Psyllid ID: psy9828

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIELENMMEESDSKKCSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKLNSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAIKFSANYDPSTKPLRSVSNAGDTLATSSPSGGSKYPPPSGPGAPPDLPPRIDRTNKPPRTNPPRSATERLFGRERESSVSKDGGGEAPNYINATPHRTGAPPTNTSLERHNTTRTTI
cccccccHHHHHHHHcccccEEEEEEEccHHHHHHHHHccccccccEEEEccccccccccccccccccHHHHHHHHHcccccccccccEEEEHHHHHHHHcccEEEEEccccHHHHHHHcccccEEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccc
cccccccHHHHHHHHHccccHEEEEEcccccHHHHHHEcccccccEEEEEcccccccHHHHHHccccEEEEEccccccccccccccccEEEEcHHHHHHHccccEEEEccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVAsqrgdsfhikthfnydqpekgemsfrkgdVFHVIELENmmeesdskkcsgiIRLSAIRDMMDRgrhgllditpnavdrlnyaqfYPIVIFLRAETKSNVKELRagipklnsaqFFSVVIFLRAETKSNVKELRAGIPNYIKTISLinfngsspsqaikfsanydpstkplrsvsnagdtlatsspsggskypppsgpgappdlppridrtnkpprtnpprsaterlfgreressvskdgggeapnyinatphrtgapptntslerhnttrtti
MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVAsqrgdsfhikTHFNydqpekgemsFRKGDVFHVIELEnmmeesdskkcsGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRagipklnsaqFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAIKFSANYDPSTKPLRSVSNAGDTLATsspsggskypppsGPGAPPDLPPRIdrtnkpprtnpprsaterlfgreressvskdgggeapnyinatphrtgapptntslerhnttrtti
MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIELENMMEESDSKKCSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKLNSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAIKFSANYDPSTKPLRSVSNAGDTLATsspsggskypppsgpgappdlppRIDrtnkpprtnpprSATERLFGRERESSVSKDGGGEAPNYINATPHRTGAPPTNTSLERHNTTRTTI
********EEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYD********FRKGDVFHVIELE**********CSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKLNSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFN****************************************************************************************************************************
****GITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVI***************GIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSN****************FSVVIFLRAETKSNVKELRAGIPNYIKTI**********************************************************************************************************************************
MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIELENM********CSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKLNSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAIKFSANYDPSTKPLRSVSN************************PPDLPPRIDRTNKPPRTNPPRSATER**************GGEAPNYINATPHRTGAPPTNT************
**MKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIELEN********KCSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKLNSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAIKFSANYDPSTKPLRSVSNAGDTL*****SGGS**PPP*G*****************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIELENMMEESDSKKCSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKLNSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAIKFSANYDPSTKPLRSVSNAGDTLATSSPSGGSKYPPPSGPGAPPDLPPRIDRTNKPPRTNPPRSATERLFGRERESSVSKDGGGEAPNYINATPHRTGAPPTNTSLERHNTTRTTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
O97758 1769 Tight junction protein ZO yes N/A 0.237 0.041 0.493 6e-16
Q07157 1748 Tight junction protein ZO yes N/A 0.369 0.065 0.379 7e-16
P39447 1745 Tight junction protein ZO yes N/A 0.369 0.065 0.379 1e-15
Q9Z0U1 1167 Tight junction protein ZO no N/A 0.234 0.062 0.413 2e-12
Q95168 1174 Tight junction protein ZO no N/A 0.234 0.062 0.413 2e-12
Q9UDY2 1190 Tight junction protein ZO no N/A 0.234 0.061 0.4 7e-12
Q9QXY1905 Tight junction protein ZO no N/A 0.324 0.111 0.333 1e-11
O62683898 Tight junction protein ZO no N/A 0.276 0.095 0.339 1e-11
O95049933 Tight junction protein ZO no N/A 0.324 0.108 0.308 2e-10
Q8TDM61919 Disks large homolog 5 OS= no N/A 0.192 0.031 0.380 5e-07
>sp|O97758|ZO1_CANFA Tight junction protein ZO-1 OS=Canis familiaris GN=TJP1 PE=1 SV=1 Back     alignment and function desciption
 Score = 85.1 bits (209), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 55/75 (73%), Gaps = 1/75 (1%)

Query: 67  DVFHVIELENMMEESDSKKCSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIV 126
           D++ + + E     +D ++ SGIIRL  I+ ++D+ +H LLD+TPNAVDRLNYAQ+YPIV
Sbjct: 666 DIYQIAKSEPRDAGTD-QRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIV 724

Query: 127 IFLRAETKSNVKELR 141
           +FL  ++K  VK +R
Sbjct: 725 VFLNPDSKQGVKTMR 739
The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells.
Canis familiaris (taxid: 9615)
>sp|Q07157|ZO1_HUMAN Tight junction protein ZO-1 OS=Homo sapiens GN=TJP1 PE=1 SV=3 Back     alignment and function description
>sp|P39447|ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus GN=Tjp1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z0U1|ZO2_MOUSE Tight junction protein ZO-2 OS=Mus musculus GN=Tjp2 PE=1 SV=2 Back     alignment and function description
>sp|Q95168|ZO2_CANFA Tight junction protein ZO-2 OS=Canis familiaris GN=TJP2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UDY2|ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens GN=TJP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXY1|ZO3_MOUSE Tight junction protein ZO-3 OS=Mus musculus GN=Tjp3 PE=1 SV=1 Back     alignment and function description
>sp|O62683|ZO3_CANFA Tight junction protein ZO-3 OS=Canis familiaris GN=TJP3 PE=1 SV=1 Back     alignment and function description
>sp|O95049|ZO3_HUMAN Tight junction protein ZO-3 OS=Homo sapiens GN=TJP3 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDM6|DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens GN=DLG5 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
328697079 1227 PREDICTED: tight junction protein ZO-2-l 0.199 0.050 0.808 1e-29
328697075 1242 PREDICTED: tight junction protein ZO-2-l 0.199 0.049 0.808 2e-29
328697081 1302 PREDICTED: tight junction protein ZO-2-l 0.199 0.047 0.808 2e-29
328697077 1246 PREDICTED: tight junction protein ZO-2-l 0.199 0.049 0.808 2e-29
345479005 1559 PREDICTED: tight junction protein ZO-1-l 0.231 0.046 0.794 1e-28
307213715 1250 Tight junction protein ZO-1 [Harpegnatho 0.228 0.056 0.794 1e-28
350409418 1181 PREDICTED: tight junction protein ZO-1-l 0.228 0.060 0.794 2e-28
340713561 1181 PREDICTED: tight junction protein ZO-1-l 0.228 0.060 0.794 2e-28
307171573 1227 Tight junction protein ZO-1 [Camponotus 0.228 0.057 0.780 2e-28
383859496 1184 PREDICTED: tight junction protein ZO-1-l 0.228 0.059 0.780 3e-28
>gi|328697079|ref|XP_003240225.1| PREDICTED: tight junction protein ZO-2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  136 bits (342), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 69/73 (94%)

Query: 1   MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGE 60
           MDMKG+TREEAVLFLLSLQDQIHLIVQ+RRD+YE ++ +QRGDSFHIKTHF+Y+QP KGE
Sbjct: 433 MDMKGVTREEAVLFLLSLQDQIHLIVQHRRDQYEQIMNNQRGDSFHIKTHFDYEQPNKGE 492

Query: 61  MSFRKGDVFHVIE 73
           MSF KGDVFHV++
Sbjct: 493 MSFCKGDVFHVMD 505

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328697075|ref|XP_001950858.2| PREDICTED: tight junction protein ZO-2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328697081|ref|XP_003240226.1| PREDICTED: tight junction protein ZO-2-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328697077|ref|XP_003240224.1| PREDICTED: tight junction protein ZO-2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345479005|ref|XP_001607015.2| PREDICTED: tight junction protein ZO-1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307213715|gb|EFN89064.1| Tight junction protein ZO-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350409418|ref|XP_003488729.1| PREDICTED: tight junction protein ZO-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713561|ref|XP_003395310.1| PREDICTED: tight junction protein ZO-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307171573|gb|EFN63382.1| Tight junction protein ZO-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383859496|ref|XP_003705230.1| PREDICTED: tight junction protein ZO-1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
FB|FBgn0262614 2090 pyd "polychaetoid" [Drosophila 0.244 0.036 0.701 1.4e-45
UNIPROTKB|J9P013 1138 TJP2 "Tight junction protein Z 0.263 0.072 0.388 3.4e-22
UNIPROTKB|J9P749 1174 TJP2 "Tight junction protein Z 0.263 0.069 0.388 3.6e-22
UNIPROTKB|Q95168 1174 TJP2 "Tight junction protein Z 0.263 0.069 0.388 3.6e-22
UNIPROTKB|F1PEE3 1197 TJP2 "Tight junction protein Z 0.263 0.068 0.388 3.8e-22
MGI|MGI:1341872 1167 Tjp2 "tight junction protein 2 0.263 0.070 0.388 4.6e-22
RGD|1309247 904 Tjp3 "tight junction protein 3 0.231 0.079 0.434 4.8e-22
UNIPROTKB|E9PTS1 1163 Tjp2 "Protein Tjp2" [Rattus no 0.263 0.070 0.376 6.1e-22
RGD|619807 1164 Tjp2 "tight junction protein 2 0.263 0.070 0.376 6.1e-22
UNIPROTKB|E9PT08 1167 Tjp2 "Protein Tjp2" [Rattus no 0.263 0.070 0.376 6.1e-22
FB|FBgn0262614 pyd "polychaetoid" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 275 (101.9 bits), Expect = 1.4e-45, Sum P(3) = 1.4e-45
 Identities = 54/77 (70%), Positives = 64/77 (83%)

Query:     1 MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGE 60
             MDM G+TREEAVLFLLSLQD+I LIVQ  ++EY+ VV +QRGDSFHIKTHF+ D P KGE
Sbjct:   457 MDMNGVTREEAVLFLLSLQDRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGE 516

Query:    61 MSFRKGDVFHVIE-LEN 76
             M+F+ GDVF VI+ L N
Sbjct:   517 MAFKAGDVFRVIDTLHN 533
GO:0004385 "guanylate kinase activity" evidence=ISS;NAS
GO:0007254 "JNK cascade" evidence=NAS
GO:0005912 "adherens junction" evidence=IDA;NAS;TAS
GO:0007391 "dorsal closure" evidence=NAS;TAS
GO:0046328 "regulation of JNK cascade" evidence=NAS
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0035147 "branch fusion, open tracheal system" evidence=IMP
GO:0005913 "cell-cell adherens junction" evidence=IDA
GO:0035156 "fusion cell fate specification" evidence=IMP
GO:0048812 "neuron projection morphogenesis" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0030155 "regulation of cell adhesion" evidence=IGI;IMP
GO:0030424 "axon" evidence=IDA
GO:0016323 "basolateral plasma membrane" evidence=IDA
GO:0045177 "apical part of cell" evidence=IDA
GO:0005917 "nephrocyte diaphragm" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0050839 "cell adhesion molecule binding" evidence=IPI
GO:0036059 "nephrocyte diaphragm assembly" evidence=IMP
GO:0022416 "chaeta development" evidence=IMP
GO:0035220 "wing disc development" evidence=IMP
GO:0060439 "trachea morphogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|J9P013 TJP2 "Tight junction protein ZO-2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P749 TJP2 "Tight junction protein ZO-2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q95168 TJP2 "Tight junction protein ZO-2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEE3 TJP2 "Tight junction protein ZO-2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1341872 Tjp2 "tight junction protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309247 Tjp3 "tight junction protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTS1 Tjp2 "Protein Tjp2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|619807 Tjp2 "tight junction protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT08 Tjp2 "Protein Tjp2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
smart00072174 smart00072, GuKc, Guanylate kinase homologues 4e-11
cd1185962 cd11859, SH3_ZO, Src homology 3 domain of the Tigh 8e-11
smart0032656 smart00326, SH3, Src homology 3 domains 1e-05
cd1202865 cd12028, SH3_ZO-3, Src homology 3 domain of the Ti 3e-05
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 5e-05
cd1202763 cd12027, SH3_ZO-2, Src homology 3 domain of the Ti 3e-04
cd1202665 cd12026, SH3_ZO-1, Src homology 3 domain of the Ti 4e-04
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 6e-04
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 9e-04
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 0.003
pfam0001847 pfam00018, SH3_1, SH3 domain 0.004
cd1187854 cd11878, SH3_Bem1p_1, First Src Homology 3 domain 0.004
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information 
 Score = 60.4 bits (147), Expect = 4e-11
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 87  SGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRA 131
                   IR + ++G+H LLDI P  V +L  AQ YPIVIF+  
Sbjct: 68  YYGTSKETIRQVAEKGKHCLLDIDPQGVKQLRKAQLYPIVIFIAP 112

Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions. Length = 174
>gnl|CDD|212793 cd11859, SH3_ZO, Src homology 3 domain of the Tight junction proteins, Zonula occludens (ZO) proteins Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212961 cd12028, SH3_ZO-3, Src homology 3 domain of the Tight junction protein, Zonula occludens protein 3 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212960 cd12027, SH3_ZO-2, Src homology 3 domain of the Tight junction protein, Zonula occludens protein 2 Back     alignment and domain information
>gnl|CDD|212959 cd12026, SH3_ZO-1, Src homology 3 domain of the Tight junction protein, Zonula occludens protein 1 Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
KOG3580|consensus 1027 100.0
KOG0609|consensus542 100.0
KOG0708|consensus359 99.97
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.53
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.53
PRK14737186 gmk guanylate kinase; Provisional 99.28
PLN02772398 guanylate kinase 99.18
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.12
KOG0707|consensus231 98.93
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.61
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 98.41
PRK14738206 gmk guanylate kinase; Provisional 98.2
PRK00300205 gmk guanylate kinase; Provisional 98.14
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 97.29
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 96.95
KOG2199|consensus462 96.49
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 96.27
KOG3812|consensus475 96.22
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 96.13
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 95.85
KOG4792|consensus293 95.4
KOG2070|consensus 661 94.53
KOG1118|consensus366 94.21
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 91.7
KOG4225|consensus489 91.53
KOG2856|consensus472 91.2
KOG1029|consensus1118 89.94
KOG4348|consensus627 89.63
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 89.2
KOG4225|consensus489 85.54
KOG3875|consensus362 84.32
PRK08356195 hypothetical protein; Provisional 84.06
KOG4226|consensus379 81.58
PRK04040188 adenylate kinase; Provisional 81.21
>KOG3580|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.9e-43  Score=353.04  Aligned_cols=202  Identities=35%  Similarity=0.635  Sum_probs=185.7

Q ss_pred             CCCCCCCHHHHHHHHhcCC--CcEEEEEEeChhHHHHHHhccCCCeeEEEeccccCCCCCCCcceeeCCeeEeccc-cc-
Q psy9828           1 MDMKGITREEAVLFLLSLQ--DQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIEL-EN-   76 (311)
Q Consensus         1 vdlr~~T~EEA~~~L~~~~--~~VtL~vq~~~~~Y~~i~~~~~gDSFYVRA~FDy~~~~~~~LsFkkGDILhViDT-~~-   76 (311)
                      |||+|+++|||+++|+.++  +.|+|++|.+.+.|++|+++..|||||||+||.|+++.+.+|+|++||||||+|| |+ 
T Consensus       459 vdF~nl~REeAVlfLL~lPkGEevtilaQ~k~Dvyr~iv~s~vGDSFyIRtHFE~Eke~P~gL~FtrGeVFrvvDTLy~G  538 (1027)
T KOG3580|consen  459 VDFRNLVREEAVLFLLELPKGEEVTILAQSKADVYRDIVASGVGDSFYIRTHFECEKETPQGLAFTRGEVFRVVDTLYDG  538 (1027)
T ss_pred             ccchhhhHHHHHHHHhcCCCCcEEeehhhhhhHHHHHHHhccCCceeEEeeeeeecCCCCccccccccceeeeeecccCC
Confidence            6899999999999999997  9999999999999999999999999999999999999999999999999999999 98 


Q ss_pred             ---------c----------------------------------------------------------------------
Q psy9828          77 ---------M----------------------------------------------------------------------   77 (311)
Q Consensus        77 ---------m----------------------------------------------------------------------   77 (311)
                               |                                                                      
T Consensus       539 klG~WLAvRiG~dlrE~ErGiIPNksRAEQlASvq~aqr~~agGdRAdFWR~RGlRsg~KknlrkSREDLsA~~vqtkfP  618 (1027)
T KOG3580|consen  539 KLGNWLAVRIGNDLRELERGIIPNKSRAEQLASVQNAQRDNAGGDRADFWRMRGLRSGVKKNLRKSREDLSAVVVQTKFP  618 (1027)
T ss_pred             CCcceEEEeecccHHHHhcccCCCccHHHHHHHHHhhccccccchHHHHHHHhhhhhhhhhhhhhhhhhhhhceecccCC
Confidence                     0                                                                      


Q ss_pred             --------------------------ccc------c------------cccCCCCccchHHHHHHHhcCCEEEEecCccc
Q psy9828          78 --------------------------MEE------S------------DSKKCSGIIRLSAIRDMMDRGRHGLLDITPNA  113 (311)
Q Consensus        78 --------------------------mE~------~------------~~~~~~nlTSl~AVr~ViekGKhCILDV~pqa  113 (311)
                                                ||.      |            ..+++.+++++.+|+.|+++.||+||||.|+|
T Consensus       619 aYERVvLREAgFkRPVvifGPiADiAmeKLa~E~PD~fqiAkteprdag~~~stg~irL~TvrqiieqDKHALLDVTP~A  698 (1027)
T KOG3580|consen  619 AYERVVLREAGFKRPVVIFGPIADIAMEKLANELPDWFQIAKTEPRDAGSEKSTGVIRLNTVRQIIEQDKHALLDVTPKA  698 (1027)
T ss_pred             chhhhhhhhhcccCceEEeccHHHHHHHHHhhhCcchhhhhccccccCCcccccceEEehhhHHHHhcccchhhccCHHH
Confidence                                      210      0            22556688999999999999999999999999


Q ss_pred             cccccccCcccEEEEEcCCCHHHHHHHHccCCcc-----------------cCCCcceEEEecCCccchhhhhhccccHH
Q psy9828         114 VDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKL-----------------NSAQFFSVVIFLRAETKSNVKELRAGIPN  176 (311)
Q Consensus       114 VkrL~~a~l~PIVIFIkPpS~e~LKeLR~~l~e~-----------------~~~hlFd~vI~nddl~~~~~~~~~~~~~~  176 (311)
                      |++|++.++||||||+.|.|...+|.||++|.-.                 ...|||+++|.++..+++          |
T Consensus       699 vdrLNY~QwypIVvff~PdSrqgvktmRqrL~P~Sr~SsRkLy~~a~KL~K~~~HLFTaTInLNs~nD~----------W  768 (1027)
T KOG3580|consen  699 VDRLNYTQWYPIVVFFNPDSRQGVKTMRQRLAPTSRKSSRKLYDQANKLKKTCAHLFTATINLNSANDS----------W  768 (1027)
T ss_pred             HhhhccceeeeEEEEeCCcchHHHHHHHHHhCcccchhHHHHHHHHHHHhhhchhheEeeeccCCCChh----------H
Confidence            9999999999999999999999999999998632                 148999999999988886          9


Q ss_pred             HHHHHHHHHhcCCCCeeE--------------eeeccCCCCCCCcccccC
Q psy9828         177 YIKTISLINFNGSSPSQA--------------IKFSANYDPSTKPLRSVS  212 (311)
Q Consensus       177 y~~Lk~~I~~eQs~pvWV--------------~~~~~~~~~~~~~~~~~~  212 (311)
                      |..||++|++||.+++||              ++++|.++|++||++|++
T Consensus       769 yg~LK~~iq~QQ~~~vWvsEgk~dG~~~Dn~ddr~syL~a~gady~ScDS  818 (1027)
T KOG3580|consen  769 YGSLKDTIQHQQGEAVWVSEGKMDGMDDDNPDDRMSYLTAMGADYLSCDS  818 (1027)
T ss_pred             HHHHHHHHHHhcCceeEeecccccCcccCCcccccccccccccccccccc
Confidence            999999999999999999              799999999999988765

>KOG0609|consensus Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
3shw_A468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 1e-16
3lh5_A251 Crystal Structure Of The Sh3-Guanylate Kinase Core 2e-16
3tsw_A391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 2e-16
3tsw_B194 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 1e-12
3kfv_A308 Crystal Structure Of The Sh3-Kinase Fragment Of Tig 7e-12
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 6e-07
3tvt_A292 Structural Basis For Discs Large Interaction With P 2e-06
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 2e-06
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 3e-06
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-06
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure 
Iteration: 1

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 70/116 (60%), Gaps = 1/116 (0%)
Query: 26  VQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIELENMMEESDSKK 85
           VQ +   YE VV  + G    +          + +++  + D++ + + E     +D ++
Sbjct: 206 VQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTD-QR 264
Query: 86  CSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELR 141
            SGIIRL  I+ ++D+ +H LLD+TPNAVDRLNYAQ+YPIV+FL  ++K  VK +R
Sbjct: 265 SSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMR 320
>pdb|3LH5|A Chain A, Crystal Structure Of The Sh3-Guanylate Kinase Core Domain Of Zo-1 Length = 251 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3KFV|A Chain A, Crystal Structure Of The Sh3-Kinase Fragment Of Tight Junction Protein 3 (Tjp3) In Apo-Form Length = 308 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-15
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-07
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 5e-14
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 8e-09
2xkx_A721 Disks large homolog 4; structural protein, scaffol 7e-14
2xkx_A721 Disks large homolog 4; structural protein, scaffol 3e-05
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 5e-11
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 2e-04
3kfv_A308 Tight junction protein ZO-3; structural genomics c 1e-10
3kfv_A308 Tight junction protein ZO-3; structural genomics c 4e-09
1kjw_A295 Postsynaptic density protein 95; protein-protein i 3e-10
1kjw_A295 Postsynaptic density protein 95; protein-protein i 3e-04
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 7e-07
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-05
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-05
4dey_A337 Voltage-dependent L-type calcium channel subunit; 2e-04
4dey_A337 Voltage-dependent L-type calcium channel subunit; 8e-04
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
 Score = 76.1 bits (186), Expect = 1e-15
 Identities = 49/214 (22%), Positives = 82/214 (38%), Gaps = 30/214 (14%)

Query: 70  HVIELENMMEESDSKKCSGIIRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFL 129
           + I      +    ++ SGIIRL  I+ ++D+ +H LLD+TPNAVDRLNYAQ+YPIV+FL
Sbjct: 249 YQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFL 308

Query: 130 RAETKSNVKELRAGIPKLNSAQ-----------------FFSVVIFLRAETKSNVKELRA 172
             ++K  VK +R  +   +                     F+  I L +        L+ 
Sbjct: 309 NPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKE 368

Query: 173 GIPNYIKTISLINFNGSSPSQAIKF-------------SANYDPSTKPLRSVSNAGDTLA 219
            I      +  ++   +  + +                 + Y   +   R  S+  DT  
Sbjct: 369 AIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDT 428

Query: 220 TSSPSGGSKYPPPSGPGAPPDLPPRIDRTNKPPR 253
                   +                I R+++P R
Sbjct: 429 EGGAYTDQELDETLNDEVGTPPESAITRSSEPVR 462
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 100.0
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 100.0
3kfv_A308 Tight junction protein ZO-3; structural genomics c 100.0
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.97
1kjw_A295 Postsynaptic density protein 95; protein-protein i 99.93
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.85
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.69
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.42
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.94
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.84
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.72
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.53
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.3
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.27
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.23
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.93
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 97.68
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 97.56
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 97.54
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 97.52
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 97.51
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 97.51
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 97.51
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 97.51
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 97.5
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 97.5
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 97.47
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 97.47
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 97.46
1uti_A58 GRB2-related adaptor protein 2; signaling protein 97.45
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 97.45
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 97.44
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 97.44
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 97.42
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 97.42
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 97.41
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 97.41
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 97.41
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 97.4
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 97.39
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 97.38
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 97.38
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 97.36
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 97.36
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 97.36
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 97.36
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 97.36
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 97.35
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 97.35
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 97.35
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 97.34
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 97.34
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 97.33
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 97.32
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.32
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 97.32
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 97.31
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 97.31
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 97.31
1i07_A60 Epidermal growth factor receptor kinase substrate 97.3
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 97.28
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 97.28
1wxb_A68 Epidermal growth factor receptor pathway substrate 97.28
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 97.28
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 97.27
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.27
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 97.27
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 97.26
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 97.26
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 97.26
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 97.25
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 97.25
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 97.25
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 97.24
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 97.23
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 97.23
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 97.23
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 97.22
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 97.22
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 97.22
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 97.21
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 97.21
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 97.21
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 97.21
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 97.2
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 97.2
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 97.2
3u23_A65 CD2-associated protein; structural genomics, struc 97.2
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 97.2
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 97.19
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 97.19
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 97.19
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 97.19
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 97.19
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 97.18
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 97.18
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 97.18
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 97.17
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 97.17
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 97.17
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 97.17
2da9_A70 SH3-domain kinase binding protein 1; structural ge 97.16
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 97.16
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 97.15
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 97.15
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 97.15
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 97.15
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 97.14
2j6f_A62 CD2-associated protein; metal-binding, immune resp 97.14
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 97.14
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 97.14
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 97.13
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 97.13
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 97.13
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 97.13
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 97.13
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 97.12
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 97.12
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 97.12
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 97.12
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 97.12
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 97.11
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 97.11
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 97.11
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 97.1
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 97.1
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 97.1
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 97.1
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 97.09
2dil_A69 Proline-serine-threonine phosphatase-interacting p 97.09
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 97.09
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 97.08
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 97.08
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 97.08
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 97.08
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 97.08
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 97.08
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 97.07
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 97.07
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 97.07
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 97.06
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 97.05
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 97.05
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 97.05
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 97.04
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 97.04
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 97.02
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 97.01
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 97.01
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 97.01
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 97.0
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 97.0
2cuc_A70 SH3 domain containing ring finger 2; structural ge 96.99
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 96.99
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 96.98
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 96.97
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 96.97
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 96.96
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 96.96
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 96.95
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 96.95
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 96.94
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 96.93
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 96.93
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 96.93
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 96.92
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 96.92
1awj_A77 ITK; transferase, regulatory intramolecular comple 96.91
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 96.91
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 96.88
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 96.88
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 96.84
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 96.83
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 96.83
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 96.82
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 96.81
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 96.81
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.81
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 96.8
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 96.79
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 96.79
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 96.73
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 96.69
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 96.62
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 96.62
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 96.52
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 96.44
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 96.29
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 96.24
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 95.69
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 95.63
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 95.25
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 95.21
1u3o_A82 Huntingtin-associated protein-interacting protein; 95.09
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 95.02
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 94.97
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 94.83
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 94.82
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 94.81
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 94.79
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 94.4
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 94.36
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 94.23
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 94.19
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 94.16
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 94.16
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 92.79
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 93.27
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 92.92
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 92.71
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 91.21
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 91.44
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 91.22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 89.16
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 84.58
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 84.47
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 82.04
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 81.54
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 80.84
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 80.59
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.6e-37  Score=307.49  Aligned_cols=200  Identities=39%  Similarity=0.635  Sum_probs=158.6

Q ss_pred             CCCCCCHHHHHHHHhc--CCCcEEEEEEeChhHHHHHHhccCCCeeEEEeccccCCCCCCCcceeeCCeeEeccc-cc--
Q psy9828           2 DMKGITREEAVLFLLS--LQDQIHLIVQNRRDEYEHVVASQRGDSFHIKTHFNYDQPEKGEMSFRKGDVFHVIEL-EN--   76 (311)
Q Consensus         2 dlr~~T~EEA~~~L~~--~~~~VtL~vq~~~~~Y~~i~~~~~gDSFYVRA~FDy~~~~~~~LsFkkGDILhViDT-~~--   76 (311)
                      +++++|++||+.+|+.  .++.|+|+++.+.+.|.+++....+++|||||+|||++..+.+|+|++||||||+|+ |+  
T Consensus        54 ~v~~~t~~e~~~~L~~~~~g~~v~L~V~r~g~~~~~~~~~~~g~s~yVralfdy~~~~~~~LsF~~GDIL~V~d~~~~~d  133 (468)
T 3shw_A           54 DFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGK  133 (468)
T ss_dssp             ECTTCCHHHHHHHHHHSCTTSEEEEEEEECHHHHHHHHHHTCCCCEEEEECSCBCCSSTTBCCBCTTCEEEEEESSGGGC
T ss_pred             ECCCCCHHHHHHHHHhcCCCCEEEEEEEECCccchhhhccccccccccccccCcCCCCCCCceEccCCEEEEeecccCCC
Confidence            5788999999999988  679999999999999999998888999999999999999999999999999999999 43  


Q ss_pred             -------------------c------------c-----------------------------------------------
Q psy9828          77 -------------------M------------M-----------------------------------------------   78 (311)
Q Consensus        77 -------------------m------------m-----------------------------------------------   78 (311)
                                         +            +                                               
T Consensus       134 ~~wW~A~~~~~~~~~~~~GlIPs~~~~e~~~~~~~~~~~~~~~~~~~f~~~~~~r~~kk~~~~~~~~~~~~~~~~~~~~Y  213 (468)
T 3shw_A          134 LGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAY  213 (468)
T ss_dssp             TTEEEEEEECTTSCEEEEEEEECHHHHHHHHHHHHC-------------------------------------CCCCCSE
T ss_pred             CCeEEEEEcCCCCcccccceecCHHHHHHHHHHhhhhhccccccccchhhhccccccccccccchhhcccccccccCCCc
Confidence                               0            0                                               


Q ss_pred             c------cc-----------------------cc------------c---CCCCccchHHHHHHHhcCCEEEEecCcccc
Q psy9828          79 E------ES-----------------------DS------------K---KCSGIIRLSAIRDMMDRGRHGLLDITPNAV  114 (311)
Q Consensus        79 E------~~-----------------------~~------------~---~~~nlTSl~AVr~ViekGKhCILDV~pqaV  114 (311)
                      |      ..                       ..            +   ...+.|++++|++++++||||||||++||+
T Consensus       214 EeV~~~~~~~~r~iVlsGPsG~Gl~~~Ll~~~p~~f~s~~TRpR~gE~dG~~Y~FTs~~~V~~vl~~Gk~~iLdId~qg~  293 (468)
T 3shw_A          214 ERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAV  293 (468)
T ss_dssp             EEEEEECCSSCCCEEEESTTHHHHHHHHHHHCTTTEEECCCBC----------CBCCHHHHHHHHTTTCEEEECCCHHHH
T ss_pred             ceeEcccCCCCCEEEEECCCHHHHHHHHHHhCCCceeeecCCCCCcccccccCCcccHHHHHHHHHCCCeEEEEeCHHHH
Confidence            0      00                       00            0   012349999999999999999999999999


Q ss_pred             ccccccCcccEEEEEcCCCHHHHHHHHccCCc---c--------------cCCCcceEEEecCCcc-chhhhhhccccHH
Q psy9828         115 DRLNYAQFYPIVIFLRAETKSNVKELRAGIPK---L--------------NSAQFFSVVIFLRAET-KSNVKELRAGIPN  176 (311)
Q Consensus       115 krL~~a~l~PIVIFIkPpS~e~LKeLR~~l~e---~--------------~~~hlFd~vI~nddl~-~~~~~~~~~~~~~  176 (311)
                      ++|+.++++|++|||+|||++.|+++|+++..   +              .|+|+||.+|+|++++ .           |
T Consensus       294 ~~l~~~~~~p~~IFI~PPS~e~L~~~~~rl~~~see~~~r~~~~a~~~e~~~~~~fD~vIvNddl~d~-----------a  362 (468)
T 3shw_A          294 DRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDG-----------W  362 (468)
T ss_dssp             HHHHHTTCCCEEEEEECSCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHGGGCSEEEECBTTBCH-----------H
T ss_pred             HHHHhcCCCCEEEEEeCcCHHHHHHHHhccCCCCHHHHHHHHHHHHHHHHhhhccCCEEEECCCcHHH-----------H
Confidence            99999999999999999999999988777641   1              2689999999999995 7           9


Q ss_pred             HHHHHHHHHhcCCCCeeE-----------------eeeccCCCCCCCc--ccccC
Q psy9828         177 YIKTISLINFNGSSPSQA-----------------IKFSANYDPSTKP--LRSVS  212 (311)
Q Consensus       177 y~~Lk~~I~~eQs~pvWV-----------------~~~~~~~~~~~~~--~~~~~  212 (311)
                      |.+|+++|..+|++|+||                 .||||+|+|+++|  ++|++
T Consensus       363 ~~~L~~ii~~~~~~~~WvP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  417 (468)
T 3shw_A          363 YGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDS  417 (468)
T ss_dssp             HHHHHHHHHHHHTSCEEEEC-----------------------------------
T ss_pred             HHHHHHHHHHhcCCCEEeCCccccccccccccccccccccccCccccccceeecc
Confidence            999999999999999999                 4667777777777  44443
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 0.001
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 0.002
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 0.003
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 0.003
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 0.003
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 0.004
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 0.004
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 0.004
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 0.004
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Discs large 5 protein KIAA0583
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.7 bits (82), Expect = 0.001
 Identities = 9/44 (20%), Positives = 21/44 (47%)

Query: 1   MDMKGITREEAVLFLLSLQDQIHLIVQNRRDEYEHVVASQRGDS 44
           ++++  T ++A L +    D I ++ Q     ++    S+ G S
Sbjct: 72  INLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRSGPS 115
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.8
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.32
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.23
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.14
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.11
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.11
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.59
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.48
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.33
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.08
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 97.99
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 97.97
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 97.81
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 97.71
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 97.71
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 97.6
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 97.59
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 97.58
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.57
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 97.52
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 97.49
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 97.46
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 97.44
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.41
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 97.41
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.39
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 97.38
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 97.37
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.34
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 97.34
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 97.33
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 97.33
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.31
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 97.28
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 97.25
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 97.24
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.22
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.22
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 97.18
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 97.07
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 96.94
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 96.92
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 96.87
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 96.86
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 96.86
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 96.8
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 96.8
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 96.79
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 96.45
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 96.4
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 96.13
d1t0hb_219 Guanylate kinase-like domain of the L-type calcium 95.61
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 94.33
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 93.8
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 92.07
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 89.36
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 89.32
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 88.1
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 87.89
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 87.25
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 86.73
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 85.67
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 85.36
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 84.58
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 84.13
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 84.04
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 83.51
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 83.32
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 83.32
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 82.51
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 81.78
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 80.89
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 80.7
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.80  E-value=1.2e-20  Score=164.83  Aligned_cols=101  Identities=26%  Similarity=0.367  Sum_probs=93.1

Q ss_pred             cCCCCc--cchHHHHHHHhcCCEEEEecCccccccccccCcccEEEEEcCCCHHHHHHHHccCCcc--------------
Q psy9828          84 KKCSGI--IRLSAIRDMMDRGRHGLLDITPNAVDRLNYAQFYPIVIFLRAETKSNVKELRAGIPKL--------------  147 (311)
Q Consensus        84 ~~~~nl--TSl~AVr~ViekGKhCILDV~pqaVkrL~~a~l~PIVIFIkPpS~e~LKeLR~~l~e~--------------  147 (311)
                      ++.|++  |++++|++++++||+|||||+++|+++|+...+.|++|||.|||.+.+++++++++++              
T Consensus        78 ~~~g~~YGt~~~~i~~~~~~gk~~lldid~~g~~~lk~~~~~~i~IfI~pps~e~l~~l~kr~~~~~i~~r~~~~~~~e~  157 (199)
T d1kjwa2          78 QYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQ  157 (199)
T ss_dssp             EETTEEEEEEHHHHHHHHHTTCEEEECCCTTHHHHHHHTTCCCEEEEECCSSHHHHHHHCTTSCHHHHHHHHHHHHHHHH
T ss_pred             eecCCccceeeeEEEehhcCCCcccccccchHHhhhhhhccceeEEeeccccHHHHHhhhccccHHHHHHHHHHHHHHHH
Confidence            455554  9999999999999999999999999999999999999999999999999999888743              


Q ss_pred             cCCCcceEEEecCCccchhhhhhccccHHHHHHHHHHHhcCCCCeeEe
Q psy9828         148 NSAQFFSVVIFLRAETKSNVKELRAGIPNYIKTISLINFNGSSPSQAI  195 (311)
Q Consensus       148 ~~~hlFd~vI~nddl~~~~~~~~~~~~~~y~~Lk~~I~~eQs~pvWV~  195 (311)
                      .+.|+||.+|+|+|++.           +|.+|+++|+++|++|+|||
T Consensus       158 ~~~~~fd~vI~Nddle~-----------a~~~l~~iI~~~~~~~~WvP  194 (199)
T d1kjwa2         158 EFTECFSAIVEGDSFEE-----------IYHKVKRVIEDLSGPYIWVP  194 (199)
T ss_dssp             HHGGGCSEEECCSSHHH-----------HHHHHHHHHHHHSCSEEEEE
T ss_pred             HhhccCCEEEECcCHHH-----------HHHHHHHHHHHhcCCCeeec
Confidence            25899999999999998           99999999999999999997
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure