254780150

254780150

translation elongation factor Tu

GeneID in NCBI database:8209126Locus tag:CLIBASIA_00150
Protein GI in NCBI database:254780150Protein Accession:YP_003064563.1
Gene range:-(31790, 32968)Protein Length:392aa
Gene description:translation elongation factor Tu
COG prediction:[J] GTPases - translation elongation factors
KEGG prediction:translation elongation factor Tu; K02358 elongation factor EF-Tu [EC:3.6.5.3]
SEED prediction:Translation elongation factor Tu
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases;
Translation elongation factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
ccccccccccccEEEEEEEcccccHHHHHHHHHHHHccEEEEcccccccHHHHHcccEEEEEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccccHHHHHHHHHcccccccccccEEEEEEEEEccccccEEEEEEEEEEEEEccccEEEEEcccccEEEEEEEEEEcccEEEEEEccccEEEEEEEcccccccccccEEEEccccccccEEEEEEEEEEccccccccccccccEEEEEEccEEEEEEEEEcccHHHHccccEEEEEEEEcccEEEccccEEEEEEccEEEEEEEEEEEEc
ccHccccccccEEEEEEEccccccHHHHHHHHHHHHccccccHHHHHcccEEEEccEEEEcEEEEEEEccEEEEEEEcccHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHccccccccHHHHHHHHHHHHHHccccccccccccEEEccEEEEEcccEEEEEEEccEcEEEcccEEEEEccccccEEEEEEEEEEccEEccEEEcccEEEEEEccccccccccccEEEcccccccEEEEEEEEEEccHHHccccccEccccccEEEEccEEEEEEEEcccccccEccccEEEEEEEEEEEEccccccEEEEEEccEEEEEEEEEEEcc
mvekryvrnkeslglstighvdhgkTTLTAAITKYYSEEkkeygdidsapeekLRGITIATAHVSyetdkrfyshidcpghadYVKNMitgatqadGAILVCAaedgpkpqtREHILLARQIGISSIVVYMNkvdavdddelldiSEYEIRDLLKehkysddtpiiRGSALCALQGTNKELGEDSIHALMKAVdthiptpqrsldapflmhiegscgiegrgtvVTGCIkrgrikagsdveiIGMGGKKLKVKCTDVEMFRKKLDEAiagdnvglllrgvnradvprgrvvcapgsiqeySRFRASVYILTaseggrttgfmdnyrpqffmdtadvtgriilspgsqavmpgdrvDLEVELIYpiamepnqtfsmreggktvgAGLILEIIE
mvekryvrnkeslglstighvdhgkttLTAAITKYYSEEKkeygdidsapeekLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLkehkysddtpiIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKrgrikagsdveiigmggkklkvKCTDVEMFRKKLDeaiagdnvglllrgvnradvprGRVVcapgsiqeysrfRASVYILTaseggrttgFMDNYRPQFFMDTADVTGRIILSpgsqavmpgdRVDLEVELIYPIAmepnqtfsmreggKTVGAGLILEIIE
MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
*****YVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEII*
********NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
****RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target392 translation elongation factor Tu [Candidatus Liberibact
254780263392 translation elongation factor Tu [Candidatus Liber 0.0
254780233 624 GTP-binding protein [Candidatus Liberibacter asiat 3e-18
254780787 884 translation initiation factor IF-2 [Candidatus Lib 2e-10
254780264 701 elongation factor G [Candidatus Liberibacter asiat 3e-09
254780321 606 GTP-binding protein LepA [Candidatus Liberibacter 5e-09
>gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Back     alignment
 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60
           MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA
Sbjct: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60

Query: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120
           TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR
Sbjct: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120

Query: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180
           QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE
Sbjct: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180

Query: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240
           LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV
Sbjct: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240

Query: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300
           EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY
Sbjct: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300

Query: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360
           SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE
Sbjct: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360

Query: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392
           LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
Sbjct: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392

>gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Back     alignment
 Score = 84.7 bits (208), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 131/284 (46%), Gaps = 37/284 (13%)

Query: 15  LSTIGHVDHGKTTLTAAITK----YYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK 70
           ++ I HVDHGKTTL   + K    +   ++     +D    EK RGITI     S   + 
Sbjct: 22  IAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWND 81

Query: 71  RFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVY 130
              + +D PGHAD+   +       +  +++  A +GP PQT+  +  A +IG+  IVV 
Sbjct: 82  VRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVV- 140

Query: 131 MNKVDAVD--DDELLDISEYEIRDLLKEHKYSD---DTPIIRGSALCALQGTNKELGEDS 185
           +NKVD  D   DE+++    E+ DL      +D   D PI+ GS        + +   D 
Sbjct: 141 VNKVDRSDARADEVIN----EVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQ 196

Query: 186 -IHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGR--------GTVVTGCIKRGRIKA 236
            +  L+  +  H+P P  S         EG   + G         G +VTG I  G IK+
Sbjct: 197 GMVPLLNLIVDHVPPPVIS---------EGEFKMIGTILEKDPFLGRIVTGRIHSGTIKS 247

Query: 237 GSDVEIIGMGGKKLKV-KCTDVEMF----RKKLDEAIAGDNVGL 275
             +++ +   G  ++V + + +  F    R+ +DEA AGD V +
Sbjct: 248 NQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSI 291

>gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Back     alignment
 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 67/128 (52%), Gaps = 17/128 (13%)

Query: 15  LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGIT--IATAHVSYETDKRF 72
           ++ +GHVDHGKT+L  AI K            D A  E + GIT  I    V+Y+   + 
Sbjct: 386 VTIMGHVDHGKTSLLDAIRKA-----------DVAKGE-IGGITQHIGAYQVAYQG--KN 431

Query: 73  YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMN 132
            + +D PGHA + +    GA   D A+LV AA++   PQ  E I  A+   + SI+V +N
Sbjct: 432 ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIVAIN 490

Query: 133 KVDAVDDD 140
           K+D +  D
Sbjct: 491 KIDKLGAD 498

>gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Back     alignment
 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 18/150 (12%)

Query: 5   RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDI-------DSAPEEKLRGI 57
           R  + ++S     + H+D GKTT T  I  YY+ +  + G++       D   +E+ RGI
Sbjct: 3   RKCKIEDSRNFGIMAHIDAGKTTTTERIL-YYAGKSHKIGEVHDGSATMDWMEQEQERGI 61

Query: 58  TIATAHVSY-----ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQT 112
           TI +A  +      +  ++  + ID PGH D+   +       DGAI +  +  G +PQT
Sbjct: 62  TITSASTTVFWPGRDGGQKKLTIIDTPGHVDFTMEVERSIRVTDGAIALLDSNAGVEPQT 121

Query: 113 REHILLARQIGISSI--VVYMNKVDAVDDD 140
                + RQ    S+  V++ NK+D +  D
Sbjct: 122 ET---VWRQADKYSVPRVIFCNKMDKMGAD 148

>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Back     alignment
 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 9/130 (6%)

Query: 14  GLSTIGHVDHGKTTLTAAITKY---YSEEKKEYGDIDSAPEEKLRGITI--ATAHVSY-E 67
             S + H+DHGK+TL     ++    +E +     +D+   E+ RGITI   T  ++Y  
Sbjct: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTS 72

Query: 68  TDKRFY--SHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGIS 125
           TD + Y  + ID PGH D+   +    +  +G++LV  A  G + QT  ++  A      
Sbjct: 73  TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-NNH 131

Query: 126 SIVVYMNKVD 135
            I+  +NK D
Sbjct: 132 EIITVLNKAD 141

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target392 translation elongation factor Tu [Candidatus Liberibact
140063955392 protein chain elongation factor EF-Tu [Candidatus Liber 1 0.0
38195601373 protein chain elongation factor EF-Tu [Candidatus Liber 1 0.0
315122752393 translation elongation factor Tu [Candidatus Liberibact 1 0.0
222085674391 translation elongation factor Tu [Agrobacterium radioba 1 1e-135
77462243391 elongation factor Tu [Rhodobacter sphaeroides 2.4.1] Le 1 1e-135
146278570391 elongation factor Tu [Rhodobacter sphaeroides ATCC 1702 1 1e-135
304391451391 translation elongation factor Tu [Ahrensia sp. R2A130] 1 1e-135
254452195391 translation elongation factor Tu [Octadecabacter antarc 1 1e-133
254438865391 translation elongation factor Tu [Octadecabacter antarc 1 1e-133
126734753391 translation elongation factor Tu [Roseobacter sp. CCS2] 1 1e-133
>gi|140063955|gb|ABO82467.1| protein chain elongation factor EF-Tu [Candidatus Liberibacter asiaticus] Length = 392 Back     alignment and organism information
 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/392 (99%), Positives = 391/392 (99%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60
           MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA
Sbjct: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60

Query: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120
           TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR
Sbjct: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120

Query: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180
           QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEH+YSDDTPIIRGSALCALQGTNKE
Sbjct: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHRYSDDTPIIRGSALCALQGTNKE 180

Query: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240
           LGEDSIHALMKAVDTHIPTPQRSLDAPFLM IEGSCGIEGRGTVVTGCIKRGRIKAGSDV
Sbjct: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMRIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240

Query: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300
           EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY
Sbjct: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300

Query: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360
           SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE
Sbjct: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360

Query: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392
           LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
Sbjct: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|38195601|gb|AAR13464.1| protein chain elongation factor EF-Tu [Candidatus Liberibacter asiaticus] Length = 373 Back     alignment and organism information
>gi|315122752|ref|YP_004063241.1| translation elongation factor Tu [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 393 Back     alignment and organism information
>gi|222085674|ref|YP_002544204.1| translation elongation factor Tu [Agrobacterium radiobacter K84] Length = 391 Back     alignment and organism information
>gi|77462243|ref|YP_351747.1| elongation factor Tu [Rhodobacter sphaeroides 2.4.1] Length = 391 Back     alignment and organism information
>gi|146278570|ref|YP_001168729.1| elongation factor Tu [Rhodobacter sphaeroides ATCC 17025] Length = 391 Back     alignment and organism information
>gi|304391451|ref|ZP_07373393.1| translation elongation factor Tu [Ahrensia sp. R2A130] Length = 391 Back     alignment and organism information
>gi|254452195|ref|ZP_05065632.1| translation elongation factor Tu [Octadecabacter antarcticus 238] Length = 391 Back     alignment and organism information
>gi|254438865|ref|ZP_05052359.1| translation elongation factor Tu [Octadecabacter antarcticus 307] Length = 391 Back     alignment and organism information
>gi|126734753|ref|ZP_01750499.1| translation elongation factor Tu [Roseobacter sp. CCS2] Length = 391 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target392 translation elongation factor Tu [Candidatus Liberibact
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 1e-178
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 1e-175
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 1e-171
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisional 1e-158
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 1e-150
KOG0460449 KOG0460, KOG0460, KOG0460, Mitochondrial translation el 1e-149
COG0050394 COG0050, TufB, GTPases - translation elongation factors 1e-148
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisional 1e-128
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed 1e-62
COG5256428 COG5256, TEF1, Translation elongation factor EF-1alpha 4e-57
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation factor EF 1e-48
KOG0458603 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [T 1e-35
COG5257415 COG5257, GCD11, Translation initiation factor 2, gamma 6e-34
KOG0459501 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 1e-30
COG5258527 COG5258, GTPBP1, GTPase [General function prediction on 2e-28
CHL00071409 CHL00071, tufA, elongation factor Tu 1e-155
cd01884195 cd01884, EF_Tu, EF-Tu subfamily 7e-94
pfam00009185 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding d 2e-58
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 1e-40
cd01883219 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1 1e-36
cd04171164 cd04171, SelB, SelB subfamily 4e-31
cd04166208 cd04166, CysN_ATPS, CysN_ATPS subfamily 2e-25
cd01888203 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initi 2e-24
cd01891194 cd01891, TypA_BipA, TypA (tyrosine phosphorylated prote 3e-21
cd01887168 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eu 2e-16
PRK05306 787 PRK05306, infB, translation initiation factor IF-2; Val 5e-12
COG4108 528 COG4108, PrfC, Peptide chain release factor RF-3 [Trans 1e-11
PRK05433 600 PRK05433, PRK05433, GTP-binding protein LepA; Provision 2e-05
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 5e-04
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 0.003
TIGR00475 581 TIGR00475, selB, selenocysteine-specific elongation fac 4e-40
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisi 7e-39
PRK04000411 PRK04000, PRK04000, translation initiation factor IF-2 1e-37
TIGR03680406 TIGR03680, eif2g_arch, translation initiation factor 2 2e-36
KOG0461 522 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elon 4e-36
COG1217 603 COG1217, TypA, Predicted membrane GTPase involved in st 6e-31
TIGR01394 594 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA 2e-28
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Provisio 4e-28
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transferase 6e-28
PRK10512 614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific trans 8e-28
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiation f 8e-25
PRK10218 607 PRK10218, PRK10218, GTP-binding protein; Provisional 1e-22
PRK05506 632 PRK05506, PRK05506, bifunctional sulfate adenylyltransf 2e-21
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, large sub 4e-21
KOG0462 650 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-b 5e-21
KOG0052391 KOG0052, KOG0052, KOG0052, Translation elongation facto 1e-17
KOG1145 683 KOG1145, KOG1145, KOG1145, Mitochondrial translation in 2e-17
KOG0466466 KOG0466, KOG0466, KOG0466, Translation initiation facto 4e-17
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subunit 1; 1e-16
COG0481 603 COG0481, LepA, Membrane GTPase LepA [Cell envelope biog 3e-14
TIGR01393 595 TIGR01393, lepA, GTP-binding protein LepA 1e-12
COG3276447 COG3276, SelB, Selenocysteine-specific translation elon 2e-38
cd0370790 cd03707, EFTU_III, Domain III of elongation factor (EF) 8e-36
pfam0314397 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal 5e-30
cd0370693 cd03706, mtEFTU_III, Domain III of mitochondrial EF-TU 4e-20
cd01513102 cd01513, Translation_factor_III, Domain III of Elongati 2e-09
cd0369787 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain 1e-27
cd0369683 cd03696, selB_II, selB_II: this subfamily represents th 2e-12
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 4e-11
cd0369391 cd03693, EF1_alpha_II, EF1_alpha_II: this family repres 2e-10
cd0134283 cd01342, Translation_Factor_II_like, Translation_Factor 2e-08
cd0408982 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic 0.002
cd0369487 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPa 0.004
cd01889192 cd01889, SelB_euk, SelB subfamily 2e-18
COG0480 697 COG0480, FusA, Translation elongation factors (GTPases) 4e-16
PRK13351 687 PRK13351, PRK13351, elongation factor G; Reviewed 2e-15
PRK12740 668 PRK12740, PRK12740, elongation factor G; Reviewed 9e-15
cd04168237 cd04168, TetM_like, Tet(M)-like subfamily 1e-14
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamil 7e-13
cd01885222 cd01885, EF2, EF2 (for archaea and eukarya) 8e-13
TIGR00490 720 TIGR00490, aEF-2, translation elongation factor aEF-2 8e-13
PRK07560 731 PRK07560, PRK07560, elongation factor EF-2; Reviewed 1e-12
PTZ00416 836 PTZ00416, PTZ00416, elongation factor 2; Provisional 2e-12
KOG0465 721 KOG0465, KOG0465, KOG0465, Mitochondrial elongation fac 9e-12
cd04167213 cd04167, Snu114p, Snu114p subfamily 8e-11
KOG0467 887 KOG0467, KOG0467, KOG0467, Translation elongation facto 8e-11
KOG0469 842 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Transla 3e-10
cd01890179 cd01890, LepA, LepA subfamily 6e-09
TIGR00503 527 TIGR00503, prfC, peptide chain release factor 3 6e-09
KOG0464 753 KOG0464, KOG0464, KOG0464, Elongation factor G [Transla 1e-08
TIGR00484 689 TIGR00484, EF-G, translation elongation factor EF-G 1e-08
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) subfamily 2e-08
cd04169267 cd04169, RF3, RF3 subfamily 8e-08
KOG0468 971 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [T 9e-08
PLN00116 843 PLN00116, PLN00116, translation elongation factor EF-2 3e-07
TIGR00491 590 TIGR00491, aIF-2, translation initiation factor aIF-2/y 8e-07
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 2e-06
PRK12739 691 PRK12739, PRK12739, elongation factor G; Reviewed 5e-05
KOG1144 1064 KOG1144, KOG1144, KOG1144, Translation initiation facto 2e-04
PRK04004 586 PRK04004, PRK04004, translation initiation factor IF-2; 4e-04
PRK00741 526 PRK00741, prfC, peptide chain release factor 3; Provisi 0.003
PRK00007 693 PRK00007, PRK00007, elongation factor G; Reviewed 0.003
COG0532 509 COG0532, InfB, Translation initiation factor 2 (IF-2; G 3e-16
CHL00189 742 CHL00189, infB, translation initiation factor 2; Provis 1e-14
TIGR00487 587 TIGR00487, IF-2, translation initiation factor IF-2 2e-14
KOG0463641 KOG0463, KOG0463, KOG0463, GTP-binding protein GP-1 [Ge 7e-06
cd00880163 cd00880, Era_like, Era (E 5e-05
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 1e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 0.004
PRK14845 1049 PRK14845, PRK14845, translation initiation factor IF-2; 0.001
>gnl|CDD|178823 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|183709 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|35681 KOG0460, KOG0460, KOG0460, Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30399 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178672 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|183433 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|34853 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|35679 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|34854 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35680 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|34855 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|133284 cd01884, EF_Tu, EF-Tu subfamily Back     alignment and domain information
>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information
>gnl|CDD|133283 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>gnl|CDD|133371 cd04171, SelB, SelB subfamily Back     alignment and domain information
>gnl|CDD|133366 cd04166, CysN_ATPS, CysN_ATPS subfamily Back     alignment and domain information
>gnl|CDD|133288 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>gnl|CDD|133291 cd01891, TypA_BipA, TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>gnl|CDD|133287 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>gnl|CDD|180006 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|33865 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180078 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|179703 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|163393 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|35682 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31410 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162336 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|32720 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|185557 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|131089 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|35683 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35275 KOG0052, KOG0052, KOG0052, Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36360 KOG1145, KOG1145, KOG1145, Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35687 KOG0466, KOG0466, KOG0466, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179943 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|30829 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|33087 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|58073 cd03707, EFTU_III, Domain III of elongation factor (EF) Tu Back     alignment and domain information
>gnl|CDD|111981 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain Back     alignment and domain information
>gnl|CDD|58072 cd03706, mtEFTU_III, Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>gnl|CDD|58069 cd01513, Translation_factor_III, Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>gnl|CDD|58088 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>gnl|CDD|58087 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|145992 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|58084 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>gnl|CDD|58078 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|58096 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|58085 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPase Back     alignment and domain information
>gnl|CDD|133289 cd01889, SelB_euk, SelB subfamily Back     alignment and domain information
>gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183990 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|133368 cd04168, TetM_like, Tet(M)-like subfamily Back     alignment and domain information
>gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|133285 cd01885, EF2, EF2 (for archaea and eukarya) Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|181029 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|185604 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133367 cd04167, Snu114p, Snu114p subfamily Back     alignment and domain information
>gnl|CDD|35688 KOG0467, KOG0467, KOG0467, Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35690 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133290 cd01890, LepA, LepA subfamily Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|35685 KOG0464, KOG0464, KOG0464, Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|133286 cd01886, EF-G, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|133369 cd04169, RF3, RF3 subfamily Back     alignment and domain information
>gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|183712 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|36359 KOG1144, KOG1144, KOG1144, Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179704 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|178789 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|30878 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|161900 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|35684 KOG0463, KOG0463, KOG0463, GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|184848 PRK14845, PRK14845, translation initiation factor IF-2; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 392 translation elongation factor Tu [Candidatus Liberibact
PRK00049397 elongation factor Tu; Reviewed 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
TIGR00483445 EF-1_alpha translation elongation factor EF-1, subunit 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
CHL00071409 tufA elongation factor Tu 100.0
PRK12317426 elongation factor 1-alpha; Reviewed 100.0
PTZ00336449 elongation factor 1-alpha; Provisional 100.0
PTZ00141443 elongation factor 1 alpha; Provisional 100.0
PRK05124475 cysN sulfate adenylyltransferase subunit 1; Provisional 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 100.0
KOG0460449 consensus 100.0
COG0050394 TufB GTPases - translation elongation factors [Translat 100.0
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 100.0
PRK04000410 translation initiation factor IF-2 subunit gamma; Valid 100.0
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 100.0
TIGR02034411 CysN sulfate adenylyltransferase, large subunit; InterP 100.0
TIGR00485394 EF-Tu translation elongation factor Tu; InterPro: IPR00 100.0
KOG0458603 consensus 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma subuni 100.0
TIGR00475 627 selB selenocysteine-specific translation elongation fac 100.0
COG2895431 CysN GTPases - Sulfate adenylate transferase subunit 1 100.0
KOG0459501 consensus 100.0
COG3276 447 SelB Selenocysteine-specific translation elongation fac 100.0
COG5258527 GTPBP1 GTPase [General function prediction only] 100.0
COG5257415 GCD11 Translation initiation factor 2, gamma subunit (e 100.0
KOG0463641 consensus 100.0
KOG1143591 consensus 100.0
KOG0461 522 consensus 100.0
KOG0466466 consensus 100.0
KOG0052391 consensus 100.0
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 100.0
COG1217 603 TypA Predicted membrane GTPase involved in stress respo 100.0
PRK10218 607 GTP-binding protein; Provisional 100.0
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 100.0
PRK05433 601 GTP-binding protein LepA; Provisional 100.0
PRK13351 687 elongation factor G; Reviewed 100.0
KOG0462 650 consensus 100.0
PRK00007 693 elongation factor G; Reviewed 100.0
PRK00741526 prfC peptide chain release factor 3; Provisional 100.0
PRK12740 670 elongation factor G; Reviewed 100.0
PRK12739 693 elongation factor G; Reviewed 100.0
COG0480 697 FusA Translation elongation factors (GTPases) [Translat 100.0
PRK07560 730 elongation factor EF-2; Reviewed 100.0
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 100.0
TIGR00484 705 EF-G translation elongation factor G; InterPro: IPR0045 100.0
CHL00189 770 infB translation initiation factor 2; Provisional 100.0
COG4108528 PrfC Peptide chain release factor RF-3 [Translation, ri 100.0
KOG0465 721 consensus 100.0
PRK05306 839 infB translation initiation factor IF-2; Validated 100.0
TIGR00503530 prfC peptide chain release factor 3; InterPro: IPR00454 100.0
TIGR00490 724 aEF-2 translation elongation factor aEF-2; InterPro: IP 100.0
KOG0469 842 consensus 100.0
KOG0464 753 consensus 100.0
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 100.0
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 100.0
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 100.0
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 100.0
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 100.0
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 100.0
cd00881189 GTP_translation_factor GTP translation factor family. T 100.0
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 100.0
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 100.0
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 100.0
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 100.0
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 100.0
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.97
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 99.88
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.84
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.83
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.82
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.81
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 99.81
PRK00089296 era GTP-binding protein Era; Reviewed 99.81
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 99.79
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 99.79
COG1160444 Predicted GTPases [General function prediction only] 99.78
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 99.76
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.75
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.75
PRK00454196 engB GTPase EngB; Reviewed 99.74
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.73
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.72
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 99.72
COG1159298 Era GTPase [General function prediction only] 99.7
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 99.69
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.68
PRK04213195 GTP-binding protein; Provisional 99.65
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 99.63
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 99.63
COG1160444 Predicted GTPases [General function prediction only] 99.62
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 99.6
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.58
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.49
COG0486454 ThdF Predicted GTPase [General function prediction only 99.36
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.32
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 99.3
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.2
PRK11058426 putative GTPase HflX; Provisional 99.14
COG2262411 HflX GTPases [General function prediction only] 99.09
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 99.08
PRK12299334 obgE GTPase ObgE; Reviewed 99.08
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 98.99
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 98.96
cd04123162 Rab21 Rab21 subfamily. The localization and function of 98.94
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 98.9
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 98.9
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 98.89
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 98.88
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 98.87
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 98.87
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 98.84
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 98.84
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 98.83
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 98.83
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 98.83
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 98.82
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 98.82
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 98.82
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 98.81
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 98.81
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 98.8
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 98.78
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 98.78
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 98.77
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 98.76
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 98.75
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 98.75
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 98.75
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 98.74
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 98.74
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 98.73
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 98.71
COG3596296 Predicted GTPase [General function prediction only] 98.7
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 98.69
PTZ00132209 GTP-binding nuclear protein; Provisional 98.69
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 98.68
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 98.67
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 98.67
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 98.66
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 98.66
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 98.66
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 98.65
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 98.64
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 98.63
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 98.62
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 98.62
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 98.61
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 98.61
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 98.6
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 98.59
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 98.58
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 98.57
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 98.56
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 98.55
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 98.52
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 98.5
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 98.46
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 98.46
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 98.45
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 98.41
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 98.36
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 98.3
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 98.29
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 98.24
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 98.22
KOG0092200 consensus 98.17
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 98.16
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 98.12
KOG2486320 consensus 98.09
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 98.07
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 98.07
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.04
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.01
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 98.0
KOG0076197 consensus 97.79
KOG0394210 consensus 97.74
KOG0078207 consensus 97.64
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.56
KOG0094221 consensus 97.28
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 97.1
KOG0410410 consensus 96.94
KOG0087222 consensus 95.58
KOG0097215 consensus 92.85
PRK12312 610 infB translation initiation factor IF-2; Provisional 100.0
PRK04004 592 translation initiation factor IF-2; Validated 100.0
KOG1145 683 consensus 100.0
KOG1144 1064 consensus 99.95
TIGR00491 1145 aIF-2 translation initiation factor aIF-2; InterPro: IP 99.95
TIGR00487 594 IF-2 translation initiation factor IF-2; InterPro: IPR0 99.9
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 100.0
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 100.0
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 100.0
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 100.0
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 100.0
KOG0467 887 consensus 99.98
KOG0468 971 consensus 99.95
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 99.74
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.51
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.51
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.45
COG2229187 Predicted GTPase [General function prediction only] 99.45
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.43
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 99.42
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.35
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.34
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.29
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.28
COG0218200 Predicted GTPase [General function prediction only] 99.28
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.26
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.23
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 99.22
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.2
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.19
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.18
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.17
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.15
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.12
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.11
PTZ00133182 ADP-ribosylation factor; Provisional 99.11
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.11
COG1084346 Predicted GTPase [General function prediction only] 99.05
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.04
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.03
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 99.01
PRK12298380 obgE GTPase ObgE; Reviewed 98.98
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 98.98
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 98.98
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 98.97
PRK12296495 obgE GTPase ObgE; Reviewed 98.96
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 98.96
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 98.96
KOG1191531 consensus 98.95
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 98.95
KOG1423379 consensus 98.95
cd04105203 SR_beta Signal recognition particle receptor, beta subu 98.94
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 98.93
PRK12297429 obgE GTPase ObgE; Reviewed 98.91
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 98.84
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 98.82
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 98.8
COG1100219 GTPase SAR1 and related small G proteins [General funct 98.72
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 98.72
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 98.7
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 98.7
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 98.66
KOG1489366 consensus 98.63
PRK13768253 GTPase; Provisional 98.61
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 98.61
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 98.59
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.52
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 98.46
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 98.41
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 98.4
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 98.4
COG0536369 Obg Predicted GTPase [General function prediction only] 98.37
KOG0073185 consensus 98.35
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 98.3
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 98.24
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 98.16
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 98.13
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.11
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 98.08
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.06
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 98.03
KOG0780483 consensus 98.01
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 97.99
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 97.97
KOG0090238 consensus 97.96
COG5019373 CDC3 Septin family protein [Cell division and chromosom 97.89
PRK00771433 signal recognition particle protein Srp54; Provisional 97.87
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.86
pfam05783490 DLIC Dynein light intermediate chain (DLIC). This famil 97.83
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 97.78
PRK10867453 signal recognition particle protein; Provisional 97.75
KOG1547336 consensus 97.74
KOG0077193 consensus 97.7
cd03114148 ArgK-like The function of this protein family is unkown 97.69
KOG0448 749 consensus 97.68
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.61
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.56
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.53
KOG1532366 consensus 97.51
KOG0098216 consensus 97.49
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 97.46
KOG0070181 consensus 97.45
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 97.38
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 97.35
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 97.31
KOG1954532 consensus 97.29
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 97.27
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.24
KOG0084205 consensus 97.18
KOG1707 625 consensus 97.12
KOG3886295 consensus 97.03
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 97.01
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 96.96
cd02036179 MinD Bacterial cell division requires the formation of 96.96
KOG1534273 consensus 96.92
KOG2655366 consensus 96.89
KOG0075186 consensus 96.86
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 96.76
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 96.75
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.72
PRK13849231 putative crown gall tumor protein VirC1; Provisional 96.71
KOG0095213 consensus 96.7
COG0523323 Putative GTPases (G3E family) [General function predict 96.68
KOG3905473 consensus 96.35
KOG4252246 consensus 96.22
PHA02518211 ParA-like protein; Provisional 96.18
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.18
KOG0395196 consensus 96.18
KOG0074185 consensus 96.04
PRK11537317 putative GTP-binding protein YjiA; Provisional 96.0
KOG0086214 consensus 95.92
KOG1490620 consensus 95.49
KOG3887347 consensus 95.45
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 95.24
KOG0071180 consensus 95.15
KOG0080209 consensus 94.97
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 94.73
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 94.65
KOG0447 980 consensus 94.59
pfam09547492 Spore_IV_A Stage IV sporulation protein A (spore_IV_A). 94.26
KOG1533290 consensus 94.24
KOG0072182 consensus 92.99
KOG0093193 consensus 92.68
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 91.37
KOG0088218 consensus 91.24
KOG3883198 consensus 91.17
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 100.0
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents the d 99.87
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. Elonga 99.85
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class II r 99.81
cd0369683 selB_II selB_II: this subfamily represents the domain o 99.81
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domain II 99.81
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. This g 99.79
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represents th 99.64
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also call 99.25
pfam0314470 GTP_EFTU_D2 Elongation factor Tu domain 2. Elongation f 98.97
cd0134283 Translation_Factor_II_like Translation_Factor_II_like: 98.94
cd0368985 RF3_II RF3_II: this subfamily represents the domain II 98.79
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents th 98.75
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial El 98.65
cd0369986 lepA_II lepA_II: This subfamily represents the domain I 98.63
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial El 98.51
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily represents 98.48
cd0369085 Tet_II Tet_II: This subfamily represents domain II of r 98.36
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily re 98.24
PRK05306839 infB translation initiation factor IF-2; Validated 98.1
PRK12312610 infB translation initiation factor IF-2; Provisional 97.96
CHL00189770 infB translation initiation factor 2; Provisional 97.9
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal dom 97.77
cd0369284