peg_33

peg_33

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(34536, 34838)Protein Length:100aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:D-3-phosphoglycerate dehydrogenase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
ccccccEEEEEEccEEEEEEccccEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEcccccHHHHHHHHccccEEEEEEEEEEEc
cccccccEEEEEccEEEEEcccccEEEEEccccccEEEEEEHEccccccEEEEEEEccccccccEEEEEEEcccccHHHHHHHHHccccEEEEEEEEEcc
vfsdgkprfikiQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIahfhlgrsqstEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
vfsdgkprfikiqeinfdvdiGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVkqfefnvd
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV*
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
*F*DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target100
15891242531 D-3-phosphoglycerate dehydrogenase [Agrobacterium tumef 1 4e-23
325063120531 D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H 1 2e-22
218509868254 D-3-phosphoglycerate dehydrogenase [Rhizobium etli Bras 1 1e-21
218516339231 D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3 1 1e-21
190893267531 D-3-phosphoglycerate dehydrogenase protein [Rhizobium e 1 3e-21
218675485531 D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56 1 4e-21
218663595535 D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE47 1 5e-21
209550768531 D-3-phosphoglycerate dehydrogenase [Rhizobium leguminos 1 5e-21
307300480531 D-3-phosphoglycerate dehydrogenase [Sinorhizobium melil 1 5e-21
307318345531 D-3-phosphoglycerate dehydrogenase [Sinorhizobium melil 1 5e-21
>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 531 Back     alignment and organism information
 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR VK   FNVD
Sbjct: 492 EAGDAIALLYVDGPVSEEVLDKLRANSAIRQVKPLTFNVD 531



Species: Agrobacterium tumefaciens
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3] Length = 531 Back     alignment and organism information
>gi|218509868|ref|ZP_03507746.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5] Length = 254 Back     alignment and organism information
>gi|218516339|ref|ZP_03513179.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3] Length = 231 Back     alignment and organism information
>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT 652] Length = 531 Back     alignment and organism information
>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56] Length = 531 Back     alignment and organism information
>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771] Length = 535 Back     alignment and organism information
>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 531 Back     alignment and organism information
>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C] Length = 531 Back     alignment and organism information
>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83] Length = 531 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target100
PRK13581526 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; 2e-19
TIGR01327525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase 1e-11
cd0487971 cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD includes the 2e-09
cd0490371 cd04903, ACT_LSD, C-terminal ACT domain of the L-serine 3e-05
cd0490273 cd04902, ACT_3PGDH-xct, C-terminal ACT (regulatory) dom 2e-11
>gnl|CDD|184162 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162302 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|153151 cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>gnl|CDD|153175 cd04903, ACT_LSD, C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>gnl|CDD|153174 cd04902, ACT_3PGDH-xct, C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 100
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehydrata 99.91
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3 99.9
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-termina 99.87
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Pho 99.81
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.76
TIGR01327535 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR0 99.75
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-dependent, b 99.65
LOAD_ACT76 consensus 98.9
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis 98.56
PRK08577135 hypothetical protein; Provisional 98.47
pfam0184266 ACT ACT domain. This family of domains generally have a 98.46
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet uncharacter 98.44
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia coli 98.42
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel protein c 98.39
PRK0673776 acetolactate synthase 1 regulatory subunit; Validated 98.29
COG1760262 SdaA L-serine deaminase [Amino acid transport and metab 98.26
CHL00100172 ilvH acetohydroxyacid synthase small subunit 98.24
PRK10872743 relA GDP/GTP pyrophosphokinase; Provisional 98.24
PRK0817896 acetolactate synthase 1 regulatory subunit; Reviewed 98.19
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; Review 98.17
COG2150167 Predicted regulator of amino acid metabolism, contains 98.17
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal AC 98.16
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 a.a. 98.11
PRK04435146 hypothetical protein; Provisional 97.89
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet unchara 97.89
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bi 97.88
COG1707 218 ACT domain-containing protein [General function predict 97.85
PRK10820 513 DNA-binding transcriptional regulator TyrR; Provisional 97.84
PRK0019490 hypothetical protein; Validated 97.84
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofunctional, 97.76
PRK06349432 homoserine dehydrogenase; Provisional 97.73
PRK13011 287 formyltetrahydrofolate deformylase; Reviewed 97.69
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-termina 97.67
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofo 97.67
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine Cleava 97.51
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases/synt 97.51
PRK1356284 acetolactate synthase 1 regulatory subunit; Provisional 97.5
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein. ACT 97.41
COG0440163 IlvH Acetolactate synthase, small (regulatory) subunit 97.35
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide trans 97.35
TIGR00655 294 PurU formyltetrahydrofolate deformylase; InterPro: IPR0 97.26
PRK06027 285 purU formyltetrahydrofolate deformylase; Reviewed 97.21
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT 97.21
PRK11589183 gcvR glycine cleavage system transcriptional repressor; 97.2
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunctional ch 97.19
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 97.19
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacter 97.0
COG0077279 PheA Prephenate dehydratase [Amino acid transport and m 96.97
KOG2663 309 consensus 96.94
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, inclu 96.83
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel protein c 96.8
PRK05007 881 PII uridylyl-transferase; Provisional 96.77
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial signal-tr 96.75
COG383090 ACT domain-containing protein [Signal transduction mech 96.74
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphoserine 96.7
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-depend 96.6
PRK05007881 PII uridylyl-transferase; Provisional 96.59
COG4747142 ACT domain-containing protein [General function predict 96.59
PRK03381 781 PII uridylyl-transferase; Provisional 96.36
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an 96.31
PRK11898285 prephenate dehydratase; Provisional 96.31
cd0489572 ACT_ACR_1 ACT domain-containing protein which is compos 96.28
PRK11899284 prephenate dehydratase; Provisional 96.25
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, arom 96.18
cd0492574 ACT_ACR_2 ACT domain-containing protein which is compos 96.18
COG4492150 PheB ACT domain-containing protein [General function pr 96.16
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensi 95.78
PRK10622386 pheA bifunctional chorismate mutase/prephenate dehydrat 95.75
PRK01759862 glnD PII uridylyl-transferase; Provisional 95.69
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; Provis 95.64
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent aromat 95.58
PRK11589 183 gcvR glycine cleavage system transcriptional repressor; 95.41
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent aromat 95.21
TIGR00119 205 acolac_sm acetolactate synthase, small subunit; InterPr 94.94
COG4747142 ACT domain-containing protein [General function predict 94.93
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine Cleava 94.69
PRK03059857 PII uridylyl-transferase; Provisional 94.09
PRK00275894 glnD PII uridylyl-transferase; Provisional 94.05
PRK03381781 PII uridylyl-transferase; Provisional 93.8
PRK05092934 PII uridylyl-transferase; Provisional 93.78
COG3283 511 TyrR Transcriptional regulator of aromatic amino acids 93.43
COG2061170 ACT-domain-containing protein, predicted allosteric reg 93.35
TIGR00691741 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 93.14
PRK08198406 threonine dehydratase; Provisional 92.15
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. A form of threonine dehydratase with two copies of the C-terminal domain is described by . This model describes a phylogenetically distinct which branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any domain. Many members of this model are found in species with other isoleucine biosynthetic enzymes.; GO: 0004794 L-threonine ammonia-lyase activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01127">TIGR01127381 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 91.76
PRK06382400 threonine dehydratase; Provisional 91.63
TIGR01693903 UTase_glnD protein-P-II uridylyltransferase; InterPro: 90.6
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/S 98.38
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monofuncti 97.81
cd0211660 ACT ACT domains are commonly involved in specifically b 97.47
PRK03059 857 PII uridylyl-transferase; Provisional 96.93
PRK00275 894 glnD PII uridylyl-transferase; Provisional 96.68
PRK04374 869 PII uridylyl-transferase; Provisional 96.55
PRK01759 862 glnD PII uridylyl-transferase; Provisional 96.49
PRK05092 934 PII uridylyl-transferase; Provisional 96.27
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegradativ 95.7
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttr 93.29
PRK09977215 putative Mg(2+) transport ATPase; Provisional 92.66
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine beta 92.3
PRK07431 594 aspartate kinase; Provisional 91.8
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensi 90.77
PRK06545357 prephenate dehydrogenase; Validated 97.54
COG2716176 GcvR Glycine cleavage system regulatory protein [Amino 96.36
TIGR01693 903 UTase_glnD protein-P-II uridylyltransferase; InterPro: 93.86
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR006236 This group of sequences represent the long form of D-3-phosphoglycerate dehydrogenase, they include the serA gene of one pathway of serine biosynthesis Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit; InterPro: IPR004643 L-serine dehydratase, also called serine deaminase, catalyses the conversion of L-serine and water to pyruvate and ammonia during gluconeogenesis from serine Back     alignment and domain information
>LOAD_ACT consensus Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>pfam01842 ACT ACT domain Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>COG1760 SdaA L-serine deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PRK10872 relA GDP/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase; InterPro: IPR004810 An Escherichia coli gene designated purU has been identified and characterised Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2663 consensus Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit; InterPro: IPR004789 Acetolactate synthases are a group of biosynthetic enzymes apparently found in plants, fungi and bacteria that are capable of de novo synthesis of the branched-chain amino acids Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG2061 ACT-domain-containing protein, predicted allosteric regulator of homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00691 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 The functions of Escherichia coli RelA and SpoT differ somewhat Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 Serine and threonine dehydratases , are functionally and structurally related pyridoxal-phosphate dependent enzymes Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD protein-P-II uridylyltransferase; InterPro: IPR010043 This entry describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for signal-transduction protein PII, and acts as the sensory component of the nitrogen regulation (ntr) system Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09977 putative Mg(2+) transport ATPase; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01693 UTase_glnD protein-P-II uridylyltransferase; InterPro: IPR010043 This entry describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for signal-transduction protein PII, and acts as the sensory component of the nitrogen regulation (ntr) system Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target100
1psd_B406 The Allosteric Ligand Site In The Vmax-Type Coopera 6e-14
2p9c_A410 Crystal Structure Of Serine Bound G336v Mutant Of E 2e-13
3ddn_A528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 4e-13
1ygy_A529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 4e-13
1yba_A410 The Active Form Of Phosphoglycerate Dehydrogenase L 4e-13
3k5p_A416 Crystal Structure Of Amino Acid-Binding Act: D-Isom 5e-13
1sc6_A404 Crystal Structure Of W139g D-3-Phosphoglycerate Deh 7e-13
2p9g_A410 Crystal Structure Of Serine Bound G336v,G337v Doubl 2e-12
>gi|146387102|pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|194368789|pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
>gi|60594357|pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
>gi|66360690|pdb|1YBA|A Chain A, The Active Form Of Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|262368138|pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2-Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 Back     alignment and structure
>gi|61679883|pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404 Back     alignment and structure
>gi|146387108|pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target100
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 2e-15
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
 Score = 76.0 bits (186), Expect = 2e-15
 Identities = 18/95 (18%), Positives = 38/95 (40%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + ++I   +FD+    + + I   D  G +  +G +LG  G+NI    L       
Sbjct: 435 QLSQKIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGP 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A   L +D  + + V   ++  V    ++  + +
Sbjct: 495 GATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDLS 529

