Psyllid ID: psy9770

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-
MNLGDKDSVYAKLLHDDMLETENESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLESSKNIANNSFGSPISSSPLLKNGTLKGKSFSSSKETLRYRPLNDQINRDPVRRVVSYTPSSLPQRRGVHYQSTGSLHSDSPSSSSVSPVPSSPRPLPPKTSWTSNLHTSKRWSSTGDFHHHTMSSHHSVHQNHHNSSGGGAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCLSF
cccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccEEEcccccEEEEEEcccccEEEcccccccccccccccccccccEEEEEEEEccccccEEEEEEcccccEEEEEccEEEEEEcccccEEEcccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccEEEEEccccccccEEEEEEEEccccEEEEEEccccccEEEEEEccccccccEEEEEEcccccEEEEEEccccccEEEEEcccEEEEEEcccccEEEEEcccccccccccccEEEEEEcccccEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccccEEEEEEccccccEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEcccccEEEEEEcccccEEEccEEEEcccccccccEEEEEEcccccEEEEEcccccEEEEEccccccEEEEcc
ccccccccHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccccccccccccEcccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEcccccEEEEccccccEEEEEccccccccEEEEEEEcccccEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccEEEEccccccEEEEEEEEEEcccccEEEEEEEcccccEEEEEccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEEEEcccccEEEEEEEccccccEEEEEEEcccccEEEEEEccccccEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEccccEEEEccccccEEEEEEcccccEEEEccccEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEEccccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEcc
MNLGDKDSVYAKLLHDDMLETENESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLEsskniannsfgspissspllkngtlkgksfsssketlryrplndqinrdpvrrvvsytpsslpqrrgvhyqstgslhsdspssssvspvpssprplppktswtsnlhtskrwsstgdfhhhtmsshhsvhqnhhnssgggakdaqyneEESSLRMYlrgrpinlyapsdlaesyditkvaappqnklkldwvygyrgkdcrsnlyllptgeIVYFVAAVAVLYNVEEqtqrhylghtddikclsihpNKLLIATgqvaghdaregkphiriwNSVSLFTVSIIGIGEFERSisclsfskadggtflcavdegndynisvwdwqksdrghkitetkcsVDTVVaaefhpldrnnivtcgkshinfwtidaggtlykKQGIFEMIRDKPKYVTCLAftqggevlsgdsngniivwtrGSNTISKFIRNVHEGSVFSICVlkegsiisaggkdgrllqfdsnlqptgyEAQIAEHLGgirtvsegrgsqlivgttrNCILVGslnlgfspvvlghTDELwalaahpslsqfLTAGFDRIVQLWDSMSHSVVWSKDIAEQaqsatfspdgsiIIVGCIAGRWLVMDSETREAysihtdgnepiqvvkfspdgkllalgsrdNYIYVYEVSgdsrkysrvgrctghssfithldwsedsmyirsnsgdyellywnagtcrqipqssqlrDVVWesnsctltfttigiwpegadgtdvnscershdarviatgddfgklklysypavqpklclsf
MNLGDKDSVYAKLLHDDMLETENESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLEsskniannsfgspissspllkngtlkgksfsssketlryrplndqinrdpvrrvvsytpsslpqrrgVHYQSTgslhsdspssssvspvpssprplppktswtsnlHTSKRWSSTGDFHHHTMSSHHSVHQNHHNSSGGGAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESyditkvaappqnklkLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWdwqksdrghkiTETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQggevlsgdsnGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAqsatfspdgsIIIVGCIAGRWLVMDSETREAYSihtdgnepiqvvKFSPDGKLLALGSRDNYIYVYEVsgdsrkysrvgRCTGHSSFithldwsedSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTfttigiwpegadGTDVNSCERSHDARVIATGDDFGKLKlysypavqpklclsf
MNLGDKDSVYAKLLHDDMLETENESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLESSKNIANNSFGSPISSSPLLKNGTLKGKSFSSSKETLRYRPLNDQINRDPVRRVVSYTPSSLPQRRGVHYQstgslhsdspssssvspvpssprplppktsWTSNLHTSKRWSSTGDFhhhtmsshhsvhqnhhnssGGGAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCLSF
************************************VLEHGDEIVCLRSTLADVLRRLA*************************************************************************************************************************************************************MYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLC***
****DKDSVYAKL****************VSDLEKK*******I*CLRSTLADVLRRLAQ********************************************************************************************************************************************************SSLRMYLRGRPINLYAPSDLA**************KLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCLSF
MNLGDKDSVYAKLLHDDMLETENESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLESSKNIANNSFGSPISSSPLLKNGTLKGKSFSSSKETLRYRPLNDQINRDPVRRVVSY*********************************************TSNLHTSKRWSSTGDFH*******************************SSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQ********GKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCLSF
**********************NESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLESSKNI*********************************************VRRVVSY***************************SVSPVPSSPRPLPPKTSWTSNLHTSKRWSSTGDFHHHTMSSHHSVHQNHHNSSGGGAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCLSF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLGDKDSVYAKLLHxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVCLRSTLADVLRRLAQLESSKNIANNSFGSPISSSPLLKNGTLKGKSFSSSKETLRYRPLNDQINRDPVRRVVSYTPSSLPQRRGVHYQSTGSLHSDSPSSSSVSPVPSSPRPLPPKTSWTSNLHTSKRWSSTGDFHHHTMSSHHSVHQNHHNSSGGGAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCLSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query811 2.2.26 [Sep-21-2011]
O00423815 Echinoderm microtubule-as yes N/A 0.903 0.899 0.466 0.0
Q4V8C3814 Echinoderm microtubule-as yes N/A 0.898 0.895 0.461 0.0
Q05BC3814 Echinoderm microtubule-as yes N/A 0.906 0.902 0.464 0.0
Q6P6T4649 Echinoderm microtubule-as no N/A 0.738 0.922 0.538 0.0
Q7TNG5649 Echinoderm microtubule-as no N/A 0.738 0.922 0.536 0.0
O95834649 Echinoderm microtubule-as no N/A 0.738 0.922 0.536 0.0
Q9HC35 981 Echinoderm microtubule-as no N/A 0.959 0.793 0.439 0.0
Q9Y1C1664 77 kDa echinoderm microtu N/A N/A 0.742 0.906 0.522 0.0
Q26613686 77 kDa echinoderm microtu yes N/A 0.748 0.884 0.513 0.0
Q2TAF3 927 Echinoderm microtubule-as N/A N/A 0.916 0.801 0.434 0.0
>sp|O00423|EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens GN=EML1 PE=1 SV=3 Back     alignment and function desciption
 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/785 (46%), Positives = 527/785 (67%), Gaps = 52/785 (6%)

Query: 26  LRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLESSKNIANNSFGSPISSSPLLKNG 85
           + +R++ LE++V    D+I  L+S LADV+RRL   E  + + N     P  + PL+   
Sbjct: 34  VTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRK--GPTKARPLM--- 88

Query: 86  TLKGKSFSSSKETLRYRPLNDQINRDPVRRVVSYTPSSLPQRRGVHYQSTGSLHSDSPSS 145
                      +TL   PL   +N   V          LP++       TGSL    PS 
Sbjct: 89  -----------QTL---PLRTTVNNGTV----------LPKK------PTGSL----PSP 114

Query: 146 SSV---SPVPSSPRPLPPKTSWTSNLHTSKRWSSTGDFH-HHTMSSHHSVHQNHHNSSGG 201
           S V   + VP++   +  +TS +  +    R  S GD   +   +   S   +   +S  
Sbjct: 115 SGVRKETAVPATKSNIK-RTSSSERVSPGGRRESNGDSRGNRNRTGSTSSSSSGKKNSES 173

Query: 202 GAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKD 261
             K+  ++ EE  ++M+LRGRP+ +Y P D  +SY +      P  +LKL+WVYGYRG+D
Sbjct: 174 KPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRD 233

Query: 262 CRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAG 321
           CR+NLYLLPTGE VYF+A+V VLYNVEEQ QRHY GH DD+KCL++HP+++ IATGQVAG
Sbjct: 234 CRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAG 293

Query: 322 --HDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNI 379
              D ++  PH+RIW+SV+L T+ +IGIG F+R+++C++FSK++GGT LCAVD+ ND+ +
Sbjct: 294 TSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVL 353

Query: 380 SVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQ 439
           SVWDWQK +   K+ + KCS + V AA+FHP D N IVTCGKSH+ FWT++ G +L KKQ
Sbjct: 354 SVWDWQKEE---KLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLE-GSSLNKKQ 409

Query: 440 GIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICV 499
           G+FE  ++KPK+V C+ F++ G+ ++GDS+GNI+VW +G+N IS  ++  HEG +F++C+
Sbjct: 410 GLFEK-QEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCM 468

Query: 500 LKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCIL 559
           L++G+++S GGKD +L+ +  N Q    + +I E  G IRTV+EG+G  +++GTTRN +L
Sbjct: 469 LRDGTLVSGGGKDRKLISWSGNYQKL-RKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVL 527

Query: 560 VGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQA 619
            G+L+  F+P+  GHTDELW LA H S SQFLT G D+   LWD++ H  VW K I + A
Sbjct: 528 QGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPA 587

Query: 620 QSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRD 679
           QS+ F P GS++ VG + GRW V D+ET++  ++HTDGNE + V+++SPDG  LA+GS D
Sbjct: 588 QSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHD 647

Query: 680 NYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQI 739
           N IY+Y VS + RKY+RVG+C+GHSSFITHLDWS +S ++ SNSGDYE+LYW    C+Q+
Sbjct: 648 NCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQV 707

Query: 740 PQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYS 799
                 RD+ W + +CTL F   G+WPEG+DGTD+N+  R+H+ ++++TGDDFGK+ L+S
Sbjct: 708 VSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFS 767

Query: 800 YPAVQ 804
           YP  Q
Sbjct: 768 YPCSQ 772
May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.
Homo sapiens (taxid: 9606)
>sp|Q4V8C3|EMAL1_RAT Echinoderm microtubule-associated protein-like 1 OS=Rattus norvegicus GN=Eml1 PE=2 SV=2 Back     alignment and function description
>sp|Q05BC3|EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus GN=Eml1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P6T4|EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus GN=Eml2 PE=1 SV=1 Back     alignment and function description
>sp|Q7TNG5|EMAL2_MOUSE Echinoderm microtubule-associated protein-like 2 OS=Mus musculus GN=Eml2 PE=2 SV=1 Back     alignment and function description
>sp|O95834|EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens GN=EML2 PE=2 SV=1 Back     alignment and function description
>sp|Q9HC35|EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens GN=EML4 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y1C1|EMAP_LYTVA 77 kDa echinoderm microtubule-associated protein (Fragment) OS=Lytechinus variegatus GN=EMAP PE=2 SV=1 Back     alignment and function description
>sp|Q26613|EMAP_STRPU 77 kDa echinoderm microtubule-associated protein OS=Strongylocentrotus purpuratus GN=EMAP PE=2 SV=1 Back     alignment and function description
>sp|Q2TAF3|EMAL4_XENLA Echinoderm microtubule-associated protein-like 4 OS=Xenopus laevis GN=eml4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query811
307199782 939 Echinoderm microtubule-associated protei 0.974 0.841 0.625 0.0
307169530896 Echinoderm microtubule-associated protei 0.967 0.876 0.623 0.0
340723718896 PREDICTED: echinoderm microtubule-associ 0.980 0.887 0.617 0.0
350422689896 PREDICTED: echinoderm microtubule-associ 0.980 0.887 0.620 0.0
350422692904 PREDICTED: echinoderm microtubule-associ 0.980 0.879 0.614 0.0
340723720904 PREDICTED: echinoderm microtubule-associ 0.980 0.879 0.612 0.0
328788758902 PREDICTED: echinoderm microtubule-associ 0.980 0.881 0.613 0.0
193690888706 PREDICTED: echinoderm microtubule-associ 0.745 0.856 0.783 0.0
383862571899 PREDICTED: echinoderm microtubule-associ 0.972 0.877 0.614 0.0
328713017655 PREDICTED: echinoderm microtubule-associ 0.755 0.935 0.775 0.0
>gi|307199782|gb|EFN80228.1| Echinoderm microtubule-associated protein-like 1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 1072 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/848 (62%), Positives = 643/848 (75%), Gaps = 58/848 (6%)

Query: 11  AKLLHDDMLETENESLRERVSDLEKKVLEHGDEIVCLRSTLADVLRRLAQLESSKNIANN 70
           AK   D+MLE E  SL  RV+DLE++ L   DEIVCLR+TLAD LRR+AQLE  +     
Sbjct: 57  AKQEMDEMLECETGSLLGRVADLERQSLAQRDEIVCLRATLADALRRIAQLEGREKREEE 116

Query: 71  SFGSP---ISSSPLLKNG--TLKGKSFSSSKETLRYRPLNDQIN----------RDPV-- 113
                   + SSPL +NG   L+    S  ++  R R      N          RD    
Sbjct: 117 RNERRNERLVSSPL-RNGHVPLRSSQNSVPQKDPRLRQTGGLRNSSSSGSSQDVRDATSS 175

Query: 114 -RRVVSYT-PSSLPQRRGVHYQSTGSLHSDSPSSSS----------VSPVPSSPRPL--- 158
            RR VSY  PS LPQRR VHYQSTGSLHSDSPSSSS           +P+P +  P    
Sbjct: 176 PRRPVSYVHPSQLPQRRSVHYQSTGSLHSDSPSSSSVSPVPSPSPRATPLPVARSPTARS 235

Query: 159 --PPKTSWTSNLHTSKRWSSTGDFHHH------------------TMSSHHSVHQNHHNS 198
             PP++S    L  +KRWSSTGDF H                   T S  +       N+
Sbjct: 236 NGPPQSS----LRRAKRWSSTGDFTHSPQNQGSNSQLVGSRLSASTKSLFNLFKPPAMNN 291

Query: 199 SGGGAKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYR 258
              G +D QYNEEES++RMYLRGRP+ LY P+ + ESYD+ KV+ PPQ+KLKLDWVYGYR
Sbjct: 292 VKHGTRDMQYNEEESTVRMYLRGRPVVLYVPTPMMESYDLHKVSTPPQSKLKLDWVYGYR 351

Query: 259 GKDCRSNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQ 318
           G+DCRSNL+LLPTGEIVYFVAAV VLYN+EE +QRHYLGHTDD+KC++IHPNKL++ATGQ
Sbjct: 352 GRDCRSNLHLLPTGEIVYFVAAVVVLYNMEEHSQRHYLGHTDDVKCIAIHPNKLVVATGQ 411

Query: 319 VAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYN 378
           V G D R+  PHIRIWNSVSL T+S+IG GEF+ SI CLSFSKADGG +LCA+DE  D+N
Sbjct: 412 VCGTDRRDAMPHIRIWNSVSLTTLSVIGNGEFDGSICCLSFSKADGGNYLCAIDETADHN 471

Query: 379 ISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKK 438
           IS+WDWQKSDRG K+TETKCSVDTVV AE+HPL+RN IV+CGK H++FW++D GG LYK+
Sbjct: 472 ISIWDWQKSDRGTKVTETKCSVDTVVCAEWHPLERNQIVSCGKGHVSFWSLDNGGMLYKR 531

Query: 439 QGIFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSIC 498
            GIFE  RDKP+YVTC+AF Q G+VL+GDSNGNIIVW RG+NTIS+ +RN+HEGS+FSIC
Sbjct: 532 MGIFES-RDKPRYVTCVAFNQNGDVLTGDSNGNIIVWARGTNTISRLVRNLHEGSIFSIC 590

Query: 499 VLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCI 558
           VLK G+II+ GGKDGR+L FD+ L  TG EAQI +H GGIRT+SEGRGSQL+VGTTRNCI
Sbjct: 591 VLKNGNIITGGGKDGRILHFDATLNLTGEEAQIEDHFGGIRTLSEGRGSQLLVGTTRNCI 650

Query: 559 LVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQ 618
           LVG + +GF+P +LGH +E+W LAAHP+L QF TAG DR++Q+WDS+SH+VVWSKDI EQ
Sbjct: 651 LVGDVEMGFNPAMLGHAEEVWGLAAHPTLPQFATAGHDRLLQMWDSLSHTVVWSKDIGEQ 710

Query: 619 AQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSR 678
           AQS  FSPDG++I+VGC++G+WL +DSETRE Y+ H+DG+EP+Q V+FSPDG LLALGSR
Sbjct: 711 AQSIVFSPDGNVIVVGCVSGKWLAIDSETRELYTHHSDGSEPLQAVQFSPDGSLLALGSR 770

Query: 679 DNYIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQ 738
           DNYIY+Y+V+ D+ KYSRVGRC GHSSFITHLDWS D  Y+RSNSGDYELLYWN G CRQ
Sbjct: 771 DNYIYIYQVNDDATKYSRVGRCMGHSSFITHLDWSVDGQYLRSNSGDYELLYWNPGVCRQ 830

Query: 739 IPQSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLY 798
           IPQ S LR+V W +++C ++F TIGIWPEGADGTDVN+C RS D +++ATGDDFGK+KL+
Sbjct: 831 IPQPSMLRNVDWATHTCVISFETIGIWPEGADGTDVNNCTRSGDGKLLATGDDFGKVKLF 890

Query: 799 SYPAVQPK 806
           S+PA QPK
Sbjct: 891 SHPACQPK 898

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307169530|gb|EFN62172.1| Echinoderm microtubule-associated protein-like 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340723718|ref|XP_003400236.1| PREDICTED: echinoderm microtubule-associated protein-like 2-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350422689|ref|XP_003493250.1| PREDICTED: echinoderm microtubule-associated protein-like 2-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350422692|ref|XP_003493251.1| PREDICTED: echinoderm microtubule-associated protein-like 2-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723720|ref|XP_003400237.1| PREDICTED: echinoderm microtubule-associated protein-like 2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328788758|ref|XP_393565.4| PREDICTED: echinoderm microtubule-associated protein-like 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|193690888|ref|XP_001950713.1| PREDICTED: echinoderm microtubule-associated protein-like 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383862571|ref|XP_003706757.1| PREDICTED: echinoderm microtubule-associated protein-like 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328713017|ref|XP_003244974.1| PREDICTED: echinoderm microtubule-associated protein-like 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query811
RGD|1306374814 Eml1 "echinoderm microtubule a 0.732 0.729 0.531 1.5e-201
ZFIN|ZDB-GENE-050706-71833 eml2 "echinoderm microtubule a 0.734 0.715 0.541 1.9e-201
ZFIN|ZDB-GENE-060929-156813 eml1 "echinoderm microtubule a 0.733 0.731 0.542 3.1e-201
MGI|MGI:1915769814 Eml1 "echinoderm microtubule a 0.732 0.729 0.531 4e-201
UNIPROTKB|O00423815 EML1 "Echinoderm microtubule-a 0.732 0.728 0.531 4e-201
UNIPROTKB|K7ERL7850 EML2 "Echinoderm microtubule-a 0.738 0.704 0.536 5.2e-199
UNIPROTKB|E2RII4817 EML2 "Uncharacterized protein" 0.737 0.731 0.534 1.6e-197
UNIPROTKB|E1BB08818 EML2 "Uncharacterized protein" 0.738 0.732 0.527 2.9e-196
RGD|621066649 Eml2 "echinoderm microtubule a 0.738 0.922 0.538 4.4e-194
UNIPROTKB|Q6P6T4649 Eml2 "Echinoderm microtubule-a 0.738 0.922 0.538 4.4e-194
RGD|1306374 Eml1 "echinoderm microtubule associated protein like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 1881 (667.2 bits), Expect = 1.5e-201, Sum P(2) = 1.5e-201
 Identities = 321/604 (53%), Positives = 458/604 (75%)

Query:   204 KDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCR 263
             K+  ++ EE  ++M+LRGRP+ +Y P D  +SY +   A  P  +LKL+WVYGYRG+DCR
Sbjct:   175 KEPTFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCR 234

Query:   264 SNLYLLPTGEIVYFVAAVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHD 323
             +NLYLLPTGE VYF+A+V VLYNVEEQ QRHY GH DD+KCL++HP+++ IATGQVAG  
Sbjct:   235 NNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAG-T 293

Query:   324 AREGK---PHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNIS 380
             +++GK   PH+RIW+SV+L T+ +IGIG F+R+++C++FSK++GG+ LCAVD+ ND+ +S
Sbjct:   294 SKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGSHLCAVDDSNDHVLS 353

Query:   381 VWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQG 440
             VWDWQ+ +R   + + KCS + V AA+FHP D N IVTCGKSH+ FWT++ G +L KKQG
Sbjct:   354 VWDWQREER---LADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLE-GNSLNKKQG 409

Query:   441 IFEMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVL 500
             +FE  ++KPK+V C+ F++ G+ ++GDS+GNI+VW +G+N IS  ++  HEG +F++C+L
Sbjct:   410 LFEK-QEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCML 468

Query:   501 KEGSIISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILV 560
             ++G+++S GGKD RL+ ++ N Q   ++A+I E  G IRTV+EG+G+ +++GTTRN +L 
Sbjct:   469 RDGTLVSGGGKDRRLISWNGNYQKL-HKAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQ 527

Query:   561 GSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQ 620
             G+L   F+P+  GHTDELW LA H S  QFLT G D+   LWD++ H  VW K I + AQ
Sbjct:   528 GTLTGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQ 587

Query:   621 SATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDN 680
             S+ F P GS++ VG + GRW V D+ET++  ++HTDGNE + V+++SPDG  LA+GS DN
Sbjct:   588 SSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDN 647

Query:   681 YIYVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIP 740
              IY+Y VS + RKY+RVG+C+GHSSFITHLDWS +S ++ SNSGDYE+LYW    C+Q+ 
Sbjct:   648 CIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVV 707

Query:   741 QSSQLRDVVWESNSCTLTFTTIGIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSY 800
                  RD+ W + +CTL F   G+WPEG+DGTD+N+  R+H+ ++++TGDDFGK+ L+SY
Sbjct:   708 SVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSY 767

Query:   801 PAVQ 804
             P  Q
Sbjct:   768 PCSQ 771
GO:0005737 "cytoplasm" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
ZFIN|ZDB-GENE-050706-71 eml2 "echinoderm microtubule associated protein like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-156 eml1 "echinoderm microtubule associated protein like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1915769 Eml1 "echinoderm microtubule associated protein like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O00423 EML1 "Echinoderm microtubule-associated protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7ERL7 EML2 "Echinoderm microtubule-associated protein-like 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RII4 EML2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BB08 EML2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|621066 Eml2 "echinoderm microtubule associated protein like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P6T4 Eml2 "Echinoderm microtubule-associated protein-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O45487EMAL_CAEELNo assigned EC number0.32010.71510.6509yesN/A
O00423EMAL1_HUMANNo assigned EC number0.46620.90380.8993yesN/A
Q26613EMAP_STRPUNo assigned EC number0.51370.74840.8848yesN/A
Q4V8C3EMAL1_RATNo assigned EC number0.46190.89880.8955yesN/A
Q05BC3EMAL1_MOUSENo assigned EC number0.46410.90620.9029yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query811
pfam0345177 pfam03451, HELP, HELP motif 2e-33
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-22
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-21
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-19
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 7e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
smart0032040 smart00320, WD40, WD40 repeats 0.003
>gnl|CDD|190637 pfam03451, HELP, HELP motif Back     alignment and domain information 
 Score =  122 bits (309), Expect = 2e-33
 Identities = 52/78 (66%), Positives = 63/78 (80%), Gaps = 1/78 (1%)

Query: 211 EESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLP 270
           E   ++M++RGRP+ +Y PSD  E+YD+     PP  KLKL+WVYGYRG+DCR+NLYLLP
Sbjct: 1   ESGYVKMFIRGRPVTMYIPSD-VENYDLEADKDPPTKKLKLEWVYGYRGRDCRANLYLLP 59

Query: 271 TGEIVYFVAAVAVLYNVE 288
           TGEIVYFVAAV VLYNVE
Sbjct: 60  TGEIVYFVAAVVVLYNVE 77

The founding member of the EMAP protein family is the 75 kDa Echinoderm Microtubule-Associated Protein, so-named for its abundance in sea urchin, sand dollar and starfish eggs. The Hydrophobic EMAP-Like Protein (HELP) motif was identified initially in the human EMAP-Like Protein 2 (EML2) and subsequently in the entire EMAP Protein family. The HELP motif is approximately 60-70 amino acids in length and is conserved amongst metazoans. Although the HELP motif is hydrophobic, there is no evidence that EMAP-Like Proteins are membrane-associated. All members of the EMAP-Like Protein family, identified to-date, are constructed with an amino terminal HELP motif followed by a WD domain. In C. elegans, EMAP-Like Protein-1 (ELP-1) is required for touch sensation indicating that ELP-1 may play a role in mechanosensation. The localization of ELP-1 to microtubules and adhesion sites implies that ELP-1 may transmit forces between the body surface and the touch receptor neurons. Length = 77
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 811
KOG2106|consensus626 100.0
KOG0318|consensus603 100.0
KOG0319|consensus 775 100.0
KOG0291|consensus 893 100.0
KOG0319|consensus 775 100.0
KOG0306|consensus 888 100.0
KOG0271|consensus480 100.0
KOG0291|consensus 893 100.0
KOG0271|consensus480 100.0
KOG0318|consensus603 100.0
KOG1408|consensus 1080 100.0
KOG0306|consensus 888 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG1408|consensus 1080 100.0
KOG0286|consensus343 100.0
KOG1063|consensus764 100.0
KOG1539|consensus 910 100.0
KOG0296|consensus399 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0276|consensus 794 100.0
KOG0273|consensus524 100.0
KOG0273|consensus524 100.0
KOG0315|consensus311 100.0
KOG0279|consensus315 100.0
KOG0276|consensus 794 100.0
KOG1539|consensus 910 100.0
KOG0284|consensus464 100.0
KOG0296|consensus399 100.0
KOG2106|consensus626 100.0
KOG1063|consensus764 100.0
KOG0263|consensus707 100.0
KOG0292|consensus 1202 100.0
KOG0263|consensus707 100.0
KOG0295|consensus406 100.0
KOG2048|consensus 691 100.0
KOG0265|consensus338 100.0
KOG0645|consensus312 100.0
KOG0295|consensus406 100.0
KOG0285|consensus460 100.0
KOG0265|consensus338 100.0
KOG0292|consensus 1202 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG2048|consensus 691 100.0
KOG0284|consensus464 100.0
KOG0285|consensus460 100.0
KOG0281|consensus499 100.0
KOG0645|consensus312 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0266|consensus456 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0293|consensus519 99.98
KOG0266|consensus456 99.97
KOG0293|consensus519 99.97
KOG0282|consensus503 99.97
KOG0281|consensus499 99.97
KOG0282|consensus503 99.97
KOG0316|consensus307 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0278|consensus334 99.97
KOG0643|consensus327 99.97
KOG1407|consensus313 99.97
KOG0278|consensus334 99.97
KOG0313|consensus423 99.97
KOG0643|consensus327 99.97
KOG0275|consensus508 99.97
KOG1407|consensus313 99.96
KOG0316|consensus307 99.96
KOG0283|consensus 712 99.96
KOG0288|consensus459 99.96
KOG0640|consensus430 99.96
KOG0275|consensus508 99.96
KOG0772|consensus641 99.96
KOG1446|consensus311 99.96
KOG0313|consensus423 99.96
KOG0310|consensus487 99.96
KOG0310|consensus 487 99.96
KOG1446|consensus311 99.96
KOG0772|consensus 641 99.95
KOG0274|consensus537 99.95
KOG0973|consensus 942 99.95
KOG0277|consensus311 99.95
KOG0299|consensus479 99.95
KOG0288|consensus459 99.95
KOG0268|consensus433 99.95
KOG0305|consensus484 99.95
KOG0289|consensus506 99.95
KOG0647|consensus347 99.95
KOG0641|consensus350 99.95
KOG0274|consensus537 99.95
KOG0305|consensus484 99.95
KOG0283|consensus712 99.95
KOG1036|consensus323 99.95
KOG0640|consensus430 99.94
KOG0646|consensus476 99.94
KOG0308|consensus 735 99.94
KOG1963|consensus 792 99.94
PTZ00420 568 coronin; Provisional 99.94
KOG0973|consensus 942 99.94
PTZ00421 493 coronin; Provisional 99.94
KOG0299|consensus479 99.94
PTZ00421 493 coronin; Provisional 99.94
KOG0289|consensus506 99.94
KOG0300|consensus481 99.94
KOG0277|consensus311 99.94
KOG2096|consensus420 99.94
KOG0308|consensus 735 99.94
KOG0647|consensus347 99.94
KOG1036|consensus323 99.94
KOG0639|consensus705 99.94
KOG1445|consensus 1012 99.94
KOG1963|consensus 792 99.93
KOG0268|consensus433 99.93
KOG2055|consensus514 99.93
KOG2096|consensus420 99.93
KOG0301|consensus 745 99.93
KOG0300|consensus481 99.93
KOG0294|consensus362 99.93
KOG0294|consensus362 99.92
PTZ00420568 coronin; Provisional 99.92
KOG1332|consensus299 99.92
KOG0301|consensus 745 99.92
KOG1445|consensus 1012 99.92
KOG0639|consensus705 99.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG0641|consensus350 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG1274|consensus 933 99.91
KOG0650|consensus733 99.91
KOG1538|consensus 1081 99.9
KOG1538|consensus 1081 99.9
KOG2055|consensus514 99.9
KOG0646|consensus476 99.9
KOG2445|consensus361 99.9
KOG1274|consensus 933 99.9
KOG4283|consensus397 99.89
KOG4283|consensus397 99.89
KOG0264|consensus422 99.89
COG2319466 FOG: WD40 repeat [General function prediction only 99.89
KOG0650|consensus733 99.89
KOG1332|consensus299 99.89
KOG0264|consensus422 99.89
KOG0267|consensus 825 99.88
KOG0321|consensus 720 99.88
KOG1273|consensus405 99.88
KOG1273|consensus405 99.88
KOG0321|consensus 720 99.88
KOG1034|consensus385 99.88
KOG0269|consensus 839 99.87
KOG2445|consensus361 99.87
COG2319466 FOG: WD40 repeat [General function prediction only 99.87
KOG4328|consensus498 99.87
KOG0267|consensus 825 99.87
KOG0270|consensus463 99.86
KOG4328|consensus498 99.85
KOG4378|consensus 673 99.85
KOG4378|consensus 673 99.84
KOG0269|consensus 839 99.84
KOG2919|consensus406 99.83
KOG4497|consensus447 99.83
KOG0302|consensus440 99.83
KOG1034|consensus385 99.82
KOG0322|consensus323 99.81
KOG1188|consensus376 99.8
KOG1009|consensus434 99.8
KOG1912|consensus 1062 99.8
KOG0307|consensus 1049 99.79
KOG0302|consensus440 99.79
KOG4497|consensus447 99.79
KOG2919|consensus406 99.79
KOG0307|consensus 1049 99.78
KOG1009|consensus434 99.78
KOG1007|consensus370 99.78
KOG4227|consensus609 99.77
KOG0322|consensus323 99.77
KOG0644|consensus 1113 99.77
COG4946668 Uncharacterized protein related to the periplasmic 99.77
PRK11028330 6-phosphogluconolactonase; Provisional 99.77
PRK11028330 6-phosphogluconolactonase; Provisional 99.77
KOG4227|consensus 609 99.77
KOG0649|consensus325 99.77
KOG0642|consensus577 99.76
KOG0270|consensus463 99.76
KOG0649|consensus325 99.75
KOG2110|consensus391 99.75
KOG1517|consensus1387 99.75
KOG1524|consensus 737 99.74
KOG0644|consensus 1113 99.74
KOG1007|consensus370 99.74
KOG2110|consensus391 99.73
KOG1517|consensus1387 99.73
KOG1524|consensus 737 99.72
KOG1188|consensus376 99.71
KOG0771|consensus398 99.71
KOG1310|consensus 758 99.7
KOG0303|consensus472 99.7
KOG1587|consensus555 99.7
KOG1587|consensus555 99.69
PRK01742429 tolB translocation protein TolB; Provisional 99.69
KOG1523|consensus361 99.69
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.68
KOG1310|consensus 758 99.68
KOG0303|consensus 472 99.68
KOG0290|consensus364 99.68
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.68
PRK01742429 tolB translocation protein TolB; Provisional 99.66
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.66
KOG2315|consensus 566 99.66
KOG1334|consensus559 99.66
KOG1334|consensus559 99.66
KOG1523|consensus361 99.66
KOG0642|consensus577 99.66
KOG0290|consensus364 99.65
KOG0771|consensus398 99.65
PRK03629429 tolB translocation protein TolB; Provisional 99.64
KOG1240|consensus1431 99.63
KOG2321|consensus 703 99.62
KOG1240|consensus1431 99.62
KOG2315|consensus566 99.62
PRK05137435 tolB translocation protein TolB; Provisional 99.62
KOG2111|consensus346 99.61
KOG2394|consensus 636 99.6
KOG1912|consensus 1062 99.6
KOG2394|consensus 636 99.6
PRK03629429 tolB translocation protein TolB; Provisional 99.59
COG4946668 Uncharacterized protein related to the periplasmic 99.59
PRK04922433 tolB translocation protein TolB; Provisional 99.59
KOG2111|consensus346 99.58
PRK04922433 tolB translocation protein TolB; Provisional 99.58
KOG2139|consensus445 99.57
KOG2139|consensus445 99.57
KOG0974|consensus 967 99.56
KOG3881|consensus412 99.55
KOG0974|consensus 967 99.55
PRK02889427 tolB translocation protein TolB; Provisional 99.55
KOG1272|consensus 545 99.54
KOG2321|consensus 703 99.53
KOG1272|consensus545 99.52
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.52
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.51
PRK02889427 tolB translocation protein TolB; Provisional 99.5
KOG2314|consensus698 99.5
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.49
PRK05137435 tolB translocation protein TolB; Provisional 99.49
KOG3881|consensus412 99.48
PF0345177 HELP: HELP motif; InterPro: IPR005108 The HELP (Hy 99.48
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.48
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.45
KOG1409|consensus404 99.45
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.45
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.44
KOG1409|consensus404 99.44
KOG2041|consensus 1189 99.44
KOG2041|consensus 1189 99.43
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.43
KOG2314|consensus 698 99.42
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.42
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.4
PRK00178430 tolB translocation protein TolB; Provisional 99.4
PRK01029428 tolB translocation protein TolB; Provisional 99.4
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.4
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.39
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.39
PRK04792448 tolB translocation protein TolB; Provisional 99.38
KOG1354|consensus433 99.38
PRK01029428 tolB translocation protein TolB; Provisional 99.35
KOG1354|consensus433 99.34
PRK00178430 tolB translocation protein TolB; Provisional 99.33
PRK04792448 tolB translocation protein TolB; Provisional 99.32
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.22
KOG4547|consensus 541 99.21
KOG0280|consensus339 99.17
KOG4547|consensus 541 99.16
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.1
PRK04043419 tolB translocation protein TolB; Provisional 99.08
KOG1064|consensus2439 99.08
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.08
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.06
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.03
KOG0280|consensus339 99.01
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.97
PRK04043419 tolB translocation protein TolB; Provisional 98.97
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.96
KOG1064|consensus2439 98.96
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.94
KOG4532|consensus344 98.91
KOG4532|consensus344 98.9
KOG0309|consensus 1081 98.9
KOG3914|consensus390 98.88
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.88
KOG4190|consensus1034 98.87
KOG4714|consensus319 98.87
KOG4649|consensus354 98.85
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.85
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.83
KOG3914|consensus 390 98.81
KOG4190|consensus1034 98.79
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.78
KOG0882|consensus 558 98.77
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.76
KOG0309|consensus 1081 98.73
KOG0882|consensus 558 98.71
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.7
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.7
KOG1920|consensus 1265 98.69
PRK02888 635 nitrous-oxide reductase; Validated 98.67
PRK02888635 nitrous-oxide reductase; Validated 98.64
KOG3617|consensus 1416 98.62
KOG4714|consensus319 98.59
KOG4649|consensus354 98.58
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.56
KOG2695|consensus425 98.55
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.55
KOG1897|consensus 1096 98.55
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.53
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.52
KOG1832|consensus1516 98.51
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.5
KOG2695|consensus425 98.5
KOG2066|consensus 846 98.49
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.45
KOG1920|consensus 1265 98.4
KOG1275|consensus 1118 98.39
KOG1832|consensus1516 98.38
KOG1897|consensus1096 98.37
KOG1275|consensus 1118 98.37
KOG3617|consensus 1416 98.36
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.34
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.3
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.28
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.26
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.22
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.22
KOG2114|consensus 933 98.2
KOG2066|consensus 846 98.16
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.16
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.15
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.14
KOG2114|consensus 933 98.14
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.12
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.09
KOG1645|consensus463 98.09
KOG3621|consensus 726 98.08
KOG3621|consensus 726 98.06
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.04
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 98.02
KOG1645|consensus463 97.92
COG3391381 Uncharacterized conserved protein [Function unknow 97.9
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.89
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.88
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.88
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.88
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.88
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.86
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.81
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.8
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.8
COG3391381 Uncharacterized conserved protein [Function unknow 97.78
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.74
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.72
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.71
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.7
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.67
PRK13616591 lipoprotein LpqB; Provisional 97.56
PRK13684334 Ycf48-like protein; Provisional 97.47
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.47
PRK13684334 Ycf48-like protein; Provisional 97.41
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.39
KOG1008|consensus 783 97.38
KOG1008|consensus 783 97.32
KOG4640|consensus 665 97.31
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.29
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.25
PRK13616591 lipoprotein LpqB; Provisional 97.22
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.2
KOG2395|consensus644 97.18
PLN00033398 photosystem II stability/assembly factor; Provisio 97.14
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.12
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.12
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.06
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.99
KOG4441|consensus571 96.97
KOG4640|consensus 665 96.94
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.84
PHA02713557 hypothetical protein; Provisional 96.84
PRK10115686 protease 2; Provisional 96.82
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.79
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.78
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.78
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.74
KOG4499|consensus310 96.71
KOG2079|consensus 1206 96.69
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.68
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.67
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.65
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.64
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.63
KOG2395|consensus644 96.62
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.59
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.57
KOG2444|consensus238 96.5
COG1520370 FOG: WD40-like repeat [Function unknown] 96.44
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.41
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.4
PHA02713557 hypothetical protein; Provisional 96.25
PRK10115686 protease 2; Provisional 96.25
KOG4499|consensus310 96.22
COG3292 671 Predicted periplasmic ligand-binding sensor domain 96.21
COG3292671 Predicted periplasmic ligand-binding sensor domain 96.16
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.16
PF14727418 PHTB1_N: PTHB1 N-terminus 96.12
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 96.09
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.09
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.09
PF14727418 PHTB1_N: PTHB1 N-terminus 95.92
COG1520370 FOG: WD40-like repeat [Function unknown] 95.82
KOG4441|consensus571 95.68
KOG1898|consensus 1205 95.68
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.68
KOG2280|consensus 829 95.62
KOG2079|consensus 1206 95.59
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.49
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.46
KOG2444|consensus238 95.32
PF13449326 Phytase-like: Esterase-like activity of phytase 95.31
COG5276370 Uncharacterized conserved protein [Function unknow 95.2
KOG1916|consensus 1283 95.13
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.08
KOG2280|consensus 829 94.84
PHA03098534 kelch-like protein; Provisional 94.82
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.8
COG5276370 Uncharacterized conserved protein [Function unknow 94.59
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.58
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.54
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.49
PLN00033398 photosystem II stability/assembly factor; Provisio 94.46
PHA03098534 kelch-like protein; Provisional 94.29
KOG1898|consensus1205 94.22
COG5167776 VID27 Protein involved in vacuole import and degra 94.19
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.18
PLN02153341 epithiospecifier protein 93.8
KOG4659|consensus 1899 93.76
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.73
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.7
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.48
KOG3616|consensus 1636 93.36
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 93.27
COG4590 733 ABC-type uncharacterized transport system, permeas 93.26
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 93.16
KOG3630|consensus 1405 93.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 92.97
PRK14127109 cell division protein GpsB; Provisional 92.95
PHA02790480 Kelch-like protein; Provisional 92.84
KOG3630|consensus 1405 92.61
KOG2377|consensus 657 92.5
PHA02790480 Kelch-like protein; Provisional 92.06
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 91.9
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 91.76
KOG2247|consensus615 91.74
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 91.41
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.38
KOG1896|consensus 1366 91.37
KOG1900|consensus 1311 91.36
PLN02153341 epithiospecifier protein 91.24
KOG2377|consensus 657 91.21
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 91.09
COG5167776 VID27 Protein involved in vacuole import and degra 90.97
KOG3616|consensus 1636 90.91
PF13449326 Phytase-like: Esterase-like activity of phytase 90.91
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 90.81
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 90.19
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 90.17
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 90.06
COG4590 733 ABC-type uncharacterized transport system, permeas 89.95
KOG2247|consensus 615 89.9
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 89.74
PLN02193470 nitrile-specifier protein 89.61
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 89.45
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 89.41
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.35
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 89.15
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 89.06
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 88.79
COG290072 SlyX Uncharacterized protein conserved in bacteria 88.29
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 88.02
KOG1916|consensus 1283 87.46
PF1147160 Sugarporin_N: Maltoporin periplasmic N-terminal ex 87.41
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 87.41
KOG1896|consensus1366 87.16
PRK13613599 lipoprotein LpqB; Provisional 87.01
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 86.64
PRK0073668 hypothetical protein; Provisional 86.6
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 86.45
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 86.38
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 86.33
PRK0029568 hypothetical protein; Provisional 86.03
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 85.65
>KOG2106|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.8e-83  Score=643.54  Aligned_cols=581  Identities=53%  Similarity=1.027  Sum_probs=550.1

Q ss_pred             CCCcccCcCCCeEEEEEecCcceeeCCCCccccccccccCCCCCCCeEEEEEeeecCCCCccceEEccCCcEEEEeccEE
Q psy9770         203 AKDAQYNEEESSLRMYLRGRPINLYAPSDLAESYDITKVAAPPQNKLKLDWVYGYRGKDCRSNLYLLPTGEIVYFVAAVA  282 (811)
Q Consensus       203 ~~~~~~~~~~~~~~~~~~g~~~~~~~p~~~~~~~~~~~~~~~p~~~l~l~~v~g~~~~~~~~~l~~spdg~~l~~~~~~i  282 (811)
                      .|++.++.+++.++|+++|+++.|++|.+.+..|+ ..+..+|+.+++|+|+|||+|++|++|+++.|.|+++|+.++.+
T Consensus         9 ~ke~~~s~g~~~~~~F~~g~pv~v~vp~d~~~~y~-~~d~~~P~~kl~LewvygYRG~dcR~Nly~lptgE~vyfvA~V~   87 (626)
T KOG2106|consen    9 LKECFFSNGEGNYKNFSRGRPVLVSVPVDPEHTYP-MADVELPTEKLKLEWVYGYRGVDCRNNLYLLPTGELVYFVAAVG   87 (626)
T ss_pred             ccceEecCCceeeEEEecCCcEEEEcCCCccccCC-hhhccCcccCceeEEEEeecceeeeceeEEccCccEEEEeccEE
Confidence            46899999999999999999999999999888887 66779999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCceEEeccCCCCeEEEEEcCCCcEEEEeeccCCCCCCCCCeEEEEeCCCCcEEEEeccCCccccEEEEEEecC
Q psy9770         283 VLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKA  362 (811)
Q Consensus       283 ~i~d~~~~~~~~~~~h~~~V~~la~spdg~~Lasg~~dg~~~~~~~~~I~iWd~~t~~~~~~l~~~~h~~~V~~l~fs~~  362 (811)
                      ++|+.++..|+++.||+..|.|+++|||..++|+|...|.++++.+|+|+|||..+...++.+.  ..+..|.|++||+.
T Consensus        88 Vl~n~ee~~Qr~y~GH~ddikc~~vHPdri~vatGQ~ag~~g~~~~phvriWdsv~L~TL~V~g--~f~~GV~~vaFsk~  165 (626)
T KOG2106|consen   88 VLYNWEERSQRHYLGHNDDIKCMAVHPDRIRVATGQGAGTSGRPLQPHVRIWDSVTLSTLHVIG--FFDRGVTCVAFSKI  165 (626)
T ss_pred             EEEeehhhhcccccCCCCceEEEeecCCceeeccCcccccCCCcCCCeeeecccccceeeeeec--cccccceeeeeccc
Confidence            9999999999999999999999999999999999999998889999999999999999999987  88999999999999


Q ss_pred             CCCcEEEEEeCCCCceEEEEEcccCCCcceEEEeeeCCCcEEEEEecCCCCCeEEEECCCcEEEEEEcCCceeeeecccc
Q psy9770         363 DGGTFLCAVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIF  442 (811)
Q Consensus       363 ~dg~~Lasv~~s~d~~i~vWd~~~~~~~~~~~~~~~~~~~V~~v~fsp~~~~ll~~~~d~~i~iwd~~~~~~~~~~~~~~  442 (811)
                      +.|.+|+.++.+.+..+.||||+.+.   .....++.++.|..+.|+|.+.+++++++.+++.+|+++ +..+.+.+++|
T Consensus       166 ~~G~~l~~vD~s~~h~lSVWdWqk~~---~~~~vk~sne~v~~a~FHPtd~nliit~Gk~H~~Fw~~~-~~~l~k~~~~f  241 (626)
T KOG2106|consen  166 NGGSLLCAVDDSNPHMLSVWDWQKKA---KLGPVKTSNEVVFLATFHPTDPNLIITCGKGHLYFWTLR-GGSLVKRQGIF  241 (626)
T ss_pred             CCCceEEEecCCCccccchhhchhhh---ccCcceeccceEEEEEeccCCCcEEEEeCCceEEEEEcc-CCceEEEeecc
Confidence            99999999999999999999999999   888999999999999999999999999999999999999 77888899999


Q ss_pred             cccCCCCceEEEEEEcCCCcEEEEcCCCcEEEEecCCceEEEEeecccccceEEEEEecCCcEEEEecCCCcEEEEeCCC
Q psy9770         443 EMIRDKPKYVTCLAFTQGGEVLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNL  522 (811)
Q Consensus       443 ~~l~~~~~~v~~l~~s~~g~llsg~~dg~I~vwd~~~~~~~~~~~~~h~~~V~~l~~s~dg~~l~s~s~dg~I~~wd~~~  522 (811)
                      ++ ++. +.|.|++|.++|++++|.++|.|.||+..+.+..+... +|++.|.+++...+|.+|. |+.|+.|..||-+.
T Consensus       242 ek-~ek-k~Vl~v~F~engdviTgDS~G~i~Iw~~~~~~~~k~~~-aH~ggv~~L~~lr~GtllS-GgKDRki~~Wd~~y  317 (626)
T KOG2106|consen  242 EK-REK-KFVLCVTFLENGDVITGDSGGNILIWSKGTNRISKQVH-AHDGGVFSLCMLRDGTLLS-GGKDRKIILWDDNY  317 (626)
T ss_pred             cc-ccc-eEEEEEEEcCCCCEEeecCCceEEEEeCCCceEEeEee-ecCCceEEEEEecCccEee-cCccceEEeccccc
Confidence            98 666 99999999999999999999999999999999988888 9999999999999998877 99999999999666


Q ss_pred             CCccceeeeccccCCeEEEeeCCCCeEEEEeCCCeEEEEEccCCceeeeeecccceEEEEECCCCCeEEEEECCCeEEEE
Q psy9770         523 QPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLW  602 (811)
Q Consensus       523 ~~~~~~~~~~~~~~~v~~l~~~~~~~l~~~~~~~~i~~~d~~~~~~~~~~~h~~~v~~l~~sp~~~~l~s~s~dg~v~iw  602 (811)
                      ++. ...++++..++++.++....+ +++|+..+.|..-.+++++.....+|.+..+.++.+|+.+++++++.|+.+++|
T Consensus       318 ~k~-r~~elPe~~G~iRtv~e~~~d-i~vGTtrN~iL~Gt~~~~f~~~v~gh~delwgla~hps~~q~~T~gqdk~v~lW  395 (626)
T KOG2106|consen  318 RKL-RETELPEQFGPIRTVAEGKGD-ILVGTTRNFILQGTLENGFTLTVQGHGDELWGLATHPSKNQLLTCGQDKHVRLW  395 (626)
T ss_pred             ccc-ccccCchhcCCeeEEecCCCc-EEEeeccceEEEeeecCCceEEEEecccceeeEEcCCChhheeeccCcceEEEc
Confidence            666 789999999999999977766 999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCcEEEEecCCCCeEEEEEcCCCCEEEEEEeCCeEEEEecCCcceeEEecCCCCCeEEEEEccCCCEEEEEecCCcE
Q psy9770         603 DSMSHSVVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYI  682 (811)
Q Consensus       603 d~~~~~~~~~~~~~~~v~~~~~spdg~~la~g~~dg~i~i~d~~~~~~~~~~~~~~~~i~~i~~spdg~~lasgs~dg~I  682 (811)
                      +  ..++++......++.|+.|+|.| .+|+|+..|.+.+.|.++...+..... ++++++++|+|+|.+||.|+.|+.|
T Consensus       396 ~--~~k~~wt~~~~d~~~~~~fhpsg-~va~Gt~~G~w~V~d~e~~~lv~~~~d-~~~ls~v~ysp~G~~lAvgs~d~~i  471 (626)
T KOG2106|consen  396 N--DHKLEWTKIIEDPAECADFHPSG-VVAVGTATGRWFVLDTETQDLVTIHTD-NEQLSVVRYSPDGAFLAVGSHDNHI  471 (626)
T ss_pred             c--CCceeEEEEecCceeEeeccCcc-eEEEeeccceEEEEecccceeEEEEec-CCceEEEEEcCCCCEEEEecCCCeE
Confidence            9  88899999999999999999999 999999999999999999888887777 8999999999999999999999999


Q ss_pred             EEEEecCCCcceeEEEEecCCCCCeeEEEeCCCCCeEEEecCCceEEEEECCCCcccCCCCCccceeEeccceeecccee
Q psy9770         683 YVYEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWNAGTCRQIPQSSQLRDVVWESNSCTLTFTTI  762 (811)
Q Consensus       683 ~iwd~~~~~~~~~~~~~~~~h~~~V~~l~~spdg~~L~s~s~Dg~i~iWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  762 (811)
                      +||.+..++..+..+.++.+  .+|+.|.||+|+++|.+.+.|..|.+|....++++..   +++++|.++.|.++|.+.
T Consensus       472 yiy~Vs~~g~~y~r~~k~~g--s~ithLDwS~Ds~~~~~~S~d~eiLyW~~~~~~~~ts---~kDvkW~t~~c~lGF~v~  546 (626)
T KOG2106|consen  472 YIYRVSANGRKYSRVGKCSG--SPITHLDWSSDSQFLVSNSGDYEILYWKPSECKQITS---VKDVKWATYTCTLGFEVF  546 (626)
T ss_pred             EEEEECCCCcEEEEeeeecC--ceeEEeeecCCCceEEeccCceEEEEEccccCcccce---ecceeeeeeEEEEEEEEe
Confidence            99999999999999888887  9999999999999999999999999997666666554   899999999999999998


Q ss_pred             eeCCCCCCCCccceEEecCCCCEEEEEcCCCcEEEEeCCCCCCCCcc
Q psy9770         763 GIWPEGADGTDVNSCERSHDARVIATGDDFGKLKLYSYPAVQPKLCL  809 (811)
Q Consensus       763 ~i~~~~~h~~~I~~l~~s~dg~~Las~~~dg~v~vw~~~~~~~~~~~  809 (811)
                      +    +.|++.|++++.+.+.++||+|++.|+|++|.||+.+++|.+
T Consensus       547 g----~s~~t~i~a~~rs~~~~~lA~gdd~g~v~lf~yPc~s~rA~~  589 (626)
T KOG2106|consen  547 G----GSDGTDINAVARSHCEKLLASGDDFGKVHLFSYPCSSPRAPS  589 (626)
T ss_pred             c----ccCCchHHHhhhhhhhhhhhccccCceEEEEccccCCCcccc
Confidence            7    778999999999999999999999999999999999998865

>KOG0318|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF03451 HELP: HELP motif; InterPro: IPR005108 The HELP (Hydrophobic ELP) domain is found in EMAP and EMAP-like proteins (ELPs) [, ] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF11471 Sugarporin_N: Maltoporin periplasmic N-terminal extension; InterPro: IPR021570 This N-terminal domain is found in members of the sugar porin family 1 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query811
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 2e-12
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 3e-07
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-08
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-08
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-08
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-08
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-08
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-08
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-08
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-08
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-08
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-08
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-08
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-08
2gnq_A336 Structure Of Wdr5 Length = 336 1e-08
2h9l_A329 Wdr5delta23 Length = 329 1e-08
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-08
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-08
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-08
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-07
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 2e-07
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 2e-05
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 3e-05
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-05
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 5e-05
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 5e-05
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 8e-05
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-04
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-04
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-04
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 4e-04
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 4e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 5e-04
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 5e-04
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 6e-04
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 7e-04
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 8e-04
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 9e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 95/468 (20%), Positives = 180/468 (38%), Gaps = 44/468 (9%)
Query: 270 PTGEIVYFVA--AVAVLYNVEEQTQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREG 327
           P G+ +   +      L+N   Q  +   GH+  +  ++  P+   IA+       A + 
Sbjct: 149 PDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIAS-------ASDD 201
Query: 328 KPHIRIWNSVSLFTVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGNDYNISVWDWQKS 387
           K  +++WN       ++ G      S+  ++FS  DG T   A D   D  + +W+    
Sbjct: 202 KT-VKLWNRNGQLLQTLTG---HSSSVRGVAFSP-DGQTIASASD---DKTVKLWN---- 249
Query: 388 DRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQG-IFEMIR 446
             G  +        +V    F P D   I +           D    L+ + G + + + 
Sbjct: 250 RNGQLLQTLTGHSSSVNGVAFRP-DGQTIASASD--------DKTVKLWNRNGQLLQTLT 300
Query: 447 DKPKYVTCLAFTQGGEVLSGDSNGNII-VWTRGSNTISKFIRNVHEGSVFSICVLKEGSI 505
                V  +AF+  G+ ++  S+   + +W R    +       H  SV+ +    +G  
Sbjct: 301 GHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQHLQTLTG--HSSSVWGVAFSPDGQT 358
Query: 506 ISAGGKDGRLLQFDSNLQPTGYEAQIAEHLGGIRTVSEGRGSQLIVGTTRN-CILVGSLN 564
           I++   D  +  ++ N Q       +  H   +R V+     Q I   + +  + + + N
Sbjct: 359 IASASDDKTVKLWNRNGQ---LLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRN 415
Query: 565 LGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSKDIAEQAQSATF 624
                 + GH+  +W +A  P      +A  D+ V+LW+     +      +   +   F
Sbjct: 416 GQLLQTLTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAF 475
Query: 625 SPDGSIIIVGCIAGRWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYV 684
           SPDG  I       + + + +   +     T  +  ++ V FSPDG+ +A  S D  + +
Sbjct: 476 SPDGQTI-ASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKL 534
Query: 685 YEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWN 732
           +      R    +   TGHSS +  + +S D   I S S D  +  WN
Sbjct: 535 WN-----RNGQLLQTLTGHSSSVWGVAFSPDGQTIASASSDKTVKLWN 577
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query811
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1k32_A 1045 Tricorn protease; protein degradation, substrate g 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1k32_A 1045 Tricorn protease; protein degradation, substrate g 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.98
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.98
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.98
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.94
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.94
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.93
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.93
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.93
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.92
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.92
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.91
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.91
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.88
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.87
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.87
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.86
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.86
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.86
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.86
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.86
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.86
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.85
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.84
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.83
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.83
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.82
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.8
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.8
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.8
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.8
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.78
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.78
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.76
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.76
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.73
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.72
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.71
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.71
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.7
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.69
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.69
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.67
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.66
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.66
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.66
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.65
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.63
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.63
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.6
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.6
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.6
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.6
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.59
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.58
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.58
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.57
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.56
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.55
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.55
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.54
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.53
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.51
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.5
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.49
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.48
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.46
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.45
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.41
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.4
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.38
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.38
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.37
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.35
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.35
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.33
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.32
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.31
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.3
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.3
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.3
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.29
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.28
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.28
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.27
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.26
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.26
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.23
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.23
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.22
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.22
2qe8_A343 Uncharacterized protein; structural genomics, join 99.19
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.19
2qe8_A343 Uncharacterized protein; structural genomics, join 99.18
2ece_A462 462AA long hypothetical selenium-binding protein; 99.13
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.13
3ott_A758 Two-component system sensor histidine kinase; beta 99.06
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.02
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.02
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.0
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.99
2ece_A462 462AA long hypothetical selenium-binding protein; 98.99
3ott_A758 Two-component system sensor histidine kinase; beta 98.98
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.97
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.97
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.95
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.92
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.91
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.9
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.89
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.86
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.86
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.86
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.85
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.82
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.81
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.79
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.79
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.78
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.76
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.62
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.6
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.6
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.57
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.55
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.54
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.54
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.52
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.52
3v65_B386 Low-density lipoprotein receptor-related protein; 98.51
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.47
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.41
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.4
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.4
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.37
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.34
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.34
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.3
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.29
3v65_B386 Low-density lipoprotein receptor-related protein; 98.28
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.28
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.2
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.19
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.18
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.16
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.09
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.08
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.04
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.04
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.03
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.98
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.9
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.88
3kya_A496 Putative phosphatase; structural genomics, joint c 97.87
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.84
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.84
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.79
3kya_A496 Putative phosphatase; structural genomics, joint c 97.77
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.74
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.71
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.69
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.68
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.59
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.54
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.5
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.48
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.46
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.44
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.44
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.35
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.23
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.15
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.12
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.05
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.03
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.0
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.96
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.86
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.84
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.76
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.73
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.67
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 96.67
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.65
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.63
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.61
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.59
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.58
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.57
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.55
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.54
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.53
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.37
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.36
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.28
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.24
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.16
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 95.78
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.7
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 94.83
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 94.76
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.61
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 94.57
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 94.36
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 94.23
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 93.89
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 92.46
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-i 90.54
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 90.3
3a0f_A 763 Xyloglucanase; beta-propeller, hydrolase; 2.50A {G 90.12
1zxa_A67 CGMP-dependent protein kinase 1, alpha isozyme; pa 90.09
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 88.74
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 88.59
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 86.54
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 85.76
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 85.4
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 83.88
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 83.29
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 80.99
3ghg_A562 Fibrinogen alpha chain; triple-stranded coiled coi 80.77
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=7.4e-62  Score=566.17  Aligned_cols=487  Identities=17%  Similarity=0.257  Sum_probs=398.3

Q ss_pred             CCccceEEccCCcEEEEe-ccEEEEEeCCCC-ceEEeccCCCCeEEEEEcCCCcEEEEeeccCCCCCCCCCeEEEEeCCC
Q psy9770         261 DCRSNLYLLPTGEIVYFV-AAVAVLYNVEEQ-TQRHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVS  338 (811)
Q Consensus       261 ~~~~~l~~spdg~~l~~~-~~~i~i~d~~~~-~~~~~~~h~~~V~~la~spdg~~Lasg~~dg~~~~~~~~~I~iWd~~t  338 (811)
                      .....++|+|||++|+++ ++.|.||++.++ ....+.+|...|++++|+|||++||+|+.|+        +|+|||+.+
T Consensus        19 g~~~~~~~spdg~~l~~~~~~~v~l~~~~~~~~~~~~~~h~~~v~~~~~spdg~~lasg~~d~--------~v~lWd~~~   90 (611)
T 1nr0_A           19 GTAVVLGNTPAGDKIQYCNGTSVYTVPVGSLTDTEIYTEHSHQTTVAKTSPSGYYCASGDVHG--------NVRIWDTTQ   90 (611)
T ss_dssp             TCCCCCEECTTSSEEEEEETTEEEEEETTCSSCCEEECCCSSCEEEEEECTTSSEEEEEETTS--------EEEEEESSS
T ss_pred             CceeEEeeCCCCCEEEeCCCCEEEEecCCCcccCeEecCCCCceEEEEECCCCcEEEEEeCCC--------CEEEeECCC
Confidence            345789999999877766 479999999865 4577899999999999999999999999999        999999976


Q ss_pred             Cc--EEEEeccCCccccEEEEEEecCCCCcEEEEEeCCCC--ceEEEEEcccCCCcceEEEeeeCCCcEEEEEecCCCCC
Q psy9770         339 LF--TVSIIGIGEFERSISCLSFSKADGGTFLCAVDEGND--YNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRN  414 (811)
Q Consensus       339 ~~--~~~~l~~~~h~~~V~~l~fs~~~dg~~Lasv~~s~d--~~i~vWd~~~~~~~~~~~~~~~~~~~V~~v~fsp~~~~  414 (811)
                      ++  ....+.  +|.+.|.+++|+|  +|++|++.+...+  +.|++||  .++   .+..+.+|...|.+++|+|++..
T Consensus        91 ~~~~~~~~~~--~~~~~v~~v~fs~--dg~~l~~~~~~~~~~~~v~~wd--~~~---~~~~l~gh~~~v~~v~f~p~~~~  161 (611)
T 1nr0_A           91 TTHILKTTIP--VFSGPVKDISWDS--ESKRIAAVGEGRERFGHVFLFD--TGT---SNGNLTGQARAMNSVDFKPSRPF  161 (611)
T ss_dssp             TTCCEEEEEE--CSSSCEEEEEECT--TSCEEEEEECCSSCSEEEEETT--TCC---BCBCCCCCSSCEEEEEECSSSSC
T ss_pred             CcceeeEeec--ccCCceEEEEECC--CCCEEEEEECCCCceeEEEEee--CCC---CcceecCCCCCceEEEECCCCCe
Confidence            54  344554  8999999999999  8999998644444  3555555  566   67788999999999999998876


Q ss_pred             -eEEEECCCcEEEEEEcCCceeeeecccccccCCCCceEEEEEEcCCCc-EEEEcCCCcEEEEecCCceEEEEeec----
Q psy9770         415 -NIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKPKYVTCLAFTQGGE-VLSGDSNGNIIVWTRGSNTISKFIRN----  488 (811)
Q Consensus       415 -ll~~~~d~~i~iwd~~~~~~~~~~~~~~~~l~~~~~~v~~l~~s~~g~-llsg~~dg~I~vwd~~~~~~~~~~~~----  488 (811)
                       +++++.|+.|++|+..+++.+..+       .+|...|.+++|+|+|+ +++|+.||.|++||+.+++....+..    
T Consensus       162 ~l~s~s~D~~v~lwd~~~~~~~~~l-------~~H~~~V~~v~fspdg~~las~s~D~~i~lwd~~~g~~~~~~~~~~~~  234 (611)
T 1nr0_A          162 RIISGSDDNTVAIFEGPPFKFKSTF-------GEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLK  234 (611)
T ss_dssp             EEEEEETTSCEEEEETTTBEEEEEE-------CCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECBCTTSS
T ss_pred             EEEEEeCCCeEEEEECCCCeEeeee-------ccccCceEEEEECCCCCEEEEEECCCcEEEEECCCCcEeeeecccccc
Confidence             555566899999998754443332       66888999999999998 56999999999999999988887743    


Q ss_pred             --ccccceEEEEEecCCcEEEEecCCCcEEEEeCCCCCccceeeec-cccCCeEEEeeCCCCeEEEEeCCCeEEEEEccC
Q psy9770         489 --VHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYEAQIA-EHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNL  565 (811)
Q Consensus       489 --~h~~~V~~l~~s~dg~~l~s~s~dg~I~~wd~~~~~~~~~~~~~-~~~~~v~~l~~~~~~~l~~~~~~~~i~~~d~~~  565 (811)
                        +|.+.|.+++|+|+|++|++++.|++|++||+.+.+........ .+...+..+.+ .+..+++++.++.+++|+...
T Consensus       235 ~~~h~~~V~~v~~spdg~~l~s~s~D~~v~lWd~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~s~s~d~~i~~~~~~~  313 (611)
T 1nr0_A          235 NVAHSGSVFGLTWSPDGTKIASASADKTIKIWNVATLKVEKTIPVGTRIEDQQLGIIW-TKQALVSISANGFINFVNPEL  313 (611)
T ss_dssp             SCSSSSCEEEEEECTTSSEEEEEETTSEEEEEETTTTEEEEEEECCSSGGGCEEEEEE-CSSCEEEEETTCCEEEEETTT
T ss_pred             ccccCCCEEEEEECCCCCEEEEEeCCCeEEEEeCCCCceeeeecCCCCccceeEEEEE-cCCEEEEEeCCCcEEEEeCCC
Confidence              69999999999999999999999999999999876652222211 12233445555 567889999999999999887


Q ss_pred             C-ceeeeeecccceEEEEECCCCCeEEEEECCCeEEEEeCCCCcEEEEe-------------------------------
Q psy9770         566 G-FSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWSK-------------------------------  613 (811)
Q Consensus       566 ~-~~~~~~~h~~~v~~l~~sp~~~~l~s~s~dg~v~iwd~~~~~~~~~~-------------------------------  613 (811)
                      + ....+.+|...|.+++|+|++++|++++.|++|++||+.+++....+                               
T Consensus       314 ~~~~~~~~gh~~~v~~l~~spdg~~l~s~s~D~~v~~Wd~~~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d~~v~~w  393 (611)
T 1nr0_A          314 GSIDQVRYGHNKAITALSSSADGKTLFSADAEGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVV  393 (611)
T ss_dssp             TEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEECSSCSCSSCEEEEEECTTSCEEEEETTTEEEEE
T ss_pred             CCcceEEcCCCCCEEEEEEeCCCCEEEEEeCCCcEEEEECCCCceeeecccCCcceEEEEEECCCCcEEEEEcCCceEEe
Confidence            6 34556799999999999999999999999999999998765432211                               


Q ss_pred             ----------------------------------------------------cCCCCeEEEEEcCCCCEEEEEEeCCeEE
Q psy9770         614 ----------------------------------------------------DIAEQAQSATFSPDGSIIIVGCIAGRWL  641 (811)
Q Consensus       614 ----------------------------------------------------~~~~~v~~~~~spdg~~la~g~~dg~i~  641 (811)
                                                                          .+...+.+++|+|||++||+|+.|+.|+
T Consensus       394 ~~~~~~~~~~~~~~~~~~~~~~~~~~s~dg~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~va~spdg~~lasgs~D~~v~  473 (611)
T 1nr0_A          394 PAGGSGVDSSKAVANKLSSQPLGLAVSADGDIAVAACYKHIAIYSHGKLTEVPISYNSSCVALSNDKQFVAVGGQDSKVH  473 (611)
T ss_dssp             CSSSSSSCTTSCCEEECSSCEEEEEECTTSSCEEEEESSEEEEEETTEEEEEECSSCEEEEEECTTSCEEEEEETTSEEE
T ss_pred             ecCCccccccceeeeecCCCCcEEEEeCCCcEEEEEeCceEEEEeCCceeeeecCCCceEEEEeCCCCEEEEeCCCCeEE
Confidence                                                                1123467899999999999999999999


Q ss_pred             EEecCCcce--eEEecCCCCCeEEEEEccCCCEEEEEecCCcEEEEEecCCCcceeEEEE--ecCCCCCeeEEEeCCCCC
Q psy9770         642 VMDSETREA--YSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYVYEVSGDSRKYSRVGR--CTGHSSFITHLDWSEDSM  717 (811)
Q Consensus       642 i~d~~~~~~--~~~~~~~~~~i~~i~~spdg~~lasgs~dg~I~iwd~~~~~~~~~~~~~--~~~h~~~V~~l~~spdg~  717 (811)
                      +||+.++..  +.. .+|...|++++|+|||++||+++.|+.|++|++.++.   +.+..  +.+|...|++++|+|||+
T Consensus       474 lwd~~~~~~~~~~~-~~h~~~v~~v~fspdg~~las~s~d~~v~~w~~~~~~---~~~~~~~~~~H~~~V~~v~fspdg~  549 (611)
T 1nr0_A          474 VYKLSGASVSEVKT-IVHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANNF---ELAHTNSWTFHTAKVACVSWSPDNV  549 (611)
T ss_dssp             EEEEETTEEEEEEE-EECSSCEEEEEECTTSSEEEEEETTSCEEEEEGGGTT---EESCCCCCCCCSSCEEEEEECTTSS
T ss_pred             EEEccCCceeeeec-cCCCCceEEEEECCCCCEEEEEcCCCCEEEEEcCCCC---ceeeeeeeeecccceeEEEECCCCC
Confidence            999987653  233 6788999999999999999999999999999998732   22222  345999999999999999


Q ss_pred             eEEEecCCceEEEEECCCCcccC-CCCCccceeEeccceeeccceeeeCCCCCC-CCccceEEecCCCCEEEEEcCCCcE
Q psy9770         718 YIRSNSGDYELLYWNAGTCRQIP-QSSQLRDVVWESNSCTLTFTTIGIWPEGAD-GTDVNSCERSHDARVIATGDDFGKL  795 (811)
Q Consensus       718 ~L~s~s~Dg~i~iWd~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~i~~~~~h-~~~I~~l~~s~dg~~Las~~~dg~v  795 (811)
                      +|++++.|++|++||+.+++... .                        ...+| ...|++++|+||++ |++++.||+|
T Consensus       550 ~lasgs~D~~v~lW~~~~~~~~~~~------------------------~~~~h~~~~v~~v~fs~d~~-l~s~~~D~~i  604 (611)
T 1nr0_A          550 RLATGSLDNSVIVWNMNKPSDHPII------------------------IKGAHAMSSVNSVIWLNETT-IVSAGQDSNI  604 (611)
T ss_dssp             EEEEEETTSCEEEEETTCTTSCCEE------------------------ETTSSTTSCEEEEEEEETTE-EEEEETTSCE
T ss_pred             EEEEEECCCcEEEEECCCcccccch------------------------hhccCcccCeeEEEEcCCCE-EEEecCCCCE
Confidence            99999999999999998765221 0                        01246 67899999999998 9999999999


Q ss_pred             EEEeCC
Q psy9770         796 KLYSYP  801 (811)
Q Consensus       796 ~vw~~~  801 (811)
                      ++|+++
T Consensus       605 ~lW~~~  610 (611)
T 1nr0_A          605 KFWNVP  610 (611)
T ss_dssp             EEEECC
T ss_pred             EEEecc
Confidence            999985
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3a0f_A Xyloglucanase; beta-propeller, hydrolase; 2.50A {Geotrichum SP} Back     alignment and structure
>1zxa_A CGMP-dependent protein kinase 1, alpha isozyme; parallel coiled coil dimer, transferase; NMR {Homo sapiens} Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 811
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-16
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-07
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-16
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-13
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-10
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-05
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-12
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 9e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-11
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-05
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.001
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.001
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-06
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-07
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 6e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-07
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.003
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-06
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 7e-05
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.001
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 79.4 bits (194), Expect = 2e-16
 Identities = 53/288 (18%), Positives = 96/288 (33%), Gaps = 12/288 (4%)

Query: 452 VTCLAFTQGGEVL-SGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGG 510
           +  + +     +L S   +G +I+W   +      I  +    V +      G+ ++ GG
Sbjct: 58  IYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAI-PLRSSWVMTCAYAPSGNYVACGG 116

Query: 511 KDGRLLQFDSNLQPTGYE---AQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGF 567
            D     ++   +                            +       C L        
Sbjct: 117 LDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQ 176

Query: 568 SPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHSVVWS-KDIAEQAQSATFSP 626
           +    GHT ++ +L+  P    F++   D   +LWD        +         +  F P
Sbjct: 177 TTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFP 236

Query: 627 DGSIIIVGCIAG--RWLVMDSETREAYSIHTDGNEPIQVVKFSPDGKLLALGSRDNYIYV 684
           +G+    G      R   + ++       H +    I  V FS  G+LL  G  D    V
Sbjct: 237 NGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNV 296

Query: 685 YEVSGDSRKYSRVGRCTGHSSFITHLDWSEDSMYIRSNSGDYELLYWN 732
           +    D+ K  R G   GH + ++ L  ++D M + + S D  L  WN
Sbjct: 297 W----DALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query811
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.9
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.9
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.9
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.89
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.87
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.86
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.85
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.81
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.78
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.78
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.76
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.7
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.62
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.59
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.57
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.53
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.5
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.25
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.23
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.22
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.13
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.08
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.07
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.04
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.03
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.01
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.0
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.98
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.96
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.95
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.94
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.91
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.83
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.81
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.63
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.53
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.52
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.21
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.02
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.02
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.96
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.95
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.95
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.89
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.8
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.79
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.76
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.69
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.66
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.64
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.64
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.62
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.62
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.58
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.55
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.46
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.38
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.06
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.92
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.24
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.1
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.79
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 93.65
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 92.71
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 91.67
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 91.67
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.42
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 90.86
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 90.42
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 88.53
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 88.15
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 84.98
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.4e-37  Score=326.74  Aligned_cols=287  Identities=15%  Similarity=0.253  Sum_probs=248.6

Q ss_pred             EEeccCCCCeEEEEEcCCCcEEEEeeccCCCCCCCCCeEEEEeCCCCcE---EEEeccCCccccEEEEEEecCCCCcEEE
Q psy9770         293 RHYLGHTDDIKCLSIHPNKLLIATGQVAGHDAREGKPHIRIWNSVSLFT---VSIIGIGEFERSISCLSFSKADGGTFLC  369 (811)
Q Consensus       293 ~~~~~h~~~V~~la~spdg~~Lasg~~dg~~~~~~~~~I~iWd~~t~~~---~~~l~~~~h~~~V~~l~fs~~~dg~~La  369 (811)
                      .+..+|...|.|++|+|+|++||+|+ ||        .|+|||+.++..   +..+...+|...|.+++|+|  +|++|+
T Consensus        45 ~~~~~H~~~V~~v~fs~~g~~latg~-dg--------~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~--dg~~l~  113 (337)
T d1gxra_          45 INTLNHGEVVCAVTISNPTRHVYTGG-KG--------CVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP--DGCTLI  113 (337)
T ss_dssp             EEEECCSSCCCEEEECSSSSEEEEEC-BS--------EEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECT--TSSEEE
T ss_pred             EEECCCCCcEEEEEECCCCCEEEEEE-CC--------EEEEEEccCCcccceeEEeeecCCCCcEEEEEEcC--CCCEEE
Confidence            34558999999999999999999997 78        999999976532   33333458999999999999  899999


Q ss_pred             EEeCCCCceEEEEEcccCCCcceEEEeeeCCCcEEEEEecCCCCCeEEEECCCcEEEEEEcCCceeeeecccccccCCCC
Q psy9770         370 AVDEGNDYNISVWDWQKSDRGHKITETKCSVDTVVAAEFHPLDRNNIVTCGKSHINFWTIDAGGTLYKKQGIFEMIRDKP  449 (811)
Q Consensus       370 sv~~s~d~~i~vWd~~~~~~~~~~~~~~~~~~~V~~v~fsp~~~~ll~~~~d~~i~iwd~~~~~~~~~~~~~~~~l~~~~  449 (811)
                      +  ++.|+.|++||+.... ......+..|...+..++|+|++..+++++.++.|++|++.++......       ..|.
T Consensus       114 s--~~~dg~i~iwd~~~~~-~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~-------~~~~  183 (337)
T d1gxra_         114 V--GGEASTLSIWDLAAPT-PRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQF-------QGHT  183 (337)
T ss_dssp             E--EESSSEEEEEECCCC---EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEE-------CCCS
T ss_pred             E--eecccccccccccccc-ccccccccccccccccccccccccccccccccccccccccccccccccc-------cccc
Confidence            8  7899999999987554 1156678889999999999998888887888999999999866554433       5567


Q ss_pred             ceEEEEEEcCCCc-EEEEcCCCcEEEEecCCceEEEEeecccccceEEEEEecCCcEEEEecCCCcEEEEeCCCCCccce
Q psy9770         450 KYVTCLAFTQGGE-VLSGDSNGNIIVWTRGSNTISKFIRNVHEGSVFSICVLKEGSIISAGGKDGRLLQFDSNLQPTGYE  528 (811)
Q Consensus       450 ~~v~~l~~s~~g~-llsg~~dg~I~vwd~~~~~~~~~~~~~h~~~V~~l~~s~dg~~l~s~s~dg~I~~wd~~~~~~~~~  528 (811)
                      ..+.+++|++++. +++++.||.|++||+.+++.+..+.  |...|.+++|+|++++|++++.|+.|++||++....   
T Consensus       184 ~~v~~l~~s~~~~~~~~~~~d~~v~i~d~~~~~~~~~~~--~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~---  258 (337)
T d1gxra_         184 DGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHD--FTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDK---  258 (337)
T ss_dssp             SCEEEEEECTTSSEEEEEETTSEEEEEETTTTEEEEEEE--CSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCE---
T ss_pred             cccccccccccccccccccccccccccccccceeecccc--cccceEEEEEcccccccceecccccccccccccccc---
Confidence            7899999999998 5689999999999999999888774  899999999999999999999999999999876543   


Q ss_pred             eeeccccCCeEEEeeCCCCeEEEEeCCCeEEEEEccCCceeeeeecccceEEEEECCCCCeEEEEECCCeEEEEeCCCCc
Q psy9770         529 AQIAEHLGGIRTVSEGRGSQLIVGTTRNCILVGSLNLGFSPVVLGHTDELWALAAHPSLSQFLTAGFDRIVQLWDSMSHS  608 (811)
Q Consensus       529 ~~~~~~~~~v~~l~~~~~~~l~~~~~~~~i~~~d~~~~~~~~~~~h~~~v~~l~~sp~~~~l~s~s~dg~v~iwd~~~~~  608 (811)
                                                              .....|...|.+++|+|++++|++++.|+.|++||+.+++
T Consensus       259 ----------------------------------------~~~~~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~  298 (337)
T d1gxra_         259 ----------------------------------------YQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGA  298 (337)
T ss_dssp             ----------------------------------------EEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCC
T ss_pred             ----------------------------------------ccccccccccceEEECCCCCEEEEEeCCCeEEEEECCCCC
Confidence                                                    1223578889999999999999999999999999999999


Q ss_pred             EEEEecCCCCeEEEEEcCCCCEEEEEEeCCeEEEEec
Q psy9770         609 VVWSKDIAEQAQSATFSPDGSIIIVGCIAGRWLVMDS  645 (811)
Q Consensus       609 ~~~~~~~~~~v~~~~~spdg~~la~g~~dg~i~i~d~  645 (811)
                      .+....+...|.+++|+|++++|++|+.||.|+|||+
T Consensus       299 ~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         299 SIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             EEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             EEEEccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence            9999999999999999999999999999999999996
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure