254780149

254780149

hypothetical protein CLIBASIA_00140

GeneID in NCBI database:8209124Locus tag:CLIBASIA_00140
Protein GI in NCBI database:254780149Protein Accession:YP_003064562.1
Gene range:-(31352, 31555)Protein Length:67aa
Gene description:hypothetical protein
COG prediction:[U] Preprotein translocase subunit SecE
KEGG prediction:hypothetical protein; K03073 preprotein translocase subunit SecE
SEED prediction:preprotein translocase
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60-------
MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
cccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MGVNRLAVLNFFKQVRdeskkifwpsrsEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
MGVNRLAVLNFFkqvrdeskkifwpsrseVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
MGVNRLAVLNFFKQVRDESKKIFWPSRSEvlvsvivviimlsissvFFLVIDQSIGWLMHFILGIGR
******A***FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG*
MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
***NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR
MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
31512275167 hypothetical protein CKC_05015 [Candidatus Liberibacter 1 1e-13
13387229465 preprotein translocase [Candidatus Liberibacter america 1 2e-10
220921884103 preprotein translocase subunit SecE [Methylobacterium n 1 5e-10
170738718101 preprotein translocase, SecE subunit [Methylobacterium 1 5e-10
22208566266 protein-export translocase protein [Agrobacterium radio 1 3e-09
304321356112 hypothetical protein PB2503_09019 [Parvularcula bermude 1 6e-09
16375940066 translocase [Hoeflea phototrophica DFL-43] Length = 66 1 9e-09
240140813100 Preprotein translocase subunit SecE-like protein [Methy 1 2e-08
163853395126 preprotein translocase, SecE subunit [Methylobacterium 1 3e-08
302382911103 preprotein translocase subunit SecE [Brevundimonas subv 1 4e-08
>gi|315122751|ref|YP_004063240.1| hypothetical protein CKC_05015 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Back     alignment and organism information
 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%)

Query: 1  MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60
          M VN L+++NFFKQV+ E K+IFWPSR+EVL+SV+VVIIMLSISS+F L IDQ IGW MH
Sbjct: 1  MRVNGLSIVNFFKQVKVEFKRIFWPSRNEVLISVVVVIIMLSISSMFLLAIDQLIGWFMH 60

Query: 61 FILGIG 66
          F+L IG
Sbjct: 61 FLLNIG 66


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|133872294|gb|ABO40214.1| preprotein translocase [Candidatus Liberibacter americanus] Length = 65 Back     alignment and organism information
>gi|220921884|ref|YP_002497185.1| preprotein translocase subunit SecE [Methylobacterium nodulans ORS 2060] Length = 103 Back     alignment and organism information
>gi|170738718|ref|YP_001767373.1| preprotein translocase, SecE subunit [Methylobacterium sp. 4-46] Length = 101 Back     alignment and organism information
>gi|222085662|ref|YP_002544192.1| protein-export translocase protein [Agrobacterium radiobacter K84] Length = 66 Back     alignment and organism information
>gi|304321356|ref|YP_003854999.1| hypothetical protein PB2503_09019 [Parvularcula bermudensis HTCC2503] Length = 112 Back     alignment and organism information
>gi|163759400|ref|ZP_02166486.1| translocase [Hoeflea phototrophica DFL-43] Length = 66 Back     alignment and organism information
>gi|240140813|ref|YP_002965293.1| Preprotein translocase subunit SecE-like protein [Methylobacterium extorquens AM1] Length = 100 Back     alignment and organism information
>gi|163853395|ref|YP_001641438.1| preprotein translocase, SecE subunit [Methylobacterium extorquens PA1] Length = 126 Back     alignment and organism information
>gi|302382911|ref|YP_003818734.1| preprotein translocase subunit SecE [Brevundimonas subvibrioides ATCC 15264] Length = 103 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
PRK0759764 PRK07597, secE, preprotein translocase subunit SecE; Re 2e-07
TIGR0096455 TIGR00964, secE_bact, preprotein translocase, SecE subu 1e-06
COG069073 COG0690, SecE, Preprotein translocase subunit SecE [Int 5e-06
PRK0574092 PRK05740, secE, preprotein translocase subunit SecE; Re 0.001
pfam0058456 pfam00584, SecE, SecE/Sec61-gamma subunits of protein t 1e-07
>gnl|CDD|181055 PRK07597, secE, preprotein translocase subunit SecE; Reviewed Back     alignment and domain information
>gnl|CDD|162136 TIGR00964, secE_bact, preprotein translocase, SecE subunit, bacterial Back     alignment and domain information
>gnl|CDD|31034 COG0690, SecE, Preprotein translocase subunit SecE [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|180229 PRK05740, secE, preprotein translocase subunit SecE; Reviewed Back     alignment and domain information
>gnl|CDD|144250 pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
TIGR0096461 secE_bact preprotein translocase, SecE subunit; InterPr 99.74
PRK05740124 secE preprotein translocase subunit SecE; Reviewed 99.73
PRK0759762 secE preprotein translocase subunit SecE; Reviewed 99.69
pfam0058456 SecE SecE/Sec61-gamma subunits of protein translocation 99.69
COG069073 SecE Preprotein translocase subunit SecE [Intracellular 99.62
TIGR0032761 secE_euk_arch protein translocase SEC61 complex gamma s 92.13
>TIGR00964 secE_bact preprotein translocase, SecE subunit; InterPro: IPR005807 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>PRK05740 secE preprotein translocase subunit SecE; Reviewed Back     alignment and domain information
>PRK07597 secE preprotein translocase subunit SecE; Reviewed Back     alignment and domain information
>pfam00584 SecE SecE/Sec61-gamma subunits of protein translocation complex Back     alignment and domain information
>COG0690 SecE Preprotein translocase subunit SecE [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00327 secE_euk_arch protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic; InterPro: IPR008158 This family is the protein translocase SEC61 complex gamma subunit of the archaeal and eukaryotic type Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
3j01_B116 Structure Of The Ribosome-Secye Complex In The Memb 1e-07
2akh_Z111 Normal Mode-Based Flexible Fitted Coordinates Of A 3e-07
3dl8_C65 Structure Of The Complex Of Aquifex Aeolicus Secyeg 5e-06
3din_D65 Crystal Structure Of The Protein-Translocation Comp 6e-06
2zjs_E60 Crystal Structure Of Secye Translocon From Thermus 2e-04
>gi|329666016|pdb|3J01|B Chain B, Structure Of The Ribosome-Secye Complex In The Membrane Environment Length = 116 Back     alignment and structure
 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 33/57 (57%)

Query: 9   LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65
           + F ++ R E +K+ WP+R E L + ++V  + ++ S+    +D  +  L+ FI G+
Sbjct: 58  VAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 114


>gi|83754006|pdb|2AKH|Z Chain Z, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli Length = 111 Back     alignment and structure
gi|215794646|pdb|3DL8|C Chain C, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca Length = 65 Back     alignment and structure
gi|209156623|pdb|3DIN|D Chain D, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase Length = 65 Back     alignment and structure
gi|209447388|pdb|2ZJS|E Chain E, Crystal Structure Of Secye Translocon From Thermus Thermophilus With A Fab Fragment Length = 60 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
3dl8_C65 SECE; RECA-type ATPase membrane protein translocation p 2e-08
3din_D65 Preprotein translocase subunit SECE; protein translocat 1e-07
3bo0_B65 Preprotein translocase SECE subunit; ribosome-SECY comp 1e-07
2zjs_E60 Preprotein translocase SECE subunit; translocon, SEC, p 5e-07
2akh_Z111 Preprotein translocase SECE subunit; protein transport, 8e-07
>3dl8_C SECE; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Length = 65 Back     alignment and structure
 Score = 52.7 bits (127), Expect = 2e-08
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 8  VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66
          +  F K VRDE K++ WPSR  V+ + I VII      V+  ++D +   ++ FIL + 
Sbjct: 4  LKEFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKIISFILSLR 62


>3din_D Preprotein translocase subunit SECE; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Length = 65 Back     alignment and structure
>3bo0_B Preprotein translocase SECE subunit; ribosome-SECY complex, protein translocation; 9.60A {Escherichia coli} PDB: 3bo1_B Length = 65 Back     alignment and structure
>2zjs_E Preprotein translocase SECE subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_E Length = 60 Back     alignment and structure
>2akh_Z Preprotein translocase SECE subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Z Length = 111 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
2akh_Z111 Preprotein translocase SECE subunit; protein transport, 99.78
3dl8_C65 SECE; RECA-type ATPase membrane protein translocation p 99.75
3bo0_B65 Preprotein translocase SECE subunit; ribosome-SECY comp 99.7
3din_D65 Preprotein translocase subunit SECE; protein translocat 99.7
2zjs_E60 Preprotein translocase SECE subunit; translocon, SEC, p 99.63
>2akh_Z Preprotein translocase SECE subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Z Back     alignment and structure
Probab=99.78  E-value=4.6e-19  Score=124.27  Aligned_cols=60  Identities=28%  Similarity=0.581  Sum_probs=57.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             559999999999998734898899999999999999999999999999999999999711
Q gi|254780149|r    6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI   65 (67)
Q Consensus         6 ~~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i~~l   65 (67)
                      .++.+|++|++.|+|||+||||||+.++|.+|+++++++++|+|++|.+++++++.++|+
T Consensus        50 ~~~~~f~~e~r~ElkKV~WPtr~E~~~~T~vVlv~vii~~lfl~~~D~~l~~~i~~ilgl  109 (111)
T 2akh_Z           50 KATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL  109 (111)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             589999999999984386999699986999999999999999999999999999998418



>3dl8_C SECE; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
>3bo0_B Preprotein translocase SECE subunit; ribosome-SECY complex, protein translocation; 9.60A {Escherichia coli} PDB: 3bo1_B 3kcr_B Back     alignment and structure
>3din_D Preprotein translocase subunit SECE; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Back     alignment and structure
>2zjs_E Preprotein translocase SECE subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_E Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 67 hypothetical protein CLIBASIA_00140 [Candidatus Li
3bo0_B_65 (B:) Preprotein translocase SECE subunit; ribosome 7e-10
3din_D_65 (D:) Preprotein translocase subunit SECE; protein 4e-09
3dl8_C_65 (C:) SECE; RECA-type ATPase membrane protein trans 7e-09
2akh_Z_111 (Z:) Preprotein translocase SECE subunit; protein 6e-08
2zjs_E_60 (E:) Preprotein translocase SECE subunit; transloc 2e-07
>3bo0_B (B:) Preprotein translocase SECE subunit; ribosome-SECY complex, protein translocation; 9.60A {Escherichia coli} PDB: 3bo1_BLength = 65 Back     alignment and structure
 Score = 57.3 bits (139), Expect = 7e-10
 Identities = 14/61 (22%), Positives = 27/61 (44%)

Query: 7  AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66
          A + F ++ R E +K+ WP+R       + V  + ++      +I   I     +I GI 
Sbjct: 5  ATVAFAREARTEVRKVIWPTRKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGIL 64

Query: 67 R 67
          +
Sbjct: 65 K 65


>3din_D (D:) Preprotein translocase subunit SECE; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8}Length = 65 Back     alignment and structure
>3dl8_C (C:) SECE; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus}Length = 65 Back     alignment and structure
>2akh_Z (Z:) Preprotein translocase SECE subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_ZLength = 111 Back     alignment and structure
>2zjs_E (E:) Preprotein translocase SECE subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_ELength = 60 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target67 hypothetical protein CLIBASIA_00140 [Candidatus Liberib
3bo0_B_65 Preprotein translocase SECE subunit; ribosome-SECY 99.79
2akh_Z_111 Preprotein translocase SECE subunit; protein trans 99.77
3dl8_C_65 SECE; RECA-type ATPase membrane protein translocat 99.76
3din_D_65 Preprotein translocase subunit SECE; protein trans 99.71
2zjs_E_60 Preprotein translocase SECE subunit; translocon, S 99.65
2ww9_B_80 Protein transport protein SSS1; ribonucleoprotein, 91.58
1rh5_B_74 Preprotein translocase SECE subunit; protein trans 91.25
2wwb_B_68 SEC61gamma, protein transport protein SEC61 subuni 90.97
>3bo0_B (B:) Preprotein translocase SECE subunit; ribosome-SECY complex, protein translocation; 9.60A {Escherichia coli} PDB: 3bo1_B Back     alignment and structure
Probab=99.79  E-value=4.3e-20  Score=130.76  Aligned_cols=64  Identities=22%  Similarity=0.371  Sum_probs=61.7

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             5655999999999999873489889999999999999999999999999999999999971179
Q gi|254780149|r    4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR   67 (67)
Q Consensus         4 ~~~~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i~~lgr   67 (67)
                      ...++.+|++|+++|||||+||||+|+.++|.+|+++++++++|+|++|.+++++++.++|+||
T Consensus         2 k~~~~~~f~~ev~~ElkKV~WPtr~E~~~~T~vVli~~ii~~~~l~~~D~~~~~~~~~i~gl~k   65 (65)
T 3bo0_B            2 KGKATVAFAREARTEVRKVIWPTRKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK   65 (65)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCTTTTTCTTHHHHHHHHHHHHHHHHHHHHHHHTTTTHHHHHHCC
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8487999999999998451089808988799999999999999999999999999999975339



>2akh_Z (Z:) Preprotein translocase SECE subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Z Back     alignment and structure
>3dl8_C (C:) SECE; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
>3din_D (D:) Preprotein translocase subunit SECE; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Back     alignment and structure
>2zjs_E (E:) Preprotein translocase SECE subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_E Back     alignment and structure
>2ww9_B (B:) Protein transport protein SSS1; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_B Back     alignment and structure
>1rh5_B (B:) Preprotein translocase SECE subunit; protein translocation, SECY, membrane protein, protein channels, protein transport; 3.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2wwb_B (B:) SEC61gamma, protein transport protein SEC61 subunit gamma; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} Back     alignment and structure