Psyllid ID: psy986
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| 157122825 | 717 | fragile X mental retardation syndrome-re | 0.887 | 0.087 | 0.904 | 6e-26 | |
| 189235654 | 660 | PREDICTED: similar to fragile X mental r | 0.887 | 0.095 | 0.920 | 2e-25 | |
| 270004423 | 677 | hypothetical protein TcasGA2_TC003774 [T | 0.887 | 0.093 | 0.920 | 2e-25 | |
| 312374565 | 282 | hypothetical protein AND_15781 [Anophele | 0.887 | 0.223 | 0.888 | 2e-25 | |
| 332023074 | 599 | Fragile X mental retardation syndrome-re | 0.887 | 0.105 | 0.904 | 1e-24 | |
| 307203416 | 603 | Fragile X mental retardation syndrome-re | 0.887 | 0.104 | 0.904 | 1e-24 | |
| 345493180 | 613 | PREDICTED: fragile X mental retardation | 0.887 | 0.102 | 0.904 | 1e-24 | |
| 345493184 | 605 | PREDICTED: fragile X mental retardation | 0.887 | 0.104 | 0.904 | 2e-24 | |
| 383859712 | 597 | PREDICTED: fragile X mental retardation | 0.887 | 0.105 | 0.888 | 2e-24 | |
| 242018237 | 492 | conserved hypothetical protein [Pediculu | 0.887 | 0.128 | 0.888 | 2e-24 |
| >gi|157122825|ref|XP_001659932.1| fragile X mental retardation syndrome-related protein 1, putative [Aedes aegypti] gi|108874593|gb|EAT38818.1| AAEL009326-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 121 bits (303), Expect = 6e-26, Method: Compositional matrix adjust.
Identities = 57/63 (90%), Positives = 62/63 (98%)
Query: 1 MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPF 60
MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEP+P++PREEGQVPF
Sbjct: 273 MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPEPSIPREEGQVPF 332
Query: 61 MVL 63
+ +
Sbjct: 333 VFV 335
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189235654|ref|XP_969396.2| PREDICTED: similar to fragile X mental retardation syndrome-related protein 1, putative [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270004423|gb|EFA00871.1| hypothetical protein TcasGA2_TC003774 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|312374565|gb|EFR22095.1| hypothetical protein AND_15781 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|332023074|gb|EGI63339.1| Fragile X mental retardation syndrome-related protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307203416|gb|EFN82491.1| Fragile X mental retardation syndrome-related protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|345493180|ref|XP_003427019.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345493184|ref|XP_003427020.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383859712|ref|XP_003705336.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242018237|ref|XP_002429585.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514552|gb|EEB16847.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| UNIPROTKB|E1B9L5 | 646 | FXR2 "Uncharacterized protein" | 0.816 | 0.089 | 0.75 | 1.5e-18 | |
| UNIPROTKB|F1M3Y6 | 654 | Fxr2 "Protein Fxr2" [Rattus no | 0.816 | 0.088 | 0.75 | 1.5e-18 | |
| UNIPROTKB|E2R2H9 | 672 | FXR2 "Uncharacterized protein" | 0.816 | 0.086 | 0.75 | 1.6e-18 | |
| UNIPROTKB|P51116 | 673 | FXR2 "Fragile X mental retarda | 0.816 | 0.086 | 0.75 | 1.6e-18 | |
| UNIPROTKB|F1ST39 | 673 | FXR2 "Uncharacterized protein" | 0.816 | 0.086 | 0.75 | 1.6e-18 | |
| UNIPROTKB|E7EU85 | 454 | FXR1 "Fragile X mental retarda | 0.873 | 0.136 | 0.723 | 1.7e-18 | |
| UNIPROTKB|E9PFF5 | 490 | FXR1 "Fragile X mental retarda | 0.873 | 0.126 | 0.723 | 2.1e-18 | |
| UNIPROTKB|A6QLG6 | 539 | FXR1 "Fragile X mental retarda | 0.873 | 0.115 | 0.723 | 2.7e-18 | |
| UNIPROTKB|F6XQE7 | 539 | FXR1 "Uncharacterized protein" | 0.873 | 0.115 | 0.723 | 2.7e-18 | |
| UNIPROTKB|F1SGB0 | 540 | FXR1 "Uncharacterized protein" | 0.873 | 0.114 | 0.723 | 2.7e-18 |
| UNIPROTKB|E1B9L5 FXR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 233 (87.1 bits), Expect = 1.5e-18, P = 1.5e-18
Identities = 45/60 (75%), Positives = 55/60 (91%)
Query: 2 LEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFM 61
LE+SE+S+QVPRNLVGKVIGKNG++IQEIVDKSGVVRV++EGDN+ + PREEG VPF+
Sbjct: 262 LEFSEDSVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKN--PREEGMVPFI 319
|
|
| UNIPROTKB|F1M3Y6 Fxr2 "Protein Fxr2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R2H9 FXR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51116 FXR2 "Fragile X mental retardation syndrome-related protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ST39 FXR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EU85 FXR1 "Fragile X mental retardation syndrome-related protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PFF5 FXR1 "Fragile X mental retardation syndrome-related protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLG6 FXR1 "Fragile X mental retardation syndrome-related protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XQE7 FXR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SGB0 FXR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 3e-07 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 3e-06 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 1e-05 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 3e-05 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 2e-04 | |
| PRK13764 | 602 | PRK13764, PRK13764, ATPase; Provisional | 2e-04 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 5e-04 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.001 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 0.001 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 0.002 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 0.004 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
Score = 42.5 bits (101), Expect = 3e-07
Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Query: 6 EESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQP 49
E + VP +LVG++IGK G I+EI +++G ++KI
Sbjct: 1 TERVLVPSSLVGRIIGKGGSTIKEIREETG-AKIKIPDSGSGSE 43
|
KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64 |
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 99.39 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 99.38 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 99.29 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 98.91 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 98.4 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 98.35 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 98.23 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 98.07 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 98.0 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.99 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 97.94 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 97.92 | |
| PF13014 | 43 | KH_3: KH domain | 97.63 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 97.38 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 97.34 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 96.82 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 96.79 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 96.7 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 95.98 | |
| PRK13764 | 602 | ATPase; Provisional | 95.95 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 95.93 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 95.89 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 95.81 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 95.7 | |
| KOG1676|consensus | 600 | 95.69 | ||
| PRK00106 | 535 | hypothetical protein; Provisional | 95.64 | |
| KOG2190|consensus | 485 | 95.61 | ||
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 95.38 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 95.2 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 95.03 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 94.92 | |
| KOG2193|consensus | 584 | 94.86 | ||
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 94.4 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 94.4 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 94.22 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 94.04 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 94.02 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 93.72 | |
| KOG2192|consensus | 390 | 93.43 | ||
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 92.87 | |
| KOG2190|consensus | 485 | 91.45 | ||
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 90.84 | |
| KOG1676|consensus | 600 | 90.41 | ||
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 89.97 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 89.77 | |
| KOG2191|consensus | 402 | 89.67 | ||
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 89.49 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 88.08 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 87.38 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 86.88 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 86.71 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 86.13 | |
| KOG2193|consensus | 584 | 85.84 | ||
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 85.77 | |
| KOG2192|consensus | 390 | 85.6 | ||
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 84.39 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 83.54 | |
| COG1847 | 208 | Jag Predicted RNA-binding protein [General functio | 81.92 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 81.28 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 80.59 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 80.02 |
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.39 E-value=1.9e-13 Score=86.29 Aligned_cols=37 Identities=38% Similarity=0.427 Sum_probs=34.4
Q ss_pred ceeeeeeeeCCCccCcccccCchhHHHHHhhhceeEE
Q psy986 3 EYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRV 39 (71)
Q Consensus 3 Ef~e~~l~V~~~dvGKVIGk~Gr~ikaIr~~~~a~~i 39 (71)
.+..++|.|+++|+||+|||+||+||||||++.+++.
T Consensus 28 ~~~~~~l~v~~~D~GkvIGk~GRti~AIRTll~a~~~ 64 (76)
T COG1837 28 KTVTIELRVAPEDMGKVIGKQGRTIQAIRTLLSAVGS 64 (76)
T ss_pred CeEEEEEEECcccccceecCCChhHHHHHHHHHHhcc
Confidence 3678999999999999999999999999999999876
|
|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191|consensus | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG1847 Jag Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 71 | ||||
| 2qnd_A | 144 | Crystal Structure Of The Kh1-Kh2 Domains From Human | 2e-18 |
| >pdb|2QND|A Chain A, Crystal Structure Of The Kh1-Kh2 Domains From Human Fragile X Mental Retardation Protein Length = 144 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 1e-12 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 4e-05 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 2e-08 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 9e-08 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 2e-07 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-07 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 5e-07 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 7e-07 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 8e-07 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-06 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-06 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 2e-06 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 2e-06 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-05 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 2e-06 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-06 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-06 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-04 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 3e-06 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-05 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-05 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 4e-05 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-05 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 3e-05 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 6e-05 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 6e-05 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 1e-04 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-04 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 4e-04 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 6e-04 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 6e-04 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 9e-04 |
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
Score = 57.3 bits (138), Expect = 1e-12
Identities = 42/62 (67%), Positives = 52/62 (83%), Gaps = 2/62 (3%)
Query: 1 MLEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPF 60
LE++E+ +QVPRNLVGKVIGKNG++IQEIVDKSGVVRV+IE +NE P+EEG VPF
Sbjct: 63 FLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNV--PQEEGMVPF 120
Query: 61 MV 62
+
Sbjct: 121 VF 122
|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.12 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 98.61 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 98.4 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 98.37 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 98.37 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 98.29 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 98.27 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 98.26 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 98.24 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 98.22 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 98.21 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 98.2 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 98.15 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 98.14 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.13 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 98.12 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 98.1 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 98.07 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 98.02 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 98.01 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 97.96 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 97.93 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 97.92 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 97.91 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 97.89 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 97.89 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 97.87 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 97.85 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 97.74 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 97.73 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 97.69 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 97.68 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 97.26 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 97.13 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 96.53 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 96.42 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 96.2 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 95.96 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 95.55 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 95.53 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 95.01 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 94.6 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 92.77 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 91.18 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 90.88 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 90.54 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 90.31 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 89.9 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 88.5 | |
| 3gku_A | 225 | Probable RNA-binding protein; APC21302, clostridiu | 88.48 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 88.43 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 88.35 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 85.62 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 82.15 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 81.15 |
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
Probab=99.12 E-value=2.8e-11 Score=80.21 Aligned_cols=63 Identities=67% Similarity=1.105 Sum_probs=54.7
Q ss_pred cceeeeeeeeCCCccCcccccCchhHHHHHhhhceeEEeecCCCCCCCCCCCCCCccceEEeeeE
Q psy986 2 LEYSEESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQPTLPREEGQVPFMVLTKT 66 (71)
Q Consensus 2 LEf~e~~l~V~~~dvGKVIGk~Gr~ikaIr~~~~a~~iki~~~~e~~~~~~~~~~~vpF~~vGt~ 66 (71)
|++.+..+.||++.+|.+|||+|++|+.|++.+|+..++|..+++.. .+.+++.+||.++||.
T Consensus 64 l~~~e~~v~Vp~~~~g~~IGK~G~nIr~i~~~tG~~~I~i~~~~~~~--~~~~~~~~~vtI~G~~ 126 (144)
T 2qnd_A 64 LEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKN--VPQEEGMVPFVFVGTK 126 (144)
T ss_dssp HCEEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHTCSEEEEEEECTTC--CCCCTTEEEEEEEEEH
T ss_pred hhcceEEEEECHHHcCeeECCCCHHHHHHHHHHCCEEEEEcCCCCCC--ccccCCeeEEEEEeCH
Confidence 56778899999999999999999999999999999999998765542 3567788999999984
|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gku_A Probable RNA-binding protein; APC21302, clostridium symbiosum ATCC 14 structural genomics, PSI-2, protein structure initiative; 2.95A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 71 | ||||
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 7e-07 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 1e-06 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 2e-06 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-06 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 3e-06 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 5e-06 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 6e-06 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-05 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 2e-05 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-05 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 3e-05 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-05 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 5e-05 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 9e-05 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 1e-04 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 1e-04 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-04 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 2e-04 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 2e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 6e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 0.001 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 0.003 |
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Neuro-oncological ventral antigen 2, nova-2, KH3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.2 bits (94), Expect = 7e-07
Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
Query: 9 LQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNEPQP 49
+ VP NLVG ++GK G+ + E + +G R++I E P
Sbjct: 7 MAVPENLVGAILGKGGKTLVEYQELTG-ARIQISKKGEFLP 46
|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 98.73 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 98.7 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 98.57 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 98.4 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 98.35 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 98.33 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 98.3 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.21 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 98.21 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.1 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 98.07 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 98.06 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.06 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 97.94 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.88 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.71 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 97.68 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 96.65 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.27 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 93.82 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 90.36 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 87.97 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 83.48 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 80.23 |
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73 E-value=5.5e-09 Score=60.33 Aligned_cols=40 Identities=33% Similarity=0.595 Sum_probs=35.3
Q ss_pred eeeeeeCCCccCcccccCchhHHHHHhhhceeEEeecCCCC
Q psy986 6 EESLQVPRNLVGKVIGKNGRIIQEIVDKSGVVRVKIEGDNE 46 (71)
Q Consensus 6 e~~l~V~~~dvGKVIGk~Gr~ikaIr~~~~a~~iki~~~~e 46 (71)
++++.||.+.+|++|||+|.+|+.|++.+|+ .++|+.+.+
T Consensus 2 ~~~~~IP~~~vg~IIGk~G~~Ik~I~~~sga-~I~i~~~~~ 41 (71)
T d1j4wa2 2 EFNFIVPTGKTGLIIGKGGETIKSISQQSGA-RIELQRNPP 41 (71)
T ss_dssp EEEEEEETTTHHHHHCGGGHHHHHHHHHHCC-EEEEECCCT
T ss_pred EEEEEEChHhcceEECCCCcChHHHHhhcCc-EEEEeecCC
Confidence 5789999999999999999999999999984 788875544
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|