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target100
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 100.0
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 99.63
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 99.53
1y7p_A 223 Hypothetical protein AF1403; structural genomics, prote 98.92
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, 98.81
2fgc_A193 Acetolactate synthase, small subunit; regulatory subuni 98.19
2pc6_A165 Probable acetolactate synthase isozyme III (small subun 98.12
2f1f_A164 Acetolactate synthase isozyme III small subunit; ferred 98.12
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transferase, 97.87
1zpv_A91 ACT domain protein; structural genomics, PSI, protein s 97.76
3o1l_A 302 Formyltetrahydrofolate deformylase; structural genomics 97.64
3lou_A 292 Formyltetrahydrofolate deformylase; structural genomics 97.61
2nyi_A195 Unknown protein; protein structure initiative, PSI, cen 97.55
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, str 97.44
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 97.44
3obi_A 288 Formyltetrahydrofolate deformylase; structural genomics 97.44
2nyi_A 195 Unknown protein; protein structure initiative, PSI, cen 97.18
2f06_A144 Conserved hypothetical protein; structural genomics hyp 96.82
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition, PDT 96.78
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate dehyd 96.43
3luy_A329 Probable chorismate mutase; structural genomics, APC380 96.41
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural geno 96.01
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structural ge 95.66
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural geno 94.87
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory subun 92.06
2f06_A144 Conserved hypothetical protein; structural genomics hyp 97.16
1u8s_A192 Glycine cleavage system transcriptional repressor, puta 97.02
1u8s_A 192 Glycine cleavage system transcriptional repressor, puta 96.98
2re1_A167 Aspartokinase, alpha and beta subunits; structural geno 91.12
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
Probab=100.00  E-value=4.6e-34  Score=199.34  Aligned_cols=98  Identities=18%  Similarity=0.319  Sum_probs=95.2

Q ss_pred             CCCCC-EEEEEEECCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHH
Q ss_conf             95587-37899979989976579839999982878668899989973699632277421478981899999478899899
Q 537021.9.peg.3    1 VFSDG-KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSV   79 (100)
Q Consensus         1 vfg~g-~~riv~i~g~~v~~~~~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~v   79 (100)
                      +||++ .+||++||||++|+.|++|+|+++|+|+|||||+||++||+++|||++|+++|+.+|+.|+|++++|+++|+++
T Consensus       431 v~g~~~~~riv~i~g~~vd~~~~g~~L~~~~~D~PG~Ig~vg~iLg~~~INIa~m~l~R~~~gg~A~~vl~vD~~v~~~v  510 (529)
T 1ygy_A          431 LYGPQLSQKIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDV  510 (529)
T ss_dssp             EETTTTEEEEEEETTEEEEEESCSEEEEEEESCCTTHHHHHHHHHHHTTCCEEEEEEEECSSSSCEEEEEEESSCCCHHH
T ss_pred             EECCCCCCEEEEECCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHCCCCEECCEEECCCCCCEEEEEEECCCCCCHHH
T ss_conf             97898751179999988996078768999827979828899999864797840277503789985899999689999999


Q ss_pred             HHHHHCCCCEEEEEEEEEE
Q ss_conf             9998649882999999974
Q 537021.9.peg.3   80 LEKLSVNVTIRFVKQFEFN   98 (100)
Q Consensus        80 l~~i~~~~~v~~vr~i~~~   98 (100)
                      +++|++++++.++++++++
T Consensus       511 l~~i~~~~~i~~v~~v~L~  529 (529)
T 1ygy_A          511 RTAIAAAVDAYKLEVVDLS  529 (529)
T ss_dssp             HHHHHHHHTEEEEEEEECC
T ss_pred             HHHHHCCCCCEEEEEEEEC
T ss_conf             9998628795389999709
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small subunit); regulatory subunit, structural genomics, PSI; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Streptococcus pneumoniae TIGR4} SCOP: d.58.18.7 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein structure initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureus subsp. aureus MU50, structural genomics; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3- phenylpyruvate, PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein structure initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, PSI-2, protein structure initiative; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

IdentityAlignment graphLength Definition E-value
Target 100
d1ygya378 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, r 7e-07
d1sc6a384 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, r 9e-06
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain
domain: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 46.4 bits (110), Expect = 7e-07
 Identities = 15/70 (21%), Positives = 27/70 (38%)

Query: 25 MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           + I   D  G +  +G +LG  G+NI    L        A   L +D  + + V   ++
Sbjct: 5  NLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIA 64

Query: 85 VNVTIRFVKQ 94
            V    ++ 
Sbjct: 65 AAVDAYKLEV 74
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

IdentityAlignment graphLength Definition Probability
Target100
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-terminal) 99.9
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-terminal) 99.82
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermotoga m 98.41
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitrosomonas 98.41
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escherichia 98.4
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Archaeo 98.39
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiotaomicr 98.16
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId 97.92
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiotaomicr 97.83
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio chole 97.7
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio chole 97.61
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylococcu 97.6
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat (Rattu 96.53
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxI 91.55
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} 91.11
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain
domain: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.90  E-value=1.4e-23  Score=142.80  Aligned_cols=77  Identities=19%  Similarity=0.273  Sum_probs=75.3

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             79839999982878668899989973699632277421478981899999478899899999864988299999997
Q 537021.9.peg.3   21 IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF   97 (100)
Q Consensus        21 ~~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~~v~~vr~i~~   97 (100)
                      .+||+|++.|+|+||+||+|+++|++++|||++|+++|+++++.|+|++++|++++++++++|+++|+|.+||.+++
T Consensus         1 AeG~~L~i~~~D~PGvi~~I~~~l~~~~iNI~~m~~~~~~~g~~a~~vi~vD~~~~~~vl~~I~~~~~V~~v~~i~l   77 (78)
T d1ygya3           1 AQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDL   77 (78)
T ss_dssp             SCSEEEEEEESCCTTHHHHHHHHHHHTTCCEEEEEEEECSSSSCEEEEEEESSCCCHHHHHHHHHHHTEEEEEEEEC
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHHCCCCHHHHEEEECCCCCEEEEEEECCCCCCHHHHHHHHCCCCEEEEEEEEC
T ss_conf             98169999967969979999999986496932413300578976899999377766999999972779079999966
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against MMDB70 database

IdentityAlignment graphLength Definition E-value
Target 100
1ygy_A_453-52977 (A:453-529) PGDH, D-3-phosphoglycerate dehydrogena 5e-07
3k5p_A_333-41684 (A:333-416) D-3-phosphoglycerate dehydrogenase; ni 2e-06
1sc6_A_322-40483 (A:322-404) PGDH, D-3-phosphoglycerate dehydrogena 2e-05
>1ygy_A (A:453-529) PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis}Length = 77 Back     alignment and structure
 Score = 47.7 bits (114), Expect = 5e-07
 Identities = 15/76 (19%), Positives = 30/76 (39%)

Query: 23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEK 82
           + + I   D  G +  +G +LG  G+NI    L        A   L +D  + + V   
Sbjct: 2  GINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTA 61

Query: 83 LSVNVTIRFVKQFEFN 98
          ++  V    ++  + +
Sbjct: 62 IAAAVDAYKLEVVDLS 77
>3k5p_A (A:333-416) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}Length = 84 Back     alignment and structure
>1sc6_A (A:322-404) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli}Length = 83 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

Original result of HHsearch against MMDB70 database

IdentityAlignment graphLength Definition Probability
Target100
1ygy_A_453-52977 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.81
3k5p_A_333-41684 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.77
1sc6_A_322-40483 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.72
2fgc_A_1-106106 Acetolactate synthase, small subunit; regulatory s 99.27
2pc6_A_1-8080 Probable acetolactate synthase isozyme III (small 99.27
2f1f_A_1-7979 Acetolactate synthase isozyme III small subunit; f 99.2
2ko1_A_88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 99.15
2jhe_A_1-7373 Transcription regulator TYRR; aromatic hydrocarbon 98.34
2nyi_A_1-8484 Unknown protein; protein structure initiative, PSI 98.27
1zpv_A_91 ACT domain protein; structural genomics, PSI, prot 98.23
1y7p_A_1-8383 Hypothetical protein AF1403; structural genomics, 98.2
3lou_A_1-9393 Formyltetrahydrofolate deformylase; structural gen 98.09
2nyi_A_85-195111 Unknown protein; protein structure initiative, PSI 98.07
2f06_A_76-13459 Conserved hypothetical protein; structural genomic 97.82
1u8s_A_87-192106 Glycine cleavage system transcriptional repressor, 97.8
1u8s_A_1-8686 Glycine cleavage system transcriptional repressor, 97.71
2qmw_A_1-87_166-267189 PDT, prephenate dehydratase; APC85812, prephenate 97.4
1phz_A_1-131131 Protein (phenylalanine hydroxylase); aromatic amin 96.49
2re1_A_25-10278 Aspartokinase, alpha and beta subunits; structural 95.44
2dtj_A_15-9480 Aspartokinase; protein-ligand complex, regulatory 94.9
2dt9_A_16-9479 Aspartokinase; protein-ligand complex, regulatory 94.13
2qmx_A_186-28095 Prephenate dehydratase; APC86053, L-Phe inhibition 91.96
>1ygy_A (A:453-529) PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=99.81  E-value=2.1e-19  Score=122.80  Aligned_cols=77  Identities=19%  Similarity=0.280  Sum_probs=74.9

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             98399999828786688999899736996322774214789818999994788998999998649882999999974
Q 537021.9.peg.3   22 GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN   98 (100)
Q Consensus        22 ~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~~v~~vr~i~~~   98 (100)
                      ++|+|++.|+|+|||||+|+++|+++++||++|.++|.++++.|++++++|++++++++++|++++++.+++++++.
T Consensus         1 e~~~i~~~~~d~pGvla~I~~il~~~~vNI~~~~~~~~~~~~~a~~~i~~d~~~~~~i~~~i~~l~~v~~v~~i~l~   77 (77)
T 1ygy_A            1 QGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDLS   77 (77)
T ss_dssp             CSEEEEEEESCCTTHHHHHHHHHHHTTCCEEEEEEEECSSSSCEEEEEEESSCCCHHHHHHHHHHHTEEEEEEEECC
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCCEECCEEECCCCCCEEEEEEECCCCCCHHHHHHHHCCCCCCEEEEEECC
T ss_conf             87689998278698689999998757978603787226889768999996899999999998648796189999529
>3k5p_A (A:333-416) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1sc6_A (A:322-404) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} Back     alignment and structure
>2fgc_A (A:1-106) Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} Back     alignment and structure
>2pc6_A (A:1-80) Probable acetolactate synthase isozyme III (small subunit); regulatory subunit, structural genomics, PSI; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2f1f_A (A:1-79) Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} Back     alignment and structure
>2ko1_A (A:) CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2jhe_A (A:1-73) Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protein, nucleotide-binding, transcription regulation, activator, repressor; HET: PG4; 2.3A {Escherichia coli} Back     alignment and structure
>2nyi_A (A:1-84) Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1zpv_A (A:) ACT domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>1y7p_A (A:1-83) Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3lou_A (A:1-93) Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2nyi_A (A:85-195) Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2f06_A (A:76-134) Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein structure initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1u8s_A (A:87-192) Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} Back     alignment and structure
>1u8s_A (A:1-86) Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} Back     alignment and structure
>2qmw_A (A:1-87,A:166-267) PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureus subsp. aureus MU50, structural genomics; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1phz_A (A:1-131) Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} Back     alignment and structure
>2re1_A (A:25-102) Aspartokinase, alpha and beta subunits; structural genomics, PSI-2, protein structure initiative; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2dtj_A (A:15-94) Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} Back     alignment and structure
>2dt9_A (A:16-94) Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure