Psyllid ID: psy986


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKTVYRLK
ccccccccccccHHHHHHHHccccHHHHHHHHHccEEEEEEccccccccccccccccccEEEEEEcccccc
cccEEHHHEEcccHcccEEEcccccEEEEEEccccEEEEEEEccccccccccccccccEEEEEcccEEEcc
mleyseeslqvprnlvgkvigknGRIIQEIVDKSGVVrvkiegdnepqptlpreegqvpFMVLTKTVYRLK
mleyseeslqvprnlvgkvigkngriiqeivdksgvvrvkiegdnepqptlpreegqvpfmvltktvyrlk
MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKTVYRLK
*************NLVGKVIGKNGRIIQEIVDKSGVVRVKI******************FMVLTKTV****
*LEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRV******************VPFMVLTKTV****
MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKTVYRLK
MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKTVYRLK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKTVYRLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
P51114 621 Fragile X mental retardat no N/A 0.859 0.098 0.714 6e-19
Q5XI81 568 Fragile X mental retardat yes N/A 0.859 0.107 0.714 6e-19
Q2TBT7 621 Fragile X mental retardat yes N/A 0.859 0.098 0.714 6e-19
P51116 673 Fragile X mental retardat no N/A 0.845 0.089 0.725 7e-19
P51115 676 Fragile X mental retardat N/A N/A 0.845 0.088 0.725 8e-19
Q61584 677 Fragile X mental retardat no N/A 0.859 0.090 0.714 8e-19
Q5BJ56 674 Fragile X mental retardat yes N/A 0.845 0.089 0.725 8e-19
Q7ZTQ5 675 Fragile X mental retardat N/A N/A 0.845 0.088 0.725 9e-19
O70523 621 Fragile X mental retardat no N/A 0.859 0.098 0.698 1e-18
Q9NFU0 684 Fragile X mental retardat yes N/A 0.887 0.092 0.666 2e-17
>sp|P51114|FXR1_HUMAN Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens GN=FXR1 PE=1 SV=3 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 2/63 (3%)

Query: 1   MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPF 60
            LE+ E+ +QVPRNLVGKVIGKNG++IQEIVDKSGVVRV+IEGDNE +  LPRE+G VPF
Sbjct: 278 FLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENK--LPREDGMVPF 335

Query: 61  MVL 63
           + +
Sbjct: 336 VFV 338




RNA-binding protein required for embryonic and postnatal development of muscle tissue. May regulate intracellular transport and local translation of certain mRNAs.
Homo sapiens (taxid: 9606)
>sp|Q5XI81|FXR1_RAT Fragile X mental retardation syndrome-related protein 1 OS=Rattus norvegicus GN=Fxr1 PE=2 SV=1 Back     alignment and function description
>sp|Q2TBT7|FXR1_BOVIN Fragile X mental retardation syndrome-related protein 1 OS=Bos taurus GN=FXR1 PE=2 SV=1 Back     alignment and function description
>sp|P51116|FXR2_HUMAN Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens GN=FXR2 PE=1 SV=2 Back     alignment and function description
>sp|P51115|FXR1A_XENLA Fragile X mental retardation syndrome-related protein 1 homolog A OS=Xenopus laevis GN=fxr1-a PE=1 SV=2 Back     alignment and function description
>sp|Q61584|FXR1_MOUSE Fragile X mental retardation syndrome-related protein 1 OS=Mus musculus GN=Fxr1 PE=1 SV=2 Back     alignment and function description
>sp|Q5BJ56|FXR1_XENTR Fragile X mental retardation syndrome-related protein 1 homolog OS=Xenopus tropicalis GN=fxr1 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZTQ5|FXR1B_XENLA Fragile X mental retardation syndrome-related protein 1 homolog B OS=Xenopus laevis GN=fxr1-b PE=2 SV=1 Back     alignment and function description
>sp|O70523|FXR1_CRIGR Fragile X mental retardation syndrome-related protein 1 OS=Cricetulus griseus GN=FXR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NFU0|FMR1_DROME Fragile X mental retardation syndrome-related protein 1 OS=Drosophila melanogaster GN=Fmr1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
157122825 717 fragile X mental retardation syndrome-re 0.887 0.087 0.904 6e-26
189235654 660 PREDICTED: similar to fragile X mental r 0.887 0.095 0.920 2e-25
270004423 677 hypothetical protein TcasGA2_TC003774 [T 0.887 0.093 0.920 2e-25
312374565 282 hypothetical protein AND_15781 [Anophele 0.887 0.223 0.888 2e-25
332023074 599 Fragile X mental retardation syndrome-re 0.887 0.105 0.904 1e-24
307203416 603 Fragile X mental retardation syndrome-re 0.887 0.104 0.904 1e-24
345493180 613 PREDICTED: fragile X mental retardation 0.887 0.102 0.904 1e-24
345493184 605 PREDICTED: fragile X mental retardation 0.887 0.104 0.904 2e-24
383859712 597 PREDICTED: fragile X mental retardation 0.887 0.105 0.888 2e-24
242018237 492 conserved hypothetical protein [Pediculu 0.887 0.128 0.888 2e-24
>gi|157122825|ref|XP_001659932.1| fragile X mental retardation syndrome-related protein 1, putative [Aedes aegypti] gi|108874593|gb|EAT38818.1| AAEL009326-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%)

Query: 1   MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPF 60
           MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEP+P++PREEGQVPF
Sbjct: 273 MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPEPSIPREEGQVPF 332

Query: 61  MVL 63
           + +
Sbjct: 333 VFV 335




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189235654|ref|XP_969396.2| PREDICTED: similar to fragile X mental retardation syndrome-related protein 1, putative [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270004423|gb|EFA00871.1| hypothetical protein TcasGA2_TC003774 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312374565|gb|EFR22095.1| hypothetical protein AND_15781 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|332023074|gb|EGI63339.1| Fragile X mental retardation syndrome-related protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307203416|gb|EFN82491.1| Fragile X mental retardation syndrome-related protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345493180|ref|XP_003427019.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345493184|ref|XP_003427020.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859712|ref|XP_003705336.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242018237|ref|XP_002429585.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514552|gb|EEB16847.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
UNIPROTKB|E1B9L5 646 FXR2 "Uncharacterized protein" 0.816 0.089 0.75 1.5e-18
UNIPROTKB|F1M3Y6 654 Fxr2 "Protein Fxr2" [Rattus no 0.816 0.088 0.75 1.5e-18
UNIPROTKB|E2R2H9 672 FXR2 "Uncharacterized protein" 0.816 0.086 0.75 1.6e-18
UNIPROTKB|P51116 673 FXR2 "Fragile X mental retarda 0.816 0.086 0.75 1.6e-18
UNIPROTKB|F1ST39 673 FXR2 "Uncharacterized protein" 0.816 0.086 0.75 1.6e-18
UNIPROTKB|E7EU85 454 FXR1 "Fragile X mental retarda 0.873 0.136 0.723 1.7e-18
UNIPROTKB|E9PFF5 490 FXR1 "Fragile X mental retarda 0.873 0.126 0.723 2.1e-18
UNIPROTKB|A6QLG6 539 FXR1 "Fragile X mental retarda 0.873 0.115 0.723 2.7e-18
UNIPROTKB|F6XQE7 539 FXR1 "Uncharacterized protein" 0.873 0.115 0.723 2.7e-18
UNIPROTKB|F1SGB0 540 FXR1 "Uncharacterized protein" 0.873 0.114 0.723 2.7e-18
UNIPROTKB|E1B9L5 FXR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 233 (87.1 bits), Expect = 1.5e-18, P = 1.5e-18
 Identities = 45/60 (75%), Positives = 55/60 (91%)

Query:     2 LEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFM 61
             LE+SE+S+QVPRNLVGKVIGKNG++IQEIVDKSGVVRV++EGDN+ +   PREEG VPF+
Sbjct:   262 LEFSEDSVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKN--PREEGMVPFI 319




GO:0005737 "cytoplasm" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
UNIPROTKB|F1M3Y6 Fxr2 "Protein Fxr2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2H9 FXR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P51116 FXR2 "Fragile X mental retardation syndrome-related protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST39 FXR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E7EU85 FXR1 "Fragile X mental retardation syndrome-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFF5 FXR1 "Fragile X mental retardation syndrome-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLG6 FXR1 "Fragile X mental retardation syndrome-related protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6XQE7 FXR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGB0 FXR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5XI81FXR1_RATNo assigned EC number0.71420.85910.1073yesN/A
Q5BJ56FXR1_XENTRNo assigned EC number0.72580.84500.0890yesN/A
Q2TBT7FXR1_BOVINNo assigned EC number0.71420.85910.0982yesN/A
Q9NFU0FMR1_DROMENo assigned EC number0.66660.88730.0921yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 3e-07
pfam0001359 pfam00013, KH_1, KH domain 3e-06
smart0032268 smart00322, KH, K homology RNA-binding domain 1e-05
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 3e-05
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 2e-04
PRK13764602 PRK13764, PRK13764, ATPase; Provisional 2e-04
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 5e-04
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 0.001
COG1185692 COG1185, Pnp, Polyribonucleotide nucleotidyltransf 0.001
pfam1301442 pfam13014, KH_3, KH domain 0.002
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 0.004
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
 Score = 42.5 bits (101), Expect = 3e-07
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 6  EESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQP 49
           E + VP +LVG++IGK G  I+EI +++G  ++KI        
Sbjct: 1  TERVLVPSSLVGRIIGKGGSTIKEIREETG-AKIKIPDSGSGSE 43


KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64

>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
COG183776 Predicted RNA-binding protein (contains KH domain) 99.39
PRK0046875 hypothetical protein; Provisional 99.38
PRK0282177 hypothetical protein; Provisional 99.29
PRK0106478 hypothetical protein; Provisional 98.91
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.4
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 98.35
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.23
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.07
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.0
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 97.99
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 97.94
smart0032269 KH K homology RNA-binding domain. 97.92
PF1301443 KH_3: KH domain 97.63
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 97.38
PRK08406140 transcription elongation factor NusA-like protein; 97.34
TIGR03665 172 arCOG04150 arCOG04150 universal archaeal KH domain 96.82
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 96.79
PRK13763 180 putative RNA-processing protein; Provisional 96.7
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 95.98
PRK13764602 ATPase; Provisional 95.95
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 95.93
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 95.89
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.81
PRK12704 520 phosphodiesterase; Provisional 95.7
KOG1676|consensus 600 95.69
PRK00106 535 hypothetical protein; Provisional 95.64
KOG2190|consensus 485 95.61
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 95.38
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 95.2
PRK12705 508 hypothetical protein; Provisional 95.03
PRK08406140 transcription elongation factor NusA-like protein; 94.92
KOG2193|consensus584 94.86
PLN00207 891 polyribonucleotide nucleotidyltransferase; Provisi 94.4
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 94.4
COG1855604 ATPase (PilT family) [General function prediction 94.22
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 94.04
PRK13763180 putative RNA-processing protein; Provisional 94.02
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 93.72
KOG2192|consensus390 93.43
COG0195190 NusA Transcription elongation factor [Transcriptio 92.87
KOG2190|consensus485 91.45
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 90.84
KOG1676|consensus 600 90.41
COG0195190 NusA Transcription elongation factor [Transcriptio 89.97
COG1094194 Predicted RNA-binding protein (contains KH domains 89.77
KOG2191|consensus 402 89.67
PRK06418166 transcription elongation factor NusA-like protein; 89.49
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 88.08
cd02412109 30S_S3_KH K homology RNA-binding (KH) domain of th 87.38
PRK12328374 nusA transcription elongation factor NusA; Provisi 86.88
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 86.71
cd0241185 archeal_30S_S3_KH K homology RNA-binding domain (K 86.13
KOG2193|consensus 584 85.84
PRK12327362 nusA transcription elongation factor NusA; Provisi 85.77
KOG2192|consensus 390 85.6
TIGR01953341 NusA transcription termination factor NusA. This m 84.39
PRK09202 470 nusA transcription elongation factor NusA; Validat 83.54
COG1847208 Jag Predicted RNA-binding protein [General functio 81.92
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 81.28
PRK00089292 era GTPase Era; Reviewed 80.59
PRK12329449 nusA transcription elongation factor NusA; Provisi 80.02
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
Probab=99.39  E-value=1.9e-13  Score=86.29  Aligned_cols=37  Identities=38%  Similarity=0.427  Sum_probs=34.4

Q ss_pred             ceeeeeeeeCCCccCcccccCchhHHHHHhhhceeEE
Q psy986            3 EYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRV   39 (71)
Q Consensus         3 Ef~e~~l~V~~~dvGKVIGk~Gr~ikaIr~~~~a~~i   39 (71)
                      .+..++|.|+++|+||+|||+||+||||||++.+++.
T Consensus        28 ~~~~~~l~v~~~D~GkvIGk~GRti~AIRTll~a~~~   64 (76)
T COG1837          28 KTVTIELRVAPEDMGKVIGKQGRTIQAIRTLLSAVGS   64 (76)
T ss_pred             CeEEEEEEECcccccceecCCChhHHHHHHHHHHhcc
Confidence            3678999999999999999999999999999999876



>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>PRK06418 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>COG1847 Jag Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2qnd_A144 Crystal Structure Of The Kh1-Kh2 Domains From Human 2e-18
>pdb|2QND|A Chain A, Crystal Structure Of The Kh1-Kh2 Domains From Human Fragile X Mental Retardation Protein Length = 144 Back     alignment and structure

Iteration: 1

Score = 87.4 bits (215), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 42/63 (66%), Positives = 54/63 (85%), Gaps = 2/63 (3%) Query: 1 MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPF 60 LE++E+ +QVPRNLVGKVIGKNG++IQEIVDKSGVVRV+IE +NE +P+EEG VPF Sbjct: 63 FLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENE--KNVPQEEGXVPF 120 Query: 61 MVL 63 + + Sbjct: 121 VFV 123

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 1e-12
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-05
1we8_A104 Tudor and KH domain containing protein; structural 2e-08
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 9e-08
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 2e-07
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 3e-07
1x4m_A94 FAR upstream element binding protein 1; KH domain, 5e-07
1x4n_A92 FAR upstream element binding protein 1; KH domain, 7e-07
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 8e-07
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-06
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 1e-06
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 2e-06
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-06
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-05
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 2e-06
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-06
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 3e-06
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-04
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 3e-06
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-05
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-05
2anr_A 178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-05
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 3e-05
1j4w_A 174 FUSE binding protein; single-stranded DNA binding 3e-05
1j4w_A174 FUSE binding protein; single-stranded DNA binding 6e-05
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 6e-05
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 1e-04
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 1e-04
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 3e-04
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 4e-04
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 6e-04
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 6e-04
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 9e-04
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
 Score = 57.3 bits (138), Expect = 1e-12
 Identities = 42/62 (67%), Positives = 52/62 (83%), Gaps = 2/62 (3%)

Query: 1   MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPF 60
            LE++E+ +QVPRNLVGKVIGKNG++IQEIVDKSGVVRV+IE +NE     P+EEG VPF
Sbjct: 63  FLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNV--PQEEGMVPF 120

Query: 61  MV 62
           + 
Sbjct: 121 VF 122


>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.12
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 98.61
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 98.4
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 98.37
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 98.37
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 98.29
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 98.27
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 98.26
1x4n_A92 FAR upstream element binding protein 1; KH domain, 98.24
1we8_A104 Tudor and KH domain containing protein; structural 98.22
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 98.21
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.2
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 98.15
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 98.14
2cpq_A91 FragIle X mental retardation syndrome related prot 98.13
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 98.12
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.1
1x4m_A94 FAR upstream element binding protein 1; KH domain, 98.07
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 98.02
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.01
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 97.96
1j4w_A 174 FUSE binding protein; single-stranded DNA binding 97.93
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 97.92
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 97.91
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 97.89
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 97.89
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 97.87
2dgr_A83 Ring finger and KH domain-containing protein 1; st 97.85
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 97.74
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 97.73
2anr_A 178 Neuro-oncological ventral antigen 1; protein-RNA c 97.69
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 97.68
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 97.26
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.13
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 96.53
2e3u_A 219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 96.42
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 96.2
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 95.96
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 95.55
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 95.53
1tua_A191 Hypothetical protein APE0754; structural genomics, 95.01
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 94.6
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 92.77
1tua_A 191 Hypothetical protein APE0754; structural genomics, 91.18
2cxc_A144 NUSA; transcription termination, RNA binding prote 90.88
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 90.54
2pt7_G152 HP1451, hypothetical protein; ATPase, protein-prot 90.31
2cxc_A144 NUSA; transcription termination, RNA binding prote 89.9
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 88.5
3gku_A225 Probable RNA-binding protein; APC21302, clostridiu 88.48
1go3_E 187 DNA-directed RNA polymerase subunit E; transferase 88.43
2asb_A251 Transcription elongation protein NUSA; protein-RNA 88.35
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 85.62
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 82.15
1hh2_P344 NUSA, N utilization substance protein A; transcrip 81.15
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
Probab=99.12  E-value=2.8e-11  Score=80.21  Aligned_cols=63  Identities=67%  Similarity=1.105  Sum_probs=54.7

Q ss_pred             cceeeeeeeeCCCccCcccccCchhHHHHHhhhceeEEeecCCCCCCCCCCCCCCccceEEeeeE
Q psy986            2 LEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKT   66 (71)
Q Consensus         2 LEf~e~~l~V~~~dvGKVIGk~Gr~ikaIr~~~~a~~iki~~~~e~~~~~~~~~~~vpF~~vGt~   66 (71)
                      |++.+..+.||++.+|.+|||+|++|+.|++.+|+..++|..+++..  .+.+++.+||.++||.
T Consensus        64 l~~~e~~v~Vp~~~~g~~IGK~G~nIr~i~~~tG~~~I~i~~~~~~~--~~~~~~~~~vtI~G~~  126 (144)
T 2qnd_A           64 LEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKN--VPQEEGMVPFVFVGTK  126 (144)
T ss_dssp             HCEEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHTCSEEEEEEECTTC--CCCCTTEEEEEEEEEH
T ss_pred             hhcceEEEEECHHHcCeeECCCCHHHHHHHHHHCCEEEEEcCCCCCC--ccccCCeeEEEEEeCH
Confidence            56778899999999999999999999999999999999998765542  3567788999999984



>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>3gku_A Probable RNA-binding protein; APC21302, clostridium symbiosum ATCC 14 structural genomics, PSI-2, protein structure initiative; 2.95A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 71
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 7e-07
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-06
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-06
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 2e-06
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 3e-06
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 5e-06
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 6e-06
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-05
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-05
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 3e-05
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-05
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 5e-05
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 9e-05
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 1e-04
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 1e-04
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-04
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 2e-04
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 2e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 6e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 0.001
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 0.003
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Neuro-oncological ventral antigen 2, nova-2, KH3
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.2 bits (94), Expect = 7e-07
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 9  LQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQP 49
          + VP NLVG ++GK G+ + E  + +G  R++I    E  P
Sbjct: 7  MAVPENLVGAILGKGGKTLVEYQELTG-ARIQISKKGEFLP 46


>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 98.73
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 98.7
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 98.57
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 98.54
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 98.4
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 98.35
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 98.33
d2cpqa178 Fragile X mental retardation syndrome related prot 98.3
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.21
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 98.21
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.2
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 98.07
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.06
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.06
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 97.94
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.71
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 97.68
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 96.65
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.27
d1hh2p368 Transcription factor NusA, C-terminal domains {The 93.82
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 90.36
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 87.97
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 83.48
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 80.23
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Far upstream binding element, FBP
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73  E-value=5.5e-09  Score=60.33  Aligned_cols=40  Identities=33%  Similarity=0.595  Sum_probs=35.3

Q ss_pred             eeeeeeCCCccCcccccCchhHHHHHhhhceeEEeecCCCC
Q psy986            6 EESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNE   46 (71)
Q Consensus         6 e~~l~V~~~dvGKVIGk~Gr~ikaIr~~~~a~~iki~~~~e   46 (71)
                      ++++.||.+.+|++|||+|.+|+.|++.+|+ .++|+.+.+
T Consensus         2 ~~~~~IP~~~vg~IIGk~G~~Ik~I~~~sga-~I~i~~~~~   41 (71)
T d1j4wa2           2 EFNFIVPTGKTGLIIGKGGETIKSISQQSGA-RIELQRNPP   41 (71)
T ss_dssp             EEEEEEETTTHHHHHCGGGHHHHHHHHHHCC-EEEEECCCT
T ss_pred             EEEEEEChHhcceEECCCCcChHHHHhhcCc-EEEEeecCC
Confidence            5789999999999999999999999999984 788875544



>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure