254780172

254780172

general L-amino acid transport system permease protein

GeneID in NCBI database:8209149Locus tag:CLIBASIA_00275
Protein GI in NCBI database:254780172Protein Accession:YP_003064585.1
Gene range:+(53847, 55007)Protein Length:386aa
Gene description:general L-amino acid transport system permease protein
COG prediction:[E] ABC-type amino acid transport system, permease component
KEGG prediction:aapM; general L-amino acid transport system permease protein; K09971 general L-amino acid transport system permease protein
SEED prediction:Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED7 TM-Helix
HMMTOP8 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
cccHHHHHHHHHHccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccccccccccHHHcccccccccccccHHHHHHHccccccHcHHHHHHHHHHHHHHccHHHHHHHHEHccccccHHHHHHHccccccccccccEEEEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHcHHHHEEcHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MIDSCKEFPYVrkrllqpslppvyqrGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVwigsnrtvcttvsqggiqpdgwnAACWAFIYDRYEqfifgnypmaqrwRPILVFLTGsilltpmlipsfprkFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAlgrnsnipvLRYACITFIELFRGVPLVTVLFMASImlplflpdtWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIglfkdsslISIINMFDLLGIVRVNfsestwissvtpttglIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
midsckefpyvrkrllqpslppVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVsqggiqpdgWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDilltaliiclllFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
*************************RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI***L******
MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
****CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK
MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target386 general L-amino acid transport system permease protein
254780171398 ABC transporter membrane spanning protein (amino a 6e-14
254780171398 ABC transporter membrane spanning protein (amino a 0.003
254781113226 amino acid ABC transporter (permease) [Candidatus 1e-08
>gi|254780171|ref|YP_003064584.1| ABC transporter membrane spanning protein (amino acid) [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 70.1 bits (170), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 57/82 (69%)

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + +S + +A+IAE++R GL ++ +GQ EAA +LGL++ +  RL+++PQ ++ +IP + + 
Sbjct: 271 IALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQ 330

Query: 314 FIGLFKDSSLISIINMFDLLGI 335
           ++ L K+SSL   +   DL+ +
Sbjct: 331 YLNLLKNSSLAVAVGFADLVSV 352

>gi|254780171|ref|YP_003064584.1| ABC transporter membrane spanning protein (amino acid) [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           T++  G + T  ++F G+I +  +G L+  GR S   ++ + C  ++E+FR +P + V+F
Sbjct: 87  TAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIF 146

Query: 231 M--ASIMLPLFLPD 242
               S++  L +PD
Sbjct: 147 FLYKSVLSVLPIPD 160

>gi|254781113|ref|YP_003065526.1| amino acid ABC transporter (permease) [Candidatus Liberibacter asiaticus str. psy62] Length = 226 Back     alignment
 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 112/212 (52%), Gaps = 30/212 (14%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGR----NSNIPVLRYACITFIELFRGVPLVTV 228
           L+  ++VTL I+    +IS+ +G  +A+ R    ++ I ++ +    ++ +FRG PL+  
Sbjct: 17  LYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHF---YVWIFRGTPLLVQ 73

Query: 229 LFMASIMLP----LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           LF+    LP    +F       D  +  ++ ++   SAYI+E++R  + SI KGQ++A+ 
Sbjct: 74  LFVIFYGLPHIGIVF-------DSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASY 126

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           ++GL+  Q +R II+PQ I      + + FI + K +S+ S I + ++       F  + 
Sbjct: 127 AIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEI-------FQTAQ 179

Query: 345 WISSVTPTTGLIF--IGFVFWI---FCFSISL 371
            I S T    +I+  + FV+ I   FC+ I +
Sbjct: 180 RIVSTTYQPLIIYCELAFVYLILTSFCYIIQI 211

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target386 general L-amino acid transport system permease protein
315122675386 general L-amino acid transport system permease protein 1 1e-172
241204486384 polar amino acid ABC transcriptional regulator inner me 1 1e-141
116251958384 general L-amino acid transport system permease protein 1 1e-141
86357517381 general L-amino acid ABC transporter, permease protein 1 1e-140
190891585381 general L-amino acid ABC transporter, permease protein 1 1e-140
209549160384 polar amino acid ABC transporter inner membrane subunit 1 1e-140
222085838384 general L-amino acid ABC transporter [Agrobacterium rad 1 1e-135
327190792359 general L-amino acid ABC transporter, permease protein 1 1e-135
218671516339 general L-amino acid ABC transporter, permease protein 1 1e-129
227821878384 putative amino acid ABC transporter, permease protein [ 1 1e-129
>gi|315122675|ref|YP_004063164.1| general L-amino acid transport system permease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 386 Back     alignment and organism information
 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 317/386 (82%), Positives = 346/386 (89%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           MI   KEFPYVRK+LL P LPPV+QRGIIAWIH +FF T KD +LT LII  LL  IP I
Sbjct: 1   MIHPLKEFPYVRKQLLPPCLPPVHQRGIIAWIHTSFFYTIKDSILTLLIIASLLSLIPDI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
            HW F+DAVW G++R VCTT+SQGGIQPDGWNAACWAF+YDRY QFIFGNYP  +RWRPI
Sbjct: 61  AHWFFIDAVWTGTDRRVCTTISQGGIQPDGWNAACWAFVYDRYPQFIFGNYPAEERWRPI 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LVF+ GSILL PML+PS PRKFLN +LLF LFPIFSFFVLYGG GL+IVETSLWGGLLVT
Sbjct: 121 LVFVLGSILLIPMLMPSLPRKFLNGVLLFFLFPIFSFFVLYGGFGLTIVETSLWGGLLVT 180

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LVIS FGII+SMPLGILLALGR+SNI VLR  CITF+ELFRGVPLVTVLFM S+MLPLFL
Sbjct: 181 LVISLFGIIVSMPLGILLALGRSSNILVLRVVCITFVELFRGVPLVTVLFMTSVMLPLFL 240

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           PD WDVDKLLRALLGV+AFASAYIAEV RGGLQSISKGQFEAANSLGL+Y Q MR II+P
Sbjct: 241 PDAWDVDKLLRALLGVAAFASAYIAEVFRGGLQSISKGQFEAANSLGLNYFQTMRFIIIP 300

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q IKRVIPGIVNTFIGLFKDS+LISIINMFD+LG+VR NFS+S+W+SSVTPTTGLIF+GF
Sbjct: 301 QTIKRVIPGIVNTFIGLFKDSTLISIINMFDILGVVRANFSDSSWVSSVTPTTGLIFVGF 360

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
           VFWIFCFSISLYSVFIE+TLHKGSKK
Sbjct: 361 VFWIFCFSISLYSVFIERTLHKGSKK 386


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204486|ref|YP_002975582.1| polar amino acid ABC transcriptional regulator inner membrane protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 384 Back     alignment and organism information
>gi|116251958|ref|YP_767796.1| general L-amino acid transport system permease protein [Rhizobium leguminosarum bv. viciae 3841] Length = 384 Back     alignment and organism information
>gi|86357517|ref|YP_469409.1| general L-amino acid ABC transporter, permease protein [Rhizobium etli CFN 42] Length = 381 Back     alignment and organism information
>gi|190891585|ref|YP_001978127.1| general L-amino acid ABC transporter, permease protein [Rhizobium etli CIAT 652] Length = 381 Back     alignment and organism information
>gi|209549160|ref|YP_002281077.1| polar amino acid ABC transporter inner membrane subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 384 Back     alignment and organism information
>gi|222085838|ref|YP_002544369.1| general L-amino acid ABC transporter [Agrobacterium radiobacter K84] Length = 384 Back     alignment and organism information
>gi|327190792|gb|EGE57860.1| general L-amino acid ABC transporter, permease protein [Rhizobium etli CNPAF512] Length = 359 Back     alignment and organism information
>gi|218671516|ref|ZP_03521186.1| general L-amino acid ABC transporter, permease protein [Rhizobium etli GR56] Length = 339 Back     alignment and organism information
>gi|227821878|ref|YP_002825848.1| putative amino acid ABC transporter, permease protein [Sinorhizobium fredii NGR234] Length = 384 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target386 general L-amino acid transport system permease protein
PRK15107224 PRK15107, PRK15107, glutamate/aspartate transport syste 4e-25
TIGR03003212 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC tra 3e-19
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 1e-17
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 6e-08
COG0765222 COG0765, HisM, ABC-type amino acid transport system, pe 3e-44
PRK15100220 PRK15100, PRK15100, amino acid ABC transporter permease 4e-24
TIGR03004214 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC tra 6e-24
COG4215230 COG4215, ArtQ, ABC-type arginine transport system, perm 5e-23
COG4160228 COG4160, ArtM, ABC-type arginine/histidine transport sy 5e-21
PRK09494219 PRK09494, glnP, glutamine ABC transporter permease prot 9e-17
PRK11123238 PRK11123, PRK11123, arginine transporter permease subun 6e-15
PRK11122222 PRK11122, artM, arginine transporter permease subunit A 2e-11
PRK15135228 PRK15135, PRK15135, histidine/lysine/arginine/ornithine 6e-11
PRK15069234 PRK15069, PRK15069, histidine/lysine/arginine/ornithine 2e-09
COG2011222 COG2011, AbcD, ABC-type metal ion transport system, per 8e-08
PRK10782217 PRK10782, PRK10782, DL-methionine transporter permease 2e-07
COG1177267 COG1177, PotC, ABC-type spermidine/putrescine transport 3e-06
TIGR01097250 TIGR01097, PhnE, phosphonate ABC transporter, permease 6e-05
COG0555274 COG0555, CysU, ABC-type sulfate transport system, perme 2e-04
COG0573310 COG0573, PstC, ABC-type phosphate transport system, per 5e-04
TIGR02141208 TIGR02141, modB_ABC, molybdate ABC transporter, permeas 0.004
TIGR0172699 TIGR01726, HEQRo_perm_3TM, amine acid ABC transporter, 2e-14
COG4597397 COG4597, BatB, ABC-type amino acid transport system, pe 4e-13
COG4597397 COG4597, BatB, ABC-type amino acid transport system, pe 2e-06
COG3639283 COG3639, COG3639, ABC-type phosphate/phosphonate transp 4e-06
COG1178540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 9e-06
COG1175295 COG1175, UgpA, ABC-type sugar transport systems, permea 0.001
>gnl|CDD|185062 PRK15107, PRK15107, glutamate/aspartate transport system permease GltK; Provisional Back     alignment and domain information
>gnl|CDD|132048 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC transporter, permease protein EhuD Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|31108 COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185055 PRK15100, PRK15100, amino acid ABC transporter permease; Provisional Back     alignment and domain information
>gnl|CDD|132049 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC transporter, permease protein EhuC Back     alignment and domain information
>gnl|CDD|33942 COG4215, ArtQ, ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33906 COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181907 PRK09494, glnP, glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|182979 PRK11123, PRK11123, arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>gnl|CDD|182978 PRK11122, artM, arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>gnl|CDD|185089 PRK15135, PRK15135, histidine/lysine/arginine/ornithine ABC transporter permease HisQ; Provisional Back     alignment and domain information
>gnl|CDD|185029 PRK15069, PRK15069, histidine/lysine/arginine/ornithine ABC transporter permease HisM; Provisional Back     alignment and domain information
>gnl|CDD|32194 COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182726 PRK10782, PRK10782, DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|31370 COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162201 TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE Back     alignment and domain information
>gnl|CDD|30901 COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30918 COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162726 TIGR02141, modB_ABC, molybdate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|130787 TIGR01726, HEQRo_perm_3TM, amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family Back     alignment and domain information
>gnl|CDD|34232 COG4597, BatB, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|34232 COG4597, BatB, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33437 COG3639, COG3639, ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31368 COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 386 general L-amino acid transport system permease protein
COG0765222 HisM ABC-type amino acid transport system, permease com 100.0
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 100.0
PRK09494219 glnP glutamine ABC transporter permease protein; Review 100.0
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 100.0
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 100.0
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 100.0
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 100.0
COG4215230 ArtQ ABC-type arginine transport system, permease compo 100.0
COG4597397 BatB ABC-type amino acid transport system, permease com 100.0
PRK10782217 DL-methionine transporter permease subunit; Provisional 100.0
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.78
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.76
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.7
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.69
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.69
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.68
PRK10160275 taurine transporter subunit; Provisional 99.65
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.64
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 99.61
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.59
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.59
PRK10592281 putrescine transporter subunit: membrane component of A 99.58
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 99.57
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.55
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 99.55
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.54
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.53
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.51
PRK09433 536 thiP thiamine transporter membrane protein; Reviewed 99.51
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.47
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 99.46
COG1178 540 ThiP ABC-type Fe3+ transport system, permease component 99.44
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.42
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.42
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.4
PRK10683317 putrescine transporter subunit: membrane component of A 99.4
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.36
COG0555274 CysU ABC-type sulfate transport system, permease compon 99.34
PRK10913300 dipeptide transporter; Provisional 99.32
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.3
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.29
PRK10999520 malF maltose transporter membrane protein; Provisional 99.26
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.23
PRK10352314 nickel transporter permease NikB; Provisional 99.14
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.1
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.01
PRK10914339 dipeptide transporter permease DppB; Provisional 98.96
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 98.75
COG4209309 LplB ABC-type polysaccharide transport system, permease 98.55
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 98.47
COG4239341 ABC-type uncharacterized transport system, permease com 98.17
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 98.15
COG4132282 ABC-type uncharacterized transport system, permease com 97.56
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 97.47
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 97.29
TIGR01253 519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 97.23
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 96.98
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 99.95
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.77
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.72
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.59
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.54
TIGR03262 546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.42
COG4149225 ModC ABC-type molybdate transport system, permease comp 99.01
PRK10998296 malG maltose transporter permease; Provisional 98.82
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 98.77
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 98.71
COG0395281 UgpE ABC-type sugar transport system, permease componen 98.67
COG3833282 MalG ABC-type maltose transport systems, permease compo 98.49
COG4986523 ABC-type anion transport system, duplicated permease co 97.37
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 97.34
COG4986 523 ABC-type anion transport system, duplicated permease co 96.99
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.62
PRK10952354 glycine betaine transporter membrane protein; Provision 99.51
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.18
CHL00187235 cysT sulfate transport protein; Provisional 99.35
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 98.83
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 97.86
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 96.32
COG4590733 ABC-type uncharacterized transport system, permease com 97.59
COG4208287 CysW ABC-type sulfate transport system, permease compon 97.49
COG4135551 ABC-type uncharacterized transport system, permease com 94.78
pfam03649250 UPF0014 Uncharacterized protein family (UPF0014). 93.84
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 92.17
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4597 BatB ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10913 dipeptide transporter; Provisional Back     alignment and domain information
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>PRK10417 nikC nickel transporter permease NikC; Provisional Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065 This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00187 cysT sulfate transport protein; Provisional Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>pfam03649 UPF0014 Uncharacterized protein family (UPF0014) Back     alignment and domain information
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target386 general L-amino acid transport system permease protein
3dhw_A217 D-methionine transport system permease protein METI; AB 3e-10
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 4e-10
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 0.004
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Length = 217 Back     alignment and structure
 Score = 61.3 bits (148), Expect = 3e-10
 Identities = 42/210 (20%), Positives = 89/210 (42%), Gaps = 8/210 (3%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI---PVLRYACITFIELFRGVPLVTV 228
            +W  L +T V  FFG +I +P+G+LL + R   I     L       + +FR +P + +
Sbjct: 12  GVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIIL 71

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L        +          L  A++ ++  A+ +IA ++   L  I  G  EA+ ++G 
Sbjct: 72  LVWMIPFTRVI---VGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGA 128

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           + +Q +R +++P+ +  ++     T I L   S++   +    L  I           + 
Sbjct: 129 TPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATV 188

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           +   T L+ +  + ++  F+       + +
Sbjct: 189 M--NTVLVLLVILVYLIQFAGDRIVRAVTR 216


>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Length = 295 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Length = 514 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target386 general L-amino acid transport system permease protein
3dhw_A217 D-methionine transport system permease protein METI; AB 99.95
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 99.86
2onk_C284 Molybdate/tungstate ABC transporter, permease protein; 99.82
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 99.71
2r6g_G296 Maltose transport system permease protein MALG; ABC tra 99.49
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Back     alignment and structure
Probab=99.95  E-value=1.9e-27  Score=182.34  Aligned_cols=201  Identities=18%  Similarity=0.262  Sum_probs=149.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHH----HHHHHHHC---CCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             0247877999999999998756----77544412---7868899978988887614722899999999766415588773
Q gi|254780172|r  174 WGGLLVTLVISFFGIIISMPLG----ILLALGRN---SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV  246 (386)
Q Consensus       174 ~gGl~~Tl~l~~~~~~~~~~lG----~llal~r~---s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~lp~g~~~  246 (386)
                      ..|+..|+.+++.+.+++.++|    ++++..|.   ...+.+......+++++|++|.++.+++.....+...  +...
T Consensus        10 l~~~~~Tl~~a~~~~~~~~~ig~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~~~--~~~~   87 (217)
T 3dhw_A           10 VRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIV--GTSI   87 (217)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTT--CCSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHH
T ss_conf             99999999999999999999999999999998644432008999999999999999999999999999999998--6123


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             87999999999998999899999999845866789999962168999999996998998620047999999961289999
Q gi|254780172|r  247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI  326 (386)
Q Consensus       247 ~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~~  326 (386)
                       .+..++++.+++..+|+.+.+|+|++++|++|.|||+++|.|++|++++|++||+.+..++++.+.++..+||+++++.
T Consensus        88 -~~~~~ii~~~~~~~~~~~~~~~~~l~~i~~~~~eAA~~lGas~~q~f~~vilP~~~p~ii~~~~~~~~~~i~~~~i~~~  166 (217)
T 3dhw_A           88 -GLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGA  166 (217)
T ss_dssp             -SHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCS
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -6999999999986799999999999858989999987189898999697419978999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999974101003551369999999999999999999999999998
Q gi|254780172|r  327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT  379 (386)
Q Consensus       327 Ig~~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~~~~~lE~r  379 (386)
                      +|..|+.........+.. + ............++++++++..++..|++|||
T Consensus       167 ig~~~~~~~~~~~~~~~~-~-~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~rR  217 (217)
T 3dhw_A          167 VGAGGLGQIGYQYGYIGY-N-ATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             TTCCHHHHHHHHHHHSSC-C-TTHHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHHH-H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             988799999999999860-0-89999999999999999999999999975699



>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Back     alignment and structure
>2onk_C Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: f.58.1.1 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Back     alignment and structure
>2r6g_G Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: f.58.1.1 PDB: 3fh6_G Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 386 general L-amino acid transport system permease protein
d3dhwa1203 f.58.1.1 (A:6-208) D-methionine transport system permea 9e-10
d2r6gf2244 f.58.1.1 (F:261-504) Maltose transport system permease 0.002
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
 Score = 58.6 bits (141), Expect = 9e-10
 Identities = 41/191 (21%), Positives = 81/191 (42%), Gaps = 6/191 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI---PVLRYACITFIELFRGVPLVT 227
             +W  L +T V  FFG +I +P+G+LL + R   I     L       + +FR +P + 
Sbjct: 6   RGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFII 65

Query: 228 VLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
           +L        +          L  A++ ++  A+ +IA ++   L  I  G  EA+ ++G
Sbjct: 66  LLVWMIPFTRVI---VGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMG 122

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
            + +Q +R +++P+ +  ++     T I L   S++   +    L  I           +
Sbjct: 123 ATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNAT 182

Query: 348 SVTPTTGLIFI 358
            +     L+ I
Sbjct: 183 VMNTVLVLLVI 193


>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Length = 244 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target386 general L-amino acid transport system permease protein
d3dhwa1203 D-methionine transport system permease protein MetI {Es 99.92
d2onkc1252 Molybdate/tungstate transport system permease protein W 99.74
d3d31c1248 Sulfate/molybdate ABC transporter, permease protein {Me 99.71
d2r6gf2244 Maltose transport system permease protein MalF {Escheri 99.45
d2r6gg1290 Maltose transport system permease protein MalG {Escheri 99.38
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=4.6e-24  Score=160.57  Aligned_cols=165  Identities=20%  Similarity=0.280  Sum_probs=131.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHH----HHHHHH---CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             02478779999999999987567----754441---27868899978988887614722899999999766415588773
Q gi|254780172|r  174 WGGLLVTLVISFFGIIISMPLGI----LLALGR---NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV  246 (386)
Q Consensus       174 ~gGl~~Tl~l~~~~~~~~~~lG~----llal~r---~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~lp~g~~~  246 (386)
                      +.|+..|+.+++.+..+++++|+    +++..+   ..+.+.+......+++++|++|.++++++.+.......  +.. 
T Consensus         5 l~~~~~tl~is~~~~~i~~ilg~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~v~~~~~~~~~~~~~--~~~-   81 (203)
T d3dhwa1           5 VRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIV--GTS-   81 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTT--CCS-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCC-
T ss_conf             99999999999999999999999999999998744432008999999999999999999999999998635540--454-


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             87999999999998999899999999845866789999962168999999996998998620047999999961289999
Q gi|254780172|r  247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI  326 (386)
Q Consensus       247 ~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~~  326 (386)
                      .....+++++++++.+|+.+++|+|++++|++|.|||+++|.|+||++++|++||+.+..+++..++++..+||++++..
T Consensus        82 ~~~~~~i~~~~~~~~p~~~~~~~~~l~~i~~~~~Eaa~~lGas~~q~~~~vilP~~~p~i~~~~~~~~~~~i~~~~~~~~  161 (203)
T d3dhwa1          82 IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGA  161 (203)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11999999999986489999999888843620689998869944424188409976999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999741
Q gi|254780172|r  327 INMFDLLGIVRVNFS  341 (386)
Q Consensus       327 Ig~~el~~~~~~~~~  341 (386)
                      +|..|+.....+...
T Consensus       162 ig~~~~~~~~~~~~~  176 (203)
T d3dhwa1         162 VGAGGLGQIGYQYGY  176 (203)
T ss_dssp             TTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             977599999999998



>d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r6gg1 f.58.1.1 (G:7-296) Maltose transport system permease protein MalG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 386 general L-amino acid transport system permease pro
3dhw_A_217 (A:) D-methionine transport system permease protei 3e-15
2r6g_F_269-326_360-453152 (F:269-326,F:360-453) Maltose transport system per 2e-11
2onk_C_69-249181 (C:69-249) Molybdate/tungstate ABC transporter, pe 8e-11
2r6g_G_73-244172 (G:73-244) Maltose transport system permease prote 3e-09
3d31_C_295 (C:) Sulfate/molybdate ABC transporter, permease p 3e-11
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12}Length = 217 Back     alignment and structure
 Score = 77.3 bits (190), Expect = 3e-15
 Identities = 42/220 (19%), Positives = 91/220 (41%), Gaps = 12/220 (5%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL---GRNSNIPVLRYACITFIELFRG 222
           + ++   +W  L +T V  FFG +I +P+G+LL +   G+      L       + +FR 
Sbjct: 6   MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRS 65

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           +P + +L        + +        L  A++ ++  A+ +IA ++   L  I  G  EA
Sbjct: 66  IPFIILLVWMIPFTRVIV---GTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEA 122

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           + ++G + +Q +R +++P+ +  ++     T I L   S++   +    L  I       
Sbjct: 123 SRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYI 182

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
                     T +  +  +  I  + I      I + + +
Sbjct: 183 GYN------ATVMNTVLVLLVILVYLIQFAGDRIVRAVTR 216


>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 152 Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus}Length = 181 Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 172 Back     alignment and structure
>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}Length = 295 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target386 general L-amino acid transport system permease protein
3dhw_A_217 D-methionine transport system permease protein MET 99.95
3d31_C_295 Sulfate/molybdate ABC transporter, permease protei 99.86
2onk_C_69-249181 Molybdate/tungstate ABC transporter, permease prot 99.76
2r6g_F_269-326_360-453152 Maltose transport system permease protein MALF; AB 99.64
2r6g_G_73-244172 Maltose transport system permease protein MALG; AB 99.63
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} Back     alignment and structure
Probab=99.95  E-value=2.8e-27  Score=182.21  Aligned_cols=208  Identities=16%  Similarity=0.208  Sum_probs=174.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             111111002478779999999999987567754441-------2786889997898888761472289999999976641
Q gi|254780172|r  167 SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGR-------NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF  239 (386)
Q Consensus       167 ~~V~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r-------~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~  239 (386)
                      +++.+..|.++..|+.+++.+.++++++|+.+|..-       +...+.+........+.++++|.+..++......+..
T Consensus         3 ~~~~~~l~~~l~~tl~~~~~~~~i~~vig~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (217)
T 3dhw_A            3 EPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVI   82 (217)
T ss_dssp             ---CHHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78999999999999999999999999999999999999873443201899999999999999999999999999864552


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             55887738799999999999899989999999984586678999996216899999999699899862004799999996
Q gi|254780172|r  240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK  319 (386)
Q Consensus       240 lp~g~~~~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~K  319 (386)
                         +.....+...++++++++.+|+.+++|++++++|++|.|||+++|+|+||++++|++||+.+..+++..+.++..+|
T Consensus        83 ---~~~~~~~~~~ii~~~~~~~~~i~~~~~~~l~~i~~~~~eaA~~lG~s~~q~~~~v~lP~~~p~i~~~~~~~~~~~~~  159 (217)
T 3dhw_A           83 ---VGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVG  159 (217)
T ss_dssp             ---TCCSSSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ---CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---04530188998988997246898999988886150277888606987421426730997699999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             128999999999999999974101003551369999999999999999999999999998
Q gi|254780172|r  320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT  379 (386)
Q Consensus       320 dTsL~~~Ig~~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~~~~~lE~r  379 (386)
                      |++.+..+|..|+.+.......+..  .........+...+++++++....+..+++|||
T Consensus       160 ~~~~~~~ig~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~i~~~~~~~l~~~l~~~~~rR  217 (217)
T 3dhw_A          160 YSAMGGAVGAGGLGQIGYQYGYIGY--NATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             HHHHCCSTTCCHHHHHHHHHHHSSC--CTTHHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999987599999999999750--189999999999999999999999999985699



>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure