254780151

254780151

tRNA-specific 2-thiouridylase MnmA

GeneID in NCBI database:8209128Locus tag:CLIBASIA_00160
Protein GI in NCBI database:254780151Protein Accession:YP_003064564.1
Gene range:-(33253, 34479)Protein Length:408aa
Gene description:tRNA-specific 2-thiouridylase MnmA
COG prediction:[J] Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain
KEGG prediction:mnmA; tRNA-specific 2-thiouridylase MnmA (EC:2.8.1.-); K00566 tRNA-specific 2-thiouridylase [EC:2.8.1.-]
SEED prediction:tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61)
Pathway involved in KEGG:Sulfur relay system [PATH:las04122]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
ccccccccccHHHccccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEEEcEEEEEEEcccccccccEEEEEEcccccccEEEEccccHHHHHHHHcccccccHHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHcccccccccEEcccccEEEEEccEEEEcccccccccccccccEEEEEccccccEEEEccHHHHcccEEEEEccEEcccccccccccccEEEEEEEEEcccccEEEEEEcccEEEEEEccccccccccEEEEEEcccccccEEEEEEEEEEEEccccccHHHHHHHHccccccc
ccEHHHHEEccccccccccccEEEEEccccccHHHHHHHHHHccccEEEEEEEccccccccccccccccHHcHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHHHHHccccccccccccccEHHHHHHHHHHHHcccEEEEccEEEEEccccccccccEEEccccccccccHHHHHHccHHHHHHccccccccccHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHcccccccccEEEccccEEccccEEEEEEccccccccccccccEEEEccccHccEEEEEcccHHHcccEEEEEEEEEccccccccccccEEEEEEEEEEcccccEEEEEccccEEEEEcccEEEEccccEEEEEcccccHHHHccccHHHHHccccHHHHHHHHHHHccccccc
mvvseatrlnsldldknpkdMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNsrkaskrkgsccagqdvydarrvcdtinvshyvFDYEerfrnavivpfassyaagetplpcvdcnrtvkfsdLLSVTRQLGADVLATGHYIRsrlyvgddgkrrrimcrpmdlerdqsYFLFATTQQQLCdlrfplgdmkkESVRDLAREMGldiadksdsqdicfvqqGKYFDVVKRINAgialegdivHLNGQILGRHNGIINYTIgqrrglgvamgEPLFVVYLdknssrvivgpresLEVHRIYLREINwlgdglfedAVVDGFKCFVKirssqdpvpvfvqrnddgvyvdfeksevgvasGQACVFYtsdsnearvlgggiisgskrsDAVEESLLSvigdefpykm
mvvseatrlnsldldknpkdMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLynsrkaskrkgsccagqdvydarrvcDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGadvlatghyirsrlyvgddgkrrrIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLdiadksdsqdiCFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYldknssrvivgpresleVHRIYLREINWLGDGLFEDAVVDGFKCFVKirssqdpvpvfvQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGiisgskrsdaveesllsvigdefpykm
MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
*********************RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD**PY**
********LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS***********AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
254780414520 GMP synthase [Candidatus Liberibacter asiaticus st 0.022
>gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 520 Back     alignment
 Score = 31.6 bits (70), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 4/31 (12%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTL 52
           RV+ A+SGGVDS+V A L+    Y+ IG+ L
Sbjct: 224 RVICAVSGGVDSTVAAFLI----YEAIGINL 250

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
140063954408 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransf 1 0.0
110808325357 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransf 1 0.0
315122753398 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba 1 0.0
222086955399 tRNA 5-methylaminomethyl-2-thiouridylate-methyltransfer 1 1e-143
222149632402 tRNA-specific 2-thiouridylase MnmA [Agrobacterium vitis 1 1e-141
190893264408 tRNA 5-methylaminomethyl-2-thiouridylate-methyltransfer 1 1e-141
327192984399 tRNA 5-methylaminomethyl-2-thiouridylate-methyltransfer 1 1e-141
86359043408 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransf 1 1e-140
218675488399 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransf 1 1e-140
209550765399 tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminos 1 1e-140
>gi|140063954|gb|ABO82466.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Candidatus Liberibacter asiaticus] Length = 408 Back     alignment and organism information
 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/408 (99%), Positives = 408/408 (100%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVT+QLYNSRKA
Sbjct: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTVQLYNSRKA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC
Sbjct: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT
Sbjct: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA
Sbjct: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV
Sbjct: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA
Sbjct: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408
           SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
Sbjct: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110808325|gb|ABG91067.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Candidatus Liberibacter asiaticus] Length = 357 Back     alignment and organism information
>gi|315122753|ref|YP_004063242.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 398 Back     alignment and organism information
>gi|222086955|ref|YP_002545489.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein [Agrobacterium radiobacter K84] Length = 399 Back     alignment and organism information
>gi|222149632|ref|YP_002550589.1| tRNA-specific 2-thiouridylase MnmA [Agrobacterium vitis S4] Length = 402 Back     alignment and organism information
>gi|190893264|ref|YP_001979806.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein [Rhizobium etli CIAT 652] Length = 408 Back     alignment and organism information
>gi|327192984|gb|EGE59899.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein [Rhizobium etli CNPAF512] Length = 399 Back     alignment and organism information
>gi|86359043|ref|YP_470935.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Rhizobium etli CFN 42] Length = 408 Back     alignment and organism information
>gi|218675488|ref|ZP_03525157.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Rhizobium etli GR56] Length = 399 Back     alignment and organism information
>gi|209550765|ref|YP_002282682.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 399 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
PRK00143346 PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Rev 1e-140
COG0482356 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thi 1e-109
pfam03054354 pfam03054, tRNA_Me_trans, tRNA methyl transferase 1e-106
TIGR00420352 TIGR00420, trmU, tRNA (5-methylaminomethyl-2-thiouridyl 5e-86
KOG2805377 KOG2805, KOG2805, KOG2805, tRNA (5-methylaminomethyl-2- 2e-66
PRK14664362 PRK14664, PRK14664, tRNA-specific 2-thiouridylase MnmA; 5e-50
PRK14665360 PRK14665, mnmA, tRNA-specific 2-thiouridylase MnmA; Pro 4e-46
cd01998349 cd01998, tRNA_Me_trans, tRNA methyl transferase 1e-115
cd01995169 cd01995, ExsB, ExsB is a transcription regulator relate 4e-08
pfam06508137 pfam06508, ExsB, ExsB 3e-05
PRK13820394 PRK13820, PRK13820, argininosuccinate synthase; Provisi 1e-04
pfam00733195 pfam00733, Asn_synthase, Asparagine synthase 0.003
COG0603222 COG0603, COG0603, Predicted PP-loop superfamily ATPase 1e-07
cd01990202 cd01990, Alpha_ANH_like_I, This is a subfamily of Adeni 1e-06
cd00553248 cd00553, NAD_synthase, NAD+ synthase is a homodimer, wh 2e-06
PRK13980265 PRK13980, PRK13980, NAD synthetase; Provisional 7e-06
COG1606269 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop 8e-06
TIGR00268252 TIGR00268, TIGR00268, conserved hypothetical protein TI 8e-06
COG0171268 COG0171, NadE, NAD synthase [Coenzyme metabolism] 3e-05
pfam02540243 pfam02540, NAD_synthase, NAD synthase 8e-04
cd01992185 cd01992, PP-ATPase, N-terminal domain of predicted ATPa 0.001
TIGR00552250 TIGR00552, nadE, NAD+ synthetase 0.001
cd01993185 cd01993, Alpha_ANH_like_II, This is a subfamily of Aden 3e-06
COG0037298 COG0037, MesJ, Predicted ATPase of the PP-loop superfam 3e-06
COG0137403 COG0137, ArgG, Argininosuccinate synthase [Amino acid t 1e-04
TIGR00364201 TIGR00364, TIGR00364, exsB protein 2e-04
cd01712177 cd01712, ThiI, ThiI is required for thiazole synthesis 0.001
COG1365255 COG1365, COG1365, Predicted ATPase (PP-loop superfamily 0.001
cd01999385 cd01999, Argininosuccinate_Synthase, Argininosuccinate 0.001
TIGR00032394 TIGR00032, argG, argininosuccinate synthase 0.002
PRK04527400 PRK04527, PRK04527, argininosuccinate synthase; Provisi 0.002
PRK00074511 PRK00074, guaA, GMP synthase; Reviewed 4e-05
cd01986103 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydro 1e-04
COG0519315 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [ 0.003
cd01997295 cd01997, GMP_synthase_C, The C-terminal domain of GMP s 0.004
TIGR00884311 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyz 0.004
>gnl|CDD|178898 PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>gnl|CDD|30830 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145938 pfam03054, tRNA_Me_trans, tRNA methyl transferase Back     alignment and domain information
>gnl|CDD|161871 TIGR00420, trmU, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>gnl|CDD|38016 KOG2805, KOG2805, KOG2805, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173127 PRK14664, PRK14664, tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>gnl|CDD|173128 PRK14665, mnmA, tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>gnl|CDD|30185 cd01998, tRNA_Me_trans, tRNA methyl transferase Back     alignment and domain information
>gnl|CDD|73293 cd01995, ExsB, ExsB is a transcription regulator related protein Back     alignment and domain information
>gnl|CDD|148238 pfam06508, ExsB, ExsB Back     alignment and domain information
>gnl|CDD|184346 PRK13820, PRK13820, argininosuccinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|144363 pfam00733, Asn_synthase, Asparagine synthase Back     alignment and domain information
>gnl|CDD|30948 COG0603, COG0603, Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30177 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|30166 cd00553, NAD_synthase, NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>gnl|CDD|184435 PRK13980, PRK13980, NAD synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|129369 TIGR00268, TIGR00268, conserved hypothetical protein TIGR00268 Back     alignment and domain information
>gnl|CDD|30520 COG0171, NadE, NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|145596 pfam02540, NAD_synthase, NAD synthase Back     alignment and domain information
>gnl|CDD|30179 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|161924 TIGR00552, nadE, NAD+ synthetase Back     alignment and domain information
>gnl|CDD|30180 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|30386 COG0037, MesJ, Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|30486 COG0137, ArgG, Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129461 TIGR00364, TIGR00364, exsB protein Back     alignment and domain information
>gnl|CDD|30167 cd01712, ThiI, ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>gnl|CDD|31556 COG1365, COG1365, Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30186 cd01999, Argininosuccinate_Synthase, Argininosuccinate synthase Back     alignment and domain information
>gnl|CDD|129143 TIGR00032, argG, argininosuccinate synthase Back     alignment and domain information
>gnl|CDD|179859 PRK04527, PRK04527, argininosuccinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|178842 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|73292 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>gnl|CDD|30865 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30184 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase Back     alignment and domain information
>gnl|CDD|162088 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
PRK00143355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 100.0
pfam03054354 tRNA_Me_trans tRNA methyl transferase. This family repr 100.0
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family repr 100.0
TIGR00420394 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 100.0
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 100.0
KOG2805377 consensus 100.0
cd01712177 ThiI ThiI is required for thiazole synthesis in the thi 99.98
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 99.87
TIGR00884319 guaA_Cterm GMP synthase, C-terminal domain; InterPro: I 99.83
pfam02568197 ThiI Thiamine biosynthesis protein (ThiI). ThiI is requ 99.79
TIGR00268263 TIGR00268 conserved hypothetical protein TIGR00268; Int 99.78
PRK00074513 guaA GMP synthase; Reviewed 99.75
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [Gener 99.74
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthetase. 99.7
PRK00919306 GMP synthase subunit B; Validated 99.7
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide 99.66
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 99.66
pfam02540243 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is 99.59
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle contr 99.58
PRK00876325 nadE NAD synthetase; Reviewed 99.54
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which cataly 99.53
PRK13980264 NAD synthetase; Provisional 99.49
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 99.46
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 99.43
PRK08349198 hypothetical protein; Validated 99.41
PRK05370447 argininosuccinate synthase; Validated 99.4
PRK13820395 argininosuccinate synthase; Provisional 99.4
PRK00509398 argininosuccinate synthase; Provisional 99.39
PRK04527397 argininosuccinate synthase; Provisional 99.36
COG0137403 ArgG Argininosuccinate synthase [Amino acid transport a 99.36
TIGR02432204 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro 99.31
PRK13981543 NAD synthetase; Provisional 99.3
pfam00764389 Arginosuc_synth Arginosuccinate synthase. This family c 99.29
COG1365255 Predicted ATPase (PP-loop superfamily) [General functio 99.29
KOG1622552 consensus 99.29
PRK10660433 tilS tRNA(Ile)-lysidine synthetase; Provisional 99.25
PRK01565399 thiamine biosynthesis protein ThiI; Provisional 99.24
cd01999385 Argininosuccinate_Synthase Argininosuccinate synthase. 99.23
COG0171268 NadE NAD synthase [Coenzyme metabolism] 99.22
COG0603222 Predicted PP-loop superfamily ATPase [General function 99.21
PRK00768274 nadE NAD synthetase; Reviewed 99.19
TIGR00364227 TIGR00364 exsB protein; InterPro: IPR004479 This protei 99.18
TIGR00032420 argG argininosuccinate synthase; InterPro: IPR001518 Ar 99.17
TIGR00342391 TIGR00342 thiamine biosynthesis/tRNA modification prote 99.07
PRK11106231 queuosine biosynthesis protein QueC; Provisional 99.07
PTZ00323294 NAD+ synthase; Provisional 99.05
PRK01269483 thiamine biosynthesis protein ThiI; Provisional 98.98
cd01995169 ExsB ExsB is a transcription regulator related protein. 98.97
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzym 98.95
pfam01507174 PAPS_reduct Phosphoadenosine phosphosulfate reductase f 98.9
KOG1706412 consensus 98.75
TIGR00552286 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase 98.72
cd01713173 PAPS_reductase This domain is found in phosphoadenosine 98.65
PRK13795630 hypothetical protein; Provisional 98.6
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouri 98.59
PRK08557420 hypothetical protein; Provisional 98.57
PRK13794473 hypothetical protein; Provisional 98.56
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 98.54
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransfe 98.3
PRK08384310 thiamine biosynthesis protein ThiI; Provisional 98.24
PRK08576439 hypothetical protein; Provisional 98.22
PRK05253300 sulfate adenylyltransferase subunit 2; Provisional 97.98
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 97.87
PRK02090243 phosphoadenosine phosphosulfate reductase; Provisional 96.7
KOG2303706 consensus 92.6
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 91.77
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 91.17
pfam06508137 ExsB ExsB. This family includes putative transcriptiona 99.42
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme has b 98.99
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine nucle 98.93
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases supe 98.74
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagine Sy 98.52
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 98.5
pfam00733195 Asn_synthase Asparagine synthase. This family is always 98.42
COG2102223 Predicted ATPases of PP-loop superfamily [General funct 98.27
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 98.2
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 98.07
KOG2840347 consensus 98.01
PTZ00077610 asparagine synthetase; Provisional 97.99
TIGR00289227 TIGR00289 conserved hypothetical protein TIGR00289; Int 97.99
TIGR03108628 eps_aminotran_1 exosortase 1 system-associated amidotra 97.95
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 97.94
PRK09431555 asnB asparagine synthetase B; Provisional 97.91
cd0198486 AANH_like Adenine nucleotide alpha hydrolases superfami 97.58
KOG0571543 consensus 97.19
pfam02677176 DUF208 Uncharacterized BCR, COG1636. 97.17
COG1636204 Uncharacterized protein conserved in bacteria [Function 96.43
TIGR03183447 DNA_S_dndC putative sulfurtransferase DndC. Members of 95.6
PRK06850488 hypothetical protein; Provisional 95.39
cd01987124 USP_OKCHK USP domain is located between the N-terminal 94.77
PRK10696311 C32 tRNA thiolase; Provisional 99.39
PRK02628678 nadE NAD synthetase; Reviewed 98.92
KOG2316277 consensus 95.5
KOG0573520 consensus 95.34
COG3969407 Predicted phosphoadenosine phosphosulfate sulfotransfer 93.42
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domain sup 90.05
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 91.11
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed Back     alignment and domain information
>pfam03054 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2 Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2805 consensus Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674 The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme Back     alignment and domain information
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI) Back     alignment and domain information
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232 This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>pfam02540 NAD_synthase NAD synthase Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>pfam01171 ATP_bind_3 PP-loop family Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>pfam00764 Arginosuc_synth Arginosuccinate synthase Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>PRK01269 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>KOG1706 consensus Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase (6 Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>KOG2303 consensus Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family; InterPro: IPR014188 This entry represents a subfamily of the alcohol dehydrogenase, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc Back     alignment and domain information
>pfam06508 ExsB ExsB Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>pfam01902 ATP_bind_4 ATP-binding region Back     alignment and domain information
>pfam00733 Asn_synthase Asparagine synthase Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2840 consensus Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>pfam02677 DUF208 Uncharacterized BCR, COG1636 Back     alignment and domain information
>COG1636 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK10696 C32 tRNA thiolase; Provisional Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>KOG2316 consensus Back     alignment and domain information
>KOG0573 consensus Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
2der_A380 Cocrystal Structure Of An Rna Sulfuration Enzyme Mn 1e-91
2hma_A376 The Crystal Structure Of Trna (5-Methylaminomethyl- 3e-82
2e18_A257 Crystal Structure Of Project Ph0182 From Pyrococcus 8e-09
1gpm_A525 Escherichia Coli Gmp Synthetase Complexed With Amp 2e-06
2vxo_A697 Human Gmp Synthetase In Complex With Xmp Length = 6 3e-05
2dpl_A308 Crystal Structure Of The Gmp Synthase From Pyrococc 3e-05
3p52_A249 Nh3-Dependent Nad Synthetase From Campylobacter Jej 4e-05
1xng_A268 Crystal Structure Of Nh3-Dependent Nad+ Synthetase 0.001
3fiu_A249 Structure Of Nmn Synthetase From Francisella Tulare 9e-05
2ywc_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 1e-04
2ywb_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 1e-04
2c5s_A413 Crystal Structure Of Bacillus Anthracis Thii, A Trn 0.003
>gi|114793688|pdb|2DER|A Chain A, Cocrystal Structure Of An Rna Sulfuration Enzyme Mnma And Trna-Glu In The Initial Trna Binding State Length = 380 Back     alignment and structure
 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 122/380 (32%), Positives = 197/380 (51%), Gaps = 28/380 (7%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ 
Sbjct: 12  SMSETAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEE---YCTAAADLA 68

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-T 133
           DA+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    
Sbjct: 69  DAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAA 128

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY+R       D   +  + R +D  +DQSYFL+  + +Q+    FP+G
Sbjct: 129 EDLGADYIATGHYVRR-----ADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVG 183

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR +A ++GL  A K DS  ICF+ + K+ + + R     A  G I+ ++G  +
Sbjct: 184 ELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIITVDGDEI 241

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYL 305
           G H G++ +T+GQR+GLG+        EP +VV  D  ++ ++V             +  
Sbjct: 242 GEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIA 301

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQA 364
           ++++W+    F        +C VK R  Q  +P  V+  +DD + V F++    V  GQ+
Sbjct: 302 QQLHWVDREPF----TGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQS 357

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  +      LGGGII 
Sbjct: 358 AVFYNGEV----CLGGGIIE 373


>gi|114794425|pdb|2HMA|A Chain A, The Crystal Structure Of Trna (5-Methylaminomethyl-2- Thiouridylate)-Methyltransferase Trmu From Streptococcus Pneumoniae Length = 376 Back     alignment and structure
gi|146386765|pdb|2E18|A Chain A, Crystal Structure Of Project Ph0182 From Pyrococcus Horikoshii Ot3 Length = 257 Back     alignment and structure
gi|1310841|pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>gi|196049679|pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
gi|119389212|pdb|2DPL|A Chain A, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308 Back     alignment and structure
>gi|310689987|pdb|3P52|A Chain A, Nh3-Dependent Nad Synthetase From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 In Complex With The Nitrate Ion Length = 249 Back     alignment and structure
>gi|62738501|pdb|1XNG|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Helicobacter Pylori Length = 268 Back     alignment and structure
gi|224510802|pdb|3FIU|A Chain A, Structure Of Nmn Synthetase From Francisella Tularensis Length = 249 Back     alignment and structure
>gi|159795613|pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
gi|159795609|pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>gi|83754678|pdb|2C5S|A Chain A, Crystal Structure Of Bacillus Anthracis Thii, A Trna- Modifying Enzyme Containing The Predicted Rna-Binding Thump Domain Length = 413 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
2hma_A376 Probable tRNA (5-methylaminomethyl-2- thiouridylate)-me 8e-80
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 8e-80
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 4e-28
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 8e-27
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzing] su 3e-09
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 6e-20
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 2e-09
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferase, li 4e-08
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural genomics, 2e-07
1ni5_A433 Putative cell cycle protein MESJ; structural genomics, 8e-07
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, adenin 6e-05
1kqp_A271 NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; liga 3e-04
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structural g 9e-04
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomics, P 0.001
1vl2_A421 Argininosuccinate synthase; TM1780, structural genomics 6e-09
1kor_A400 Argininosuccinate synthetase; ligase, riken structural 9e-08
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesis, as 1e-05
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase 0.001
2d13_A227 Hypothetical protein PH1257; structural genomics, NPPSF 0.003
1k92_A455 Argininosuccinate synthase, argininosuccinate; N-type A 3e-05
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 4e-04
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structural g 0.002
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Length = 376 Back     alignment and structure
 Score =  292 bits (749), Expect = 8e-80
 Identities = 134/385 (34%), Positives = 190/385 (49%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 5   SDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 61

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 62  VVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAIT 121

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R    V  D      M R +D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 122 LGADYVATGHYAR----VARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHL 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G 
Sbjct: 178 EKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYL--PAQPGRMMTVDGRDMGE 235

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE--- 307
           H G++ YTIGQR GLG+         P FVV  D + + + VG     +       E   
Sbjct: 236 HAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQ 295

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++  +   E       +C  K R  Q    V V    +   V F + +  +  GQA VF
Sbjct: 296 VHFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAITPGQAVVF 351

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  +      LGGG+I  + R   V
Sbjct: 352 YDGE----ECLGGGLIDNAYRDGQV 372


>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Length = 380 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Length = 203 Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Length = 413 Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii OT3} PDB: 2z0c_A 3a4i_A Length = 308 Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Length = 219 Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Length = 232 Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Length = 268 Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} Length = 249 Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Length = 433 Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Length = 249 Back     alignment and structure
>1kqp_A NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Length = 271 Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Length = 590 Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei 1710B} Length = 285 Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Length = 421 Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Length = 400 Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, structural genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Length = 413 Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Length = 275 Back     alignment and structure
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A Length = 227 Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Length = 455 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Length = 464 Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Pyrococcus horikoshii OT3} Length = 257 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target408 tRNA-specific 2-thiouridylase MnmA [Candidatus Liberiba
2hma_A376 Probable tRNA (5-methylaminomethyl-2- thiouridylate)-me 100.0
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 100.0
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 99.91
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferase, li 99.87
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, adenin 99.86
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomics, P 99.83
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural genomics, 99.75
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine amidotra 99.72
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP synthetase, X 99.72
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structural g 99.71
1vl2_A421 Argininosuccinate synthase; TM1780, structural genomics 99.71
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase 99.69
1kqp_A271 NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; liga 99.68
2vxo_A697 GMP synthase [glutamine-hydrolyzing]; proto-oncogene, p 99.66
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 99.63
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP- 99.56
1ni5_A433 Putative cell cycle protein MESJ; structural genomics, 99.42
1k92_A455 Argininosuccinate synthase, argininosuccinate; N-type A 99.36
1kor_A400 Argininosuccinate synthetase; ligase, riken structural 99.36
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesis, as 99.36
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 99.28
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 99.24
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structural g 99.14
3dla_A680 Glutamine-dependent NAD(+) synthetase; glutaminase, amm 98.99
1vbk_A307 Hypothetical protein PH1313; structural genomics, riken 98.65
3ilv_A634 Glutamine-dependent NAD(+) synthetase; protein structur 98.59
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3-phosp 98.58
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel, swi 98.48
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cluster 97.51
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate redu 97.48
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferase, nu 97.44
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/beta p 97.42
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzing] su 99.9
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 99.89
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfide cr 98.45
2d13_A227 Hypothetical protein PH1257; structural genomics, NPPSF 98.74
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lac 98.43
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, clavulan 98.31
1ct9_A553 Asparagine synthetase B; amidotransferase, substrate ch 98.13
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 93.09
2bln_A305 Protein YFBG; transferase, formyltransferase, L-ARA4N b 91.14
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
Probab=100.00  E-value=0  Score=947.83  Aligned_cols=362  Identities=36%  Similarity=0.595  Sum_probs=336.9

Q ss_pred             CCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             43467888633889999609857999999998869849999987047876655557788189999999999980995898
Q gi|254780151|r   10 NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        10 ~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      |+|+.+   +++||+|||||||||||||+||++|||||+|+||++|+..+   ..+.||+++|++||++||++|||||++
T Consensus         2 ~~m~~~---~k~rV~v~mSGGVDSsvaA~LL~~~G~~V~gv~m~~~~~~~---~~~~c~~~~d~~da~~va~~LgIp~~~   75 (376)
T 2hma_A            2 NAMSDN---SKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD---ENGVCTATEDYKDVVAVADQIGIPYYS   75 (376)
T ss_dssp             ---CCG---GGSEEEEECCSSHHHHHHHHHHHHTTCEEEEEEEECCCCCC-------CHHHHHHHHHHHHHHHHTCCEEE
T ss_pred             CCCCCC---CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC---CCCCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             857778---76889999268799999999999779957999997877877---778778378899999999985998899


Q ss_pred             CCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCC
Q ss_conf             17078866322441126787088612000015411058888874016876452253110254126787731688531578
Q gi|254780151|r   90 FDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDL  169 (408)
Q Consensus        90 ~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~  169 (408)
                      +|++++||++||+||+++|++|+|||||++||++|||++|+++|+++|+||||||||||+...    ..+.+.|+||.|.
T Consensus        76 ~d~~~~f~~~V~~~f~~~y~~G~TPNPcv~CN~~IKF~~l~~~a~~~g~d~iATGHYAri~~~----~~g~~~L~r~~D~  151 (376)
T 2hma_A           76 VNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITLGADYVATGHYARVARD----EDGTVHMLRGVDN  151 (376)
T ss_dssp             EECHHHHHHHTHHHHHHHHHTTCCCCHHHHHHHHTTTTHHHHHHHTTTCSEEECCCSEEEEEC----SSSCEEEEECSST
T ss_pred             ECHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEC----CCCCEEEEECCCC
T ss_conf             650899999998989999860379994421123466999999998615662146734213677----9986898851677


Q ss_pred             CCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCC
Q ss_conf             78731898630202210033425689978989999741254355111023011127751034553076643467110377
Q gi|254780151|r  170 ERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN  249 (408)
Q Consensus       170 ~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~  249 (408)
                      +||||||||+|+|++|++++||||+|+|+|||++|+++||++|+||||||||||++++|++||++|++  ++||+|+|.+
T Consensus       152 ~KDQSYfL~~l~~~~L~~~iFPLG~~~K~eVR~iA~~~gl~~a~K~dSq~ICFi~~~~~~~fl~~~~~--~~~G~ivd~~  229 (376)
T 2hma_A          152 GKDQTYFLSQLSQEQLQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVD  229 (376)
T ss_dssp             TTCCGGGGTTCCHHHHTTEECTTTTCCHHHHHHHHHHTTCTTTTCCCCCSCTTTTTSCHHHHHHTTSC--CCCEEEEETT
T ss_pred             CCCCCEEEEEECHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCC--CCCEEEEECC
T ss_conf             77742244432587883666888999778999999875953267645545300379988999886179--9970599589


Q ss_pred             CCEEEEECCCEEEEECCCCCCCCCC-----CCCCEEEECCCCCCEEEEEC---CCCCCCCCEEECCCEECCCCCCCCCCC
Q ss_conf             4322335783153102334335657-----78613763175531256523---555422211200223037765554456
Q gi|254780151|r  250 GQILGRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGP---RESLEVHRIYLREINWLGDGLFEDAVV  321 (408)
Q Consensus       250 G~viG~H~G~~~yTIGQRkGL~i~~-----~eP~YVv~id~~~N~ViVg~---~~~L~~~~i~l~d~nWi~~~~~~~~~~  321 (408)
                      |++||+|+|+|+|||||||||++++     ++||||++||+++|+|+||+   ++.|+.+.+.+.++||+++.+.    .
T Consensus       230 G~~lG~H~G~~~yTiGQRkGlgi~~~~~~~~~p~yV~~~d~~~N~v~V~~~~~~~~l~~~~~~~~~~~wi~~~~~----~  305 (376)
T 2hma_A          230 GRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQVHFTREMPE----E  305 (376)
T ss_dssp             CCEEEEESCGGGCCTTCBSCTTTTC----CCSCEEEEEEEGGGTEEEEEESTTCGGGEEEEEEEEEEEESSCCCS----S
T ss_pred             CCEEEEECCEEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEECCCCCHHHHHHCCCEEEEEEECCCCCC----C
T ss_conf             968778689667634654654434666777873699861278878998767312334430241001267477887----8


Q ss_pred             CCEEEEEEEECCCCCCEEEEEEECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCCCCH
Q ss_conf             8718999980178870089998299799997597200069638999738886658887689714555303
Q gi|254780151|r  322 DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDA  391 (408)
Q Consensus       322 ~~~~~~vkiR~~~~pvp~~i~~~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~~~~  391 (408)
                      .+++|.||+||+++++||+++..++.+.|+|++|++||||||+||||++|    +|||||||+++.|+..
T Consensus       306 ~~~~~~vkiRyr~~~~~~~v~~~~~~~~V~f~eP~~avaPGQsaVfYdgd----~vlGGGiI~~~~~~~~  371 (376)
T 2hma_A          306 FTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAITPGQAVVFYDGE----ECLGGGLIDNAYRDGQ  371 (376)
T ss_dssp             EEEEEEEESSTTSCCEEEEEEECSSCEEEEEEEEEECCCTTSEEEEEETT----EEEEEEEEEEEESSSS
T ss_pred             CCEEEEEEEEECCCCCCEEEEEECCEEEEEECCCCCCCCCCCEEEEEECC----EEEEEEEECHHCCCCC
T ss_conf             87599999904899855799997998999979999870823469999599----9999999904422586



>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphatase, transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway; 2.10A {Thermus thermophilus HB8} PDB: 2ywc_A* Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>1kqp_A NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure