254780173

254780173

ABC transporter related protein

GeneID in NCBI database:8209150Locus tag:CLIBASIA_00280
Protein GI in NCBI database:254780173Protein Accession:YP_003064586.1
Gene range:+(55022, 55795)Protein Length:257aa
Gene description:ABC transporter related protein
COG prediction:[E] ABC-type polar amino acid transport system, ATPase component
KEGG prediction:ABC transporter related protein; K09972 general L-amino acid transport system ATP-binding protein [EC:3.6.3.-]
SEED prediction:Amino acid ABC transporter, ATP-binding protein
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY
cccccccccccccccEEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccccHHHHHcccEEEcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHHcc
cccHHHccccccccccEEEEEEEEEEEccEEEEEEEccEEEcccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEccccHHHHHHHHHHEEEEcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHcccHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHccEEEEEEccEEEEEEcHHHHHHccccHHHHHHHHHHHc
mkntpinsknppknnFAVEIKFLNKWYGNFHALRDINlnvlrgerviiagpsgsgksTLIRCINHIEKhqageiiingiplnddirNIHEVRRDVGMVFqhfnlfsnlsvlenctlgpiwvrkmpkKDAEELAMHYLNKVKIadkshrsssllsggeSQRAAIARSLCmqpkimlfdeptsaldpEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQgqiveqnspeeffnnpqheRTQAFLSQIIY
mkntpinsknppknnFAVEIKFLNKWYGNFHALRDINLNVLRGERVIiagpsgsgkstLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQnspeeffnnpqHERTQAFLSQIIY
MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY
*****************VEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKM****A*ELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY
MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIAD***************RAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY
******NSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY
MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target257 ABC transporter related protein [Candidatus Liberibacte
254780704254 ABC transporter, nucleotide binding/ATPase protein 2e-35
254780559234 thiamine transporter ATP-binding subunit [Candidat 1e-27
254780596 438 ABC transporter nucleotide binding/ATPase protein 3e-25
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 6e-25
254780871227 lipoprotein-releasing system ATP-binding protein l 2e-23
254780744262 ABC transporter nucleotide binding/ATPase protein 1e-20
254780139257 putative ATP-binding component of ABC transporter 1e-19
254780917596 ABC transporter, nucleotide binding/ATPase protein 4e-16
254780576597 ABC transporter related protein [Candidatus Liberi 3e-14
254780718240 putative high-affinity zinc uptake system ATP-bind 3e-14
254780193528 lipid A ABC exporter family, fused ATPase and inne 7e-14
254780538280 ABC transporter, nucleotide binding/ATPase protein 2e-11
254781123 610 putative ABC transporter, ATP-binding protein [Can 3e-11
254781123 610 putative ABC transporter, ATP-binding protein [Can 3e-09
254780273 539 putative ABC transporter ATP-binding protein [Cand 2e-08
254780273539 putative ABC transporter ATP-binding protein [Cand 7e-08
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 7e-08
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 5e-07
254780184 959 excinuclease ABC subunit A [Candidatus Liberibacte 2e-05
254781060249 ABC transporter, nucleotide binding/ATPase protein 1e-06
>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score =  140 bits (354), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 129/237 (54%), Gaps = 12/237 (5%)

Query: 26  WYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQ-----AGEIIINGIP 80
            YG   AL DINL + +     + GPSG GKST +RC+N + +        GEII++G  
Sbjct: 15  CYGEKRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGKN 74

Query: 81  LNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGP-IWVRKMPKKDAEELAMHYLNK 139
           +     ++  +R  VGMVFQ  N F   S+ +N   GP I      K D +++    L K
Sbjct: 75  IYQSSVDVVRLRARVGMVFQRPNPFPK-SIYDNVAYGPRIