Psyllid ID: psy9876

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
VDLTGGLNQVYLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDNAESVKTGNAGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPFNIMSRKLES
cccccccccccccccccccccccccccccccEEEcccccEEEEEEEcEEEEccccccEEEEEEEccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccEEEEEccccEEEEEEEEEEcccccEEEEEEEEccccccccEEEEEccccccccccccccccccccccccccc
cccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEcccEcccccEccccEEEEEcccccccccccccHHHHcccccEEEEEEEEccccccccccccccccccEEEccccEEEEEEEcccccEEEEEEEccccccEEEEEEEEccccEEEEEEEEcccccccHHHHcccEccccccccHHccc
vdltgglnqvyliyphgaptdpdrhagdlgsitadkngfVSLQISDhvlsldgpltilgrgvvvhekaddlgrgdnaesvktgnAGARLAQFIhknpglnpallgldgnwnlmlTVTGPIMAVAILngkdvkgtvlflqpkpqgpvlisgnitgltpgdhgfhihekgdisqgcasmgphynpfnimsrkles
VDLTGGLNQVYLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEkaddlgrgdnaesvKTGNAGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPFNIMSRKLES
VDLTGGLNQVYLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDNAESVKTGNAGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPFNIMSRKLES
*****GLNQVYLIYPHG***********LGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKA****************AGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCA******************
VDLTGGLNQVYLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADD*****************RLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPF*********
VDLTGGLNQVYLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDNAESVKTGNAGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPFNIMSRKLES
****GGLNQVY***PHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDNAESVKTGNAGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPFNI*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VDLTGGLNQVYLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDNAESVKTGNAGARLAQFIHKNPGLNPALLGLDGNWNLMLTVTGPIMAVAILNGKDVKGTVLFLQPKPQGPVLISGNITGLTPGDHGFHIHEKGDISQGCASMGPHYNPFNIMSRKLES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query193 2.2.26 [Sep-21-2011]
Q8HXQ4155 Superoxide dismutase [Cu- N/A N/A 0.383 0.477 0.620 5e-21
Q8HXQ3154 Superoxide dismutase [Cu- N/A N/A 0.388 0.487 0.607 9e-21
P60052154 Superoxide dismutase [Cu- yes N/A 0.388 0.487 0.607 2e-20
P00441154 Superoxide dismutase [Cu- yes N/A 0.388 0.487 0.607 2e-20
Q52RN5152 Superoxide dismutase [Cu- N/A N/A 0.393 0.5 0.607 2e-20
P03946152 Superoxide dismutase [Cu- N/A N/A 0.383 0.486 0.626 4e-20
P00442152 Superoxide dismutase [Cu- yes N/A 0.383 0.486 0.607 7e-20
Q8HXP9154 Superoxide dismutase [Cu- N/A N/A 0.388 0.487 0.594 7e-20
P00443154 Superoxide dismutase [Cu- yes N/A 0.404 0.506 0.582 1e-19
P08228154 Superoxide dismutase [Cu- yes N/A 0.383 0.480 0.6 1e-19
>sp|Q8HXQ4|SODC_PONPY Superoxide dismutase [Cu-Zn] OS=Pongo pygmaeus GN=SOD1 PE=2 SV=3 Back     alignment and function desciption
 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (74%)

Query: 12  LIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDL 71
           L   HG P D +RH GDLG++TADK+G  S+ I D V+SL G   I+GR +VVHEKADDL
Sbjct: 69  LSRKHGGPKDEERHVGDLGNVTADKDGVASVSIEDSVISLSGDHCIIGRTLVVHEKADDL 128

Query: 72  GRGDNAESVKTGNAGARLA 90
           G+G N ES KTGNAG+RLA
Sbjct: 129 GKGGNEESTKTGNAGSRLA 147
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Pongo pygmaeus (taxid: 9600)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|Q8HXQ3|SODC_HYLLA Superoxide dismutase [Cu-Zn] OS=Hylobates lar GN=SOD1 PE=2 SV=3 Back     alignment and function description
>sp|P60052|SODC_PANTR Superoxide dismutase [Cu-Zn] OS=Pan troglodytes GN=SOD1 PE=2 SV=2 Back     alignment and function description
>sp|P00441|SODC_HUMAN Superoxide dismutase [Cu-Zn] OS=Homo sapiens GN=SOD1 PE=1 SV=2 Back     alignment and function description
>sp|Q52RN5|SODC_BOSMU Superoxide dismutase [Cu-Zn] OS=Bos mutus grunniens GN=SOD1 PE=2 SV=3 Back     alignment and function description
>sp|P03946|SODC_XIPGL Superoxide dismutase [Cu-Zn] OS=Xiphias gladius GN=sod1 PE=1 SV=2 Back     alignment and function description
>sp|P00442|SODC_BOVIN Superoxide dismutase [Cu-Zn] OS=Bos taurus GN=SOD1 PE=1 SV=2 Back     alignment and function description
>sp|Q8HXP9|SODC_CEBAP Superoxide dismutase [Cu-Zn] OS=Cebus apella GN=SOD1 PE=2 SV=3 Back     alignment and function description
>sp|P00443|SODC_HORSE Superoxide dismutase [Cu-Zn] OS=Equus caballus GN=SOD1 PE=1 SV=2 Back     alignment and function description
>sp|P08228|SODC_MOUSE Superoxide dismutase [Cu-Zn] OS=Mus musculus GN=Sod1 PE=1 SV=2 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query193
UNIPROTKB|Q8HXQ4155 SOD1 "Superoxide dismutase [Cu 0.388 0.483 0.64 5.5e-22
UNIPROTKB|Q8HXQ3154 SOD1 "Superoxide dismutase [Cu 0.388 0.487 0.626 9e-22
UNIPROTKB|Q52RN5152 SOD1 "Superoxide dismutase [Cu 0.388 0.493 0.626 1.5e-21
UNIPROTKB|P00441154 SOD1 "Superoxide dismutase [Cu 0.388 0.487 0.626 1.5e-21
UNIPROTKB|P60052154 SOD1 "Superoxide dismutase [Cu 0.388 0.487 0.626 1.5e-21
UNIPROTKB|H7BYH4135 SOD1 "Superoxide dismutase [Cu 0.388 0.555 0.626 1.5e-21
UNIPROTKB|P00442152 SOD1 "Superoxide dismutase [Cu 0.388 0.493 0.626 1.9e-21
UNIPROTKB|Q8HXP9154 SOD1 "Superoxide dismutase [Cu 0.388 0.487 0.613 4.9e-21
UNIPROTKB|F1MNQ4152 F1MNQ4 "Superoxide dismutase [ 0.388 0.493 0.613 6.3e-21
MGI|MGI:98351154 Sod1 "superoxide dismutase 1, 0.388 0.487 0.6 8e-21
UNIPROTKB|Q8HXQ4 SOD1 "Superoxide dismutase [Cu-Zn]" [Pongo pygmaeus (taxid:9600)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 48/75 (64%), Positives = 58/75 (77%)

Query:    16 HGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGD 75
             HG P D +RH GDLG++TADK+G  S+ I D V+SL G   I+GR +VVHEKADDLG+G 
Sbjct:    73 HGGPKDEERHVGDLGNVTADKDGVASVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGG 132

Query:    76 NAESVKTGNAGARLA 90
             N ES KTGNAG+RLA
Sbjct:   133 NEESTKTGNAGSRLA 147
GO:0000187 "activation of MAPK activity" evidence=ISS
GO:0000303 "response to superoxide" evidence=ISS
GO:0001541 "ovarian follicle development" evidence=ISS
GO:0001819 "positive regulation of cytokine production" evidence=ISS
GO:0001895 "retina homeostasis" evidence=ISS
GO:0002262 "myeloid cell homeostasis" evidence=ISS
GO:0004784 "superoxide dismutase activity" evidence=ISS
GO:0005507 "copper ion binding" evidence=ISS
GO:0005615 "extracellular space" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0005829 "cytosol" evidence=ISS
GO:0006302 "double-strand break repair" evidence=ISS
GO:0006309 "apoptotic DNA fragmentation" evidence=ISS
GO:0006749 "glutathione metabolic process" evidence=ISS
GO:0006801 "superoxide metabolic process" evidence=ISS
GO:0006879 "cellular iron ion homeostasis" evidence=ISS
GO:0007283 "spermatogenesis" evidence=ISS
GO:0007566 "embryo implantation" evidence=ISS
GO:0007569 "cell aging" evidence=ISS
GO:0007605 "sensory perception of sound" evidence=ISS
GO:0007626 "locomotory behavior" evidence=ISS
GO:0008217 "regulation of blood pressure" evidence=ISS
GO:0008270 "zinc ion binding" evidence=ISS
GO:0009408 "response to heat" evidence=ISS
GO:0010033 "response to organic substance" evidence=ISS
GO:0019226 "transmission of nerve impulse" evidence=ISS
GO:0019430 "removal of superoxide radicals" evidence=ISS
GO:0030346 "protein phosphatase 2B binding" evidence=ISS
GO:0031012 "extracellular matrix" evidence=ISS
GO:0031410 "cytoplasmic vesicle" evidence=ISS
GO:0032287 "peripheral nervous system myelin maintenance" evidence=ISS
GO:0032839 "dendrite cytoplasm" evidence=ISS
GO:0040014 "regulation of multicellular organism growth" evidence=ISS
GO:0042493 "response to drug" evidence=ISS
GO:0042542 "response to hydrogen peroxide" evidence=ISS
GO:0043025 "neuronal cell body" evidence=ISS
GO:0043085 "positive regulation of catalytic activity" evidence=ISS
GO:0043234 "protein complex" evidence=ISS
GO:0043524 "negative regulation of neuron apoptotic process" evidence=ISS
GO:0045471 "response to ethanol" evidence=ISS
GO:0045541 "negative regulation of cholesterol biosynthetic process" evidence=ISS
GO:0045859 "regulation of protein kinase activity" evidence=ISS
GO:0046716 "muscle cell homeostasis" evidence=ISS
GO:0048678 "response to axon injury" evidence=ISS
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=ISS
GO:0051087 "chaperone binding" evidence=ISS
GO:0051881 "regulation of mitochondrial membrane potential" evidence=ISS
GO:0060047 "heart contraction" evidence=ISS
GO:0060052 "neurofilament cytoskeleton organization" evidence=ISS
GO:0060087 "relaxation of vascular smooth muscle" evidence=ISS
GO:0060088 "auditory receptor cell stereocilium organization" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
UNIPROTKB|Q8HXQ3 SOD1 "Superoxide dismutase [Cu-Zn]" [Hylobates lar (taxid:9580)] Back     alignment and assigned GO terms
UNIPROTKB|Q52RN5 SOD1 "Superoxide dismutase [Cu-Zn]" [Bos grunniens (taxid:30521)] Back     alignment and assigned GO terms
UNIPROTKB|P00441 SOD1 "Superoxide dismutase [Cu-Zn]" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P60052 SOD1 "Superoxide dismutase [Cu-Zn]" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYH4 SOD1 "Superoxide dismutase [Cu-Zn]" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00442 SOD1 "Superoxide dismutase [Cu-Zn]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXP9 SOD1 "Superoxide dismutase [Cu-Zn]" [Cebus apella (taxid:9515)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNQ4 F1MNQ4 "Superoxide dismutase [Cu-Zn]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:98351 Sod1 "superoxide dismutase 1, soluble" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33431SODC_CAVPO1, ., 1, 5, ., 1, ., 10.55690.39890.5032yesN/A
P80566SODC_CHICK1, ., 1, 5, ., 1, ., 10.60.38340.4805yesN/A
P08228SODC_MOUSE1, ., 1, 5, ., 1, ., 10.60.38340.4805yesN/A
Q6FWL5SODC_CANGA1, ., 1, 5, ., 1, ., 10.54660.37820.4740yesN/A
P60052SODC_PANTR1, ., 1, 5, ., 1, ., 10.60750.38860.4870yesN/A
Q8WNN6SODC_CANFA1, ., 1, 5, ., 1, ., 10.55690.39890.5032yesN/A
P09212SODC_RABIT1, ., 1, 5, ., 1, ., 10.56960.39890.5032yesN/A
Q7M1R5SODC_SOYBN1, ., 1, 5, ., 1, ., 10.52560.39370.5yesN/A
Q8HXQ0SODC_MACMU1, ., 1, 5, ., 1, ., 10.58220.40410.5064yesN/A
P04178SODC_PIG1, ., 1, 5, ., 1, ., 10.60.37820.4771yesN/A
O73872SODC_DANRE1, ., 1, 5, ., 1, ., 10.58660.38340.4805yesN/A
Q6CPE2SODC_KLULA1, ., 1, 5, ., 1, ., 10.57330.37820.4709yesN/A
Q9C0N4SODC_CRYGA1, ., 1, 5, ., 1, ., 10.61330.37820.4740yesN/A
Q0IIW3SODC_XENTR1, ., 1, 5, ., 1, ., 10.58660.38340.4900yesN/A
Q8HXP8SODC_CALJA1, ., 1, 5, ., 1, ., 10.59490.38860.4870yesN/A
P00445SODC_YEAST1, ., 1, 5, ., 1, ., 10.520.37820.4740yesN/A
P07632SODC_RAT1, ., 1, 5, ., 1, ., 10.58660.38340.4805yesN/A
Q751L8SODC_ASHGO1, ., 1, 5, ., 1, ., 10.54660.37820.4740yesN/A
P00442SODC_BOVIN1, ., 1, 5, ., 1, ., 10.60750.38340.4868yesN/A
P00443SODC_HORSE1, ., 1, 5, ., 1, ., 10.58220.40410.5064yesN/A
P00441SODC_HUMAN1, ., 1, 5, ., 1, ., 10.60750.38860.4870yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.1LOW CONFIDENCE prediction!
3rd Layer1.15.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 2e-25
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 2e-21
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 6e-21
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 3e-20
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 1e-18
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 7e-16
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 3e-14
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 4e-13
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 2e-12
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 4e-10
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 9e-07
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information 
 Score = 95.8 bits (239), Expect = 2e-25
 Identities = 39/76 (51%), Positives = 52/76 (68%)

Query: 15  PHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRG 74
            HG P D  RHAGDLG+I ADK+G  ++ + D ++SL G  +I+GR +VVH   DDLG+G
Sbjct: 68  KHGGPNDEGRHAGDLGNIVADKDGVATVSVLDPLISLKGGNSIIGRSLVVHAGQDDLGKG 127

Query: 75  DNAESVKTGNAGARLA 90
            +  S  TGNAG R+A
Sbjct: 128 PDELSGGTGNAGVRVA 143

superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene causes familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Cytoplasmic and periplasmic SODs exist as dimers, whereas chloroplastic and extracellular enzymes exist as tetramers. Structure supports independent functional evolution in prokaryotes (P-class) and eukaryotes (E-class) [PMID:.8176730]. Length = 144
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 193
PLN02386152 superoxide dismutase [Cu-Zn] 99.97
PLN02642164 copper, zinc superoxide dismutase 99.97
KOG0441|consensus154 99.94
PRK15388177 Cu/Zn superoxide dismutase; Provisional 99.91
PRK10290173 superoxide dismutase; Provisional 99.9
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 99.89
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 99.88
PLN02642164 copper, zinc superoxide dismutase 99.87
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 99.87
PLN02386152 superoxide dismutase [Cu-Zn] 99.86
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 99.82
KOG0441|consensus154 99.81
PLN02957238 copper, zinc superoxide dismutase 99.79
KOG4656|consensus247 99.78
PRK15388177 Cu/Zn superoxide dismutase; Provisional 99.77
PRK10290173 superoxide dismutase; Provisional 99.75
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 99.73
PLN02957238 copper, zinc superoxide dismutase 99.73
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 99.65
KOG4656|consensus247 99.61
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information 
Probab=99.97  E-value=9.7e-31  Score=209.00  Aligned_cols=96  Identities=45%  Similarity=0.661  Sum_probs=92.9

Q ss_pred             CCCCCccCC-----CCCCCCCCCCCCCCCCCcCCCEEECCCccEEEEEEEceeeeCCCCCCCccEEEEeeccCCCCCCCC
Q psy9876           2 DLTGGLNQV-----YLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDN   76 (193)
Q Consensus         2 d~s~gc~s~-----p~~~~hg~~~~~~~h~GDLgni~~~~~G~~~~~~~~~~~~L~g~~siiGRslVIH~~~Dd~~~~~~   76 (193)
                      |++++|.|+     |++++||.|++..||+||||||+++++|++++.+++++++|.|+++|+|||||||+++|||+++++
T Consensus        51 d~~~g~~SaGgHfnP~~~~Hg~~~~~~~H~GDLgNi~~~~~G~a~~~~~~~~~~L~g~~~i~GrslVIHa~~DD~~~~~~  130 (152)
T PLN02386         51 DTTNGCMSTGPHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIVDKQIPLTGPNSIVGRAVVVHADPDDLGKGGH  130 (152)
T ss_pred             CCCCCcccccCccCCCCCCCCCCCcccCccccccCEEECCCCeEEEEEECCceEeCCCCccCCcEEEEEccCCCcCCCcc
Confidence            789999999     999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCCeeEEEEecCC
Q psy9876          77 AESVKTGNAGARLAQFIHKNP   97 (193)
Q Consensus        77 ~~s~~~G~aG~riaCgvI~~~   97 (193)
                      +.|+++|+||.|||||||++.
T Consensus       131 ~~s~~~G~aG~RiACgvI~~~  151 (152)
T PLN02386        131 ELSKSTGNAGGRVACGIIGLQ  151 (152)
T ss_pred             cccccCCCCCceEEEEEEEec
Confidence            999999999999999999864

>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG0441|consensus Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>KOG0441|consensus Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 9e-22
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 5e-13
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 1e-21
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 2e-12
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 1e-21
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 3e-13
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 1e-21
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 3e-13
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 1e-21
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 9e-13
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 1e-21
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 3e-13
3gqf_A153 Structural And Biophysical Properties Of The Pathog 1e-21
3gqf_A153 Structural And Biophysical Properties Of The Pathog 3e-11
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 1e-21
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 3e-11
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 1e-21
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 8e-13
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 1e-21
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 2e-12
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 1e-21
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 5e-12
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 2e-21
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 7e-13
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 2e-21
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 7e-13
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 2e-21
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 5e-12
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 2e-21
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 2e-12
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 2e-21
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 2e-12
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 2e-21
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 5e-12
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 2e-21
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 5e-13
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 2e-21
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 1e-12
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 2e-21
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 3e-13
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 2e-21
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 3e-12
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 2e-21
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 7e-13
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 2e-21
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 2e-14
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 2e-21
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 2e-12
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 3e-21
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 5e-13
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 3e-21
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 6e-13
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 3e-21
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 8e-13
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 3e-21
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 3e-13
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 6e-21
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 6e-12
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 6e-21
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 8e-13
1cob_A151 Crystal Structure Solution And Refinement Of The Se 6e-21
1cob_A151 Crystal Structure Solution And Refinement Of The Se 6e-12
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 6e-21
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 8e-13
3gzo_A154 Human Sod1 G93a Variant Length = 154 6e-21
3gzo_A154 Human Sod1 G93a Variant Length = 154 8e-13
3sod_O152 Changes In Crystallographic Structure And Thermosta 6e-21
3sod_O152 Changes In Crystallographic Structure And Thermosta 2e-12
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 7e-21
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-12
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 8e-21
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 6e-12
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 8e-21
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 7e-13
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 9e-21
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 7e-12
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 1e-20
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 8e-13
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 1e-20
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 7e-13
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 1e-20
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 7e-13
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 1e-20
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 3e-11
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-20
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-13
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-20
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-13
3gtt_A153 Mouse Sod1 Length = 153 1e-20
3gtt_A153 Mouse Sod1 Length = 153 2e-14
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 1e-20
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 4e-12
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-20
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-12
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 1e-20
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 7e-13
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 1e-20
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 8e-13
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 2e-20
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 7e-13
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 2e-20
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 7e-13
3h2p_A153 Human Sod1 D124v Variant Length = 153 2e-20
3h2p_A153 Human Sod1 D124v Variant Length = 153 8e-13
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 2e-20
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 4e-12
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-20
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 4e-12
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 2e-20
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 4e-12
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 3e-20
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 6e-12
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 4e-20
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 6e-12
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 5e-20
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 2e-13
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 5e-20
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 6e-11
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 5e-19
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 3e-12
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 5e-17
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 5e-10
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 6e-17
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 1e-09
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 6e-17
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 9e-10
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 6e-17
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 8e-10
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 6e-17
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 9e-11
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 7e-17
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 8e-11
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 2e-16
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 2e-13
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 2e-16
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 2e-13
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 5e-16
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 8e-11
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 7e-16
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 3e-10
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 3e-15
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 3e-10
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 4e-15
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 1e-10
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 6e-15
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 1e-11
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 1e-14
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 1e-14
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 1e-14
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 1e-14
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 2e-12
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 2e-14
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 1e-11
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 7e-13
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 2e-10
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 5e-11
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 2e-10
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 1e-08
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 1e-06
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 6e-07
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 1e-04
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 6e-07
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 1e-05
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 59/79 (74%)
Query: 12  LIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDL 71
           L   HG P D +RH GDLG++TADK+G   + I D V+SL G  +I+GR +VVHEKADDL
Sbjct: 67  LSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDL 126
Query: 72  GRGDNAESVKTGNAGARLA 90
           G+G N ES KTGNAG+RLA
Sbjct: 127 GKGGNEESTKTGNAGSRLA 145
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 5e-30
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 6e-27
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 4e-29
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 2e-23
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 5e-29
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 1e-25
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 1e-28
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 2e-27
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 2e-28
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 1e-24
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 2e-28
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 1e-25
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 2e-28
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 2e-25
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 3e-28
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 1e-26
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 4e-28
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 7e-27
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 8e-28
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 8e-26
1do5_A154 Human copper chaperone for superoxide dismutase do 4e-27
1do5_A154 Human copper chaperone for superoxide dismutase do 8e-26
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 4e-27
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 2e-25
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 1e-24
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 6e-15
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 4e-22
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 7e-18
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 4e-22
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 3e-19
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 7e-22
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 2e-18
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 1e-21
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 1e-18
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 2e-21
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 9e-18
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 3e-21
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 3e-18
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 4e-21
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 6e-21
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 1e-20
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 1e-07
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 6e-20
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 9e-19
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 4e-15
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 1e-09
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 2e-14
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 7e-09
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
 Score =  107 bits (268), Expect = 5e-30
 Identities = 38/76 (50%), Positives = 50/76 (65%)

Query: 15  PHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRG 74
            HGAP D  RH GDLG++ A  +G      +D ++SL+G  +I+GR +V+HE  DDLGRG
Sbjct: 72  EHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRG 131

Query: 75  DNAESVKTGNAGARLA 90
            +  S  TGNAG RLA
Sbjct: 132 GHELSKVTGNAGGRLA 147
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query193
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 99.98
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 99.97
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 99.97
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 99.97
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 99.97
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 99.97
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 99.97
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 99.97
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 99.97
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 99.97
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 99.97
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 99.97
1do5_A154 Human copper chaperone for superoxide dismutase do 99.96
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 99.94
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 99.93
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 99.93
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 99.92
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 99.92
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 99.91
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 99.91
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 99.91
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 99.9
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 99.9
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 99.89
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 99.89
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 99.89
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 99.88
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 99.88
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 99.88
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 99.88
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 99.87
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 99.87
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 99.87
1do5_A154 Human copper chaperone for superoxide dismutase do 99.86
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 99.86
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 99.86
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 99.84
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 99.81
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 99.79
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 99.79
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 99.79
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 99.78
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 99.78
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 99.76
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 99.76
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 99.76
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 99.76
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 99.76
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 99.74
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 99.74
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
Probab=99.98  E-value=1.1e-32  Score=219.11  Aligned_cols=97  Identities=42%  Similarity=0.651  Sum_probs=94.0

Q ss_pred             CCCCCccCC-----CCCCCCCCCCCCCCCCCcCCCEEECCCccEEEEEEEceeeeCCCCCCCccEEEEeeccCCCCCCCC
Q psy9876           2 DLTGGLNQV-----YLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDN   76 (193)
Q Consensus         2 d~s~gc~s~-----p~~~~hg~~~~~~~h~GDLgni~~~~~G~~~~~~~~~~~~L~g~~siiGRslVIH~~~Dd~~~~~~   76 (193)
                      |+|+||.|+     |+++.||.|++..||+||||||+++++|++++.|++++++|+|+++|||||||||+++|||++|++
T Consensus        50 d~s~gc~SaGgHfnP~~~~Hg~p~~~~~H~GDLgni~~~~~G~a~~~~~d~~i~L~g~~~iiGRslVIHa~~Dd~g~g~~  129 (152)
T 3f7l_A           50 DNTNGCTSAGGHFNPHGKEHGAPEDENRHAGDLGNVVAGEDGKAVINMKDKLVKLTGPDSVIGRTLVVHVDEDDLGRGGH  129 (152)
T ss_dssp             CCTTTTGGGCSBCCTTCCCCCCTTCSSSCTTEEEEEEECTTSCEEEEEEESSCBSSSTTBCTTCEEEEESSCCCTTCSCS
T ss_pred             cCCCCcccccccccccCCcCCCCCCCCCccccccCeEECCCCeEEEEEECcceeccCCcccCCeEEEEEcCCccCCCCCC
Confidence            789999999     999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCCeeEEEEecCCC
Q psy9876          77 AESVKTGNAGARLAQFIHKNPG   98 (193)
Q Consensus        77 ~~s~~~G~aG~riaCgvI~~~~   98 (193)
                      +.|+++||||.|||||||+..+
T Consensus       130 ~~s~~tGnaG~RiACgvI~~~~  151 (152)
T 3f7l_A          130 EQSKITGNAGGRLACGVIGITK  151 (152)
T ss_dssp             TTHHHHTTCCSEEEEEECEECC
T ss_pred             cCcccCCCCCceEEEEEEEEec
Confidence            9999999999999999998764
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 193
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 1e-20
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 1e-16
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 4e-20
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 1e-14
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 5e-20
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 9e-13
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 6e-20
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 5e-16
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 1e-18
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 1e-14
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-17
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 3e-14
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 1e-15
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 2e-09
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 6e-15
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 3e-07
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 3e-14
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 2e-12
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 5e-14
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 4e-13
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 1e-13
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 3e-12
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 3e-12
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 1e-10
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.0 bits (202), Expect = 1e-20
 Identities = 47/77 (61%), Positives = 57/77 (74%)

Query: 14  YPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGR 73
             HG P D +RH GDLG++TADK+G   + I D V+SL G   I+GR +VVHEKADDLG+
Sbjct: 69  RKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGK 128

Query: 74  GDNAESVKTGNAGARLA 90
           G N ES KTGNAG+RLA
Sbjct: 129 GGNEESTKTGNAGSRLA 145
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query193
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 99.96
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 99.96
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 99.96
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 99.96
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 99.95
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 99.94
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 99.92
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 99.9
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 99.9
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 99.89
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 99.89
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 99.89
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 99.88
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 99.87
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 99.86
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 99.86
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 99.84
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 99.83
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 99.78
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 99.77
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 99.76
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 99.75
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 99.75
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 99.6
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

Probab=99.96  E-value=2e-30  Score=204.93  Aligned_cols=97  Identities=42%  Similarity=0.641  Sum_probs=94.2

Q ss_pred             CCCCCccCC-----CCCCCCCCCCCCCCCCCcCCCEEECCCccEEEEEEEceeeeCCCCCCCccEEEEeeccCCCCCCCC
Q psy9876           2 DLTGGLNQV-----YLIYPHGAPTDPDRHAGDLGSITADKNGFVSLQISDHVLSLDGPLTILGRGVVVHEKADDLGRGDN   76 (193)
Q Consensus         2 d~s~gc~s~-----p~~~~hg~~~~~~~h~GDLgni~~~~~G~~~~~~~~~~~~L~g~~siiGRslVIH~~~Dd~~~~~~   76 (193)
                      |++.+|.|+     |++.+||.|++..+|+||||||+++++|++++++++++++|+++++|+|||||||+++|||+++++
T Consensus        54 d~s~~~~saGgH~nP~~~~hg~~~~~~~h~GDlgni~~~~~G~~~~~~~d~~l~l~g~~~iiGRsiVIH~~~Dd~~~~~~  133 (156)
T d1to4a_          54 DTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGH  133 (156)
T ss_dssp             CCTTTTGGGCSBCCTTCCCCCCTTCSSCCTTEEEEEEECTTSCEEEEEEESSCBSSGGGBCTTSEEEEESSCCCTTCSCS
T ss_pred             ccCCcccccccccccccccccCCCcccCccCccccEEeCCCceEEEEEECceeecCCcCCcCCcEEEEECCCCccccCCc
Confidence            789999999     999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCCeeEEEEecCCC
Q psy9876          77 AESVKTGNAGARLAQFIHKNPG   98 (193)
Q Consensus        77 ~~s~~~G~aG~riaCgvI~~~~   98 (193)
                      +.|+++|++|+|||||||++++
T Consensus       134 ~~s~~~G~aG~RiACgvIg~a~  155 (156)
T d1to4a_         134 ELSKVTGNAGGRLACGVVGLAA  155 (156)
T ss_dssp             TTHHHHTTCCSEEEEEECEECC
T ss_pred             ccccccCCCCceEEEEEEEEec
Confidence            9999999999999999999874
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure