Culex quinquefasciatus] gi|167881356|gb|EDS44739.1| hairy [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|158296333|ref|XP_316733.3| AGAP006699-PA [Anopheles gambiae str. PEST] gi|157016460|gb|EAA11851.3| AGAP006699-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157110092|ref|XP_001650948.1| hairy protein [Aedes aegypti] gi|157130964|ref|XP_001662100.1| hairy protein [Aedes aegypti] gi|108871710|gb|EAT35935.1| AAEL011943-PA [Aedes aegypti] gi|108878802|gb|EAT43027.1| AAEL005480-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|156550861|ref|XP_001601817.1| PREDICTED: protein hairy-like [Nasonia vitripennis] gi|451936070|gb|AGF87125.1| hairy [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|166796106|ref|NP_001107765.1| hairy [Tribolium castaneum] gi|20269075|emb|CAD29886.1| helix-loop-helix transcription factor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014144|gb|EFA10592.1| hypothetical protein TcasGA2_TC012851 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383855344|ref|XP_003703174.1| PREDICTED: protein hairy-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|110762302|ref|XP_393948.3| PREDICTED: protein hairy [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|194022542|gb|ACF32779.1| hairy [Tribolium confusum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| FB|FBgn0001168 | 337 | h "hairy" [Drosophila melanoga | 1.0 | 0.207 | 0.785 | 5.9e-25 | |
| FB|FBgn0010109 | 435 | dpn "deadpan" [Drosophila mela | 1.0 | 0.160 | 0.757 | 4.5e-24 | |
| UNIPROTKB|G3N2D5 | 304 | HES1 "Transcription factor HES | 1.0 | 0.230 | 0.7 | 1.9e-21 | |
| UNIPROTKB|Q3ZBG4 | 280 | HES1 "Transcription factor HES | 1.0 | 0.25 | 0.7 | 1.9e-21 | |
| UNIPROTKB|Q14469 | 280 | HES1 "Transcription factor HES | 1.0 | 0.25 | 0.7 | 1.9e-21 | |
| UNIPROTKB|I3LM61 | 280 | HES1 "Uncharacterized protein" | 1.0 | 0.25 | 0.7 | 1.9e-21 | |
| MGI|MGI:104853 | 282 | Hes1 "hairy and enhancer of sp | 1.0 | 0.248 | 0.7 | 1.9e-21 | |
| RGD|62081 | 281 | Hes1 "hairy and enhancer of sp | 1.0 | 0.249 | 0.7 | 1.9e-21 | |
| UNIPROTKB|Q6IRB2 | 267 | hes1-a "Transcription factor H | 1.0 | 0.262 | 0.7 | 2.4e-21 | |
| UNIPROTKB|Q5PPM5 | 267 | hes1 "Transcription factor HES | 1.0 | 0.262 | 0.7 | 3e-21 |
| FB|FBgn0001168 h "hairy" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 284 (105.0 bits), Expect = 5.9e-25, P = 5.9e-25
Identities = 55/70 (78%), Positives = 60/70 (85%)
Query: 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA 60
MEKRRRARINNCLNELKTLILDA KKDPARHSKLEKADILE TVKHL+ +QRQQ A+ A
Sbjct: 39 MEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQA 98
Query: 61 TDPHVLKSFK 70
DP ++ FK
Sbjct: 99 ADPKIVNKFK 108
|
|
| FB|FBgn0010109 dpn "deadpan" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N2D5 HES1 "Transcription factor HES-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBG4 HES1 "Transcription factor HES-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14469 HES1 "Transcription factor HES-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LM61 HES1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104853 Hes1 "hairy and enhancer of split 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|62081 Hes1 "hairy and enhancer of split 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6IRB2 hes1-a "Transcription factor HES-1-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5PPM5 hes1 "Transcription factor HES-1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 3e-09 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 2e-08 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 6e-08 |
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Score = 47.1 bits (113), Expect = 3e-09
Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 6/51 (11%)
Query: 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQ 51
E+RRR RIN+ EL+ L+ + KL KA+IL + +++++++Q
Sbjct: 8 RERRRRDRINDAFEELRELLP------TPPNKKLSKAEILRLAIEYIKHLQ 52
|
Length = 52 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| KOG4304|consensus | 250 | 99.91 | ||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.53 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.48 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.44 | |
| KOG1318|consensus | 411 | 99.1 | ||
| KOG3561|consensus | 803 | 99.0 | ||
| KOG1319|consensus | 229 | 98.43 | ||
| KOG3560|consensus | 712 | 98.06 | ||
| KOG0561|consensus | 373 | 97.88 | ||
| KOG2483|consensus | 232 | 97.4 | ||
| KOG4029|consensus | 228 | 97.07 | ||
| KOG3960|consensus | 284 | 97.03 | ||
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 96.75 | |
| KOG2588|consensus | 953 | 96.54 | ||
| KOG3558|consensus | 768 | 95.27 | ||
| KOG3910|consensus | 632 | 94.0 | ||
| KOG3559|consensus | 598 | 93.65 | ||
| KOG4395|consensus | 285 | 85.17 |
| >KOG4304|consensus | Back alignment and domain information |
|---|
Probab=99.91 E-value=3.1e-25 Score=160.02 Aligned_cols=70 Identities=60% Similarity=0.862 Sum_probs=63.6
Q ss_pred ChhHHHHHHHHhHHHHHHHHHhhhhcCCcccchhhHHHHHHHHHHHHHHHHHHHhHhhcC-CChhhhhhcC
Q psy9718 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQLALSAA-TDPHVLKSFK 70 (70)
Q Consensus 1 iEkrRR~RIN~~l~~Lk~Llp~~~~~~~~~~~KleKA~ILe~TV~ylk~lq~~~~~~~~~-~~~~~~~~~~ 70 (70)
||||||+|||+||++||+||++++++++..++|||||||||+||+||+.|++.+..+... .++.+.++|+
T Consensus 39 ~EKkRRaRIN~~L~eLK~Li~e~~~~~~~~~sklEKAdILEltV~hL~~l~~~~~~~~~~~~~~~~~d~f~ 109 (250)
T KOG4304|consen 39 LEKKRRARINRCLDELKDLIPEALKKDGQRHSKLEKADILELTVNHLRQLQRSQQAAAQAAPAALPVDSFR 109 (250)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhhhHHHHHHHHHHHHHHHHhcccccccccccccccchhhh
Confidence 799999999999999999999999998888999999999999999999999988776655 6677777774
|
|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >KOG1318|consensus | Back alignment and domain information |
|---|
| >KOG3561|consensus | Back alignment and domain information |
|---|
| >KOG1319|consensus | Back alignment and domain information |
|---|
| >KOG3560|consensus | Back alignment and domain information |
|---|
| >KOG0561|consensus | Back alignment and domain information |
|---|
| >KOG2483|consensus | Back alignment and domain information |
|---|
| >KOG4029|consensus | Back alignment and domain information |
|---|
| >KOG3960|consensus | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >KOG2588|consensus | Back alignment and domain information |
|---|
| >KOG3558|consensus | Back alignment and domain information |
|---|
| >KOG3910|consensus | Back alignment and domain information |
|---|
| >KOG3559|consensus | Back alignment and domain information |
|---|
| >KOG4395|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 2e-08 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 5e-07 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 1e-05 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 4e-05 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 3e-04 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 6e-04 |
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
Score = 44.4 bits (105), Expect = 2e-08
Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Query: 2 EKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQ 53
E+ RR R+ L+EL +LI K+ + KA +E +++ ++Q+
Sbjct: 10 EQARRNRLAVALHELASLIPAEWKQQNVS-AAPSKATTVEAACRYIRHLQQN 60
|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.75 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.74 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.69 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.6 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.57 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.55 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.45 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.45 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.35 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.33 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.29 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.28 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.14 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 98.99 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 98.97 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.94 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.93 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.25 |
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.75 E-value=6.6e-19 Score=106.54 Aligned_cols=48 Identities=33% Similarity=0.622 Sum_probs=43.2
Q ss_pred ChhHHHHHHHHhHHHHHHHHHhhhhcCCcccchhhHHHHHHHHHHHHHHHHH
Q psy9718 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQR 52 (70)
Q Consensus 1 iEkrRR~RIN~~l~~Lk~Llp~~~~~~~~~~~KleKA~ILe~TV~ylk~lq~ 52 (70)
+||+||++||.+|++|++|||.+.. ..+|+|||+||++||+||+.|+.
T Consensus 16 ~ERrRR~rIN~~l~eL~~LvP~~~~----~~~KldKasIL~~tV~ylk~l~~ 63 (73)
T 4h10_A 16 IEKRRRDKMNSFIDELASLVPTCNA----MSRKLDKLTVLRMAVQHMKTLRG 63 (73)
T ss_dssp HHHHHHHHHHHHHHHHHHHSHHHHT----CSSCCCHHHHHHHHHHHHHHHSC
T ss_pred HHHHHHHHHHHHHHHHHHHcccccc----ccccccHHHHHHHHHHHHHHHhc
Confidence 4999999999999999999999852 24799999999999999999874
|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 70 | ||||
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 3e-07 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 3e-07 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 0.001 |
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Usf B/HLH domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.9 bits (96), Expect = 3e-07
Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
Query: 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQ 53
+E+RRR +INN + +L +I D+ + S K IL +++ +++
Sbjct: 12 VERRRRDKINNWIVQLSKIIPDSSMEST--KSGQSKGGILSKASDYIQELRQS 62
|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.68 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.53 | |
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.49 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.43 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.28 |
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Pho4 B/HLH domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.68 E-value=5.6e-18 Score=97.47 Aligned_cols=53 Identities=26% Similarity=0.377 Sum_probs=46.3
Q ss_pred ChhHHHHHHHHhHHHHHHHHHhhhhcCCcccchhhHHHHHHHHHHHHHHHHHHH
Q psy9718 1 MEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENMQRQQ 54 (70)
Q Consensus 1 iEkrRR~RIN~~l~~Lk~Llp~~~~~~~~~~~KleKA~ILe~TV~ylk~lq~~~ 54 (70)
+||+||++||.+|++|++|||.+...++ ...|++||+||++||+||+.||+++
T Consensus 9 ~Er~RR~~in~~~~~L~~llP~~~~~~~-~~~k~sKa~iL~~Av~yI~~Lq~~v 61 (63)
T d1a0aa_ 9 AEQARRNRLAVALHELASLIPAEWKQQN-VSAAPSKATTVEAACRYIRHLQQNG 61 (63)
T ss_dssp GTHHHHHHHHHHHHHHHHTSCHHHHTSS-CCCCSCTTHHHHHHHHHHHHHHTCS
T ss_pred HHHHHHHHHHHHHHHHHHHCCCcccccC-CcccccHHHHHHHHHHHHHHHHHhh
Confidence 5999999999999999999998754432 2489999999999999999998764
|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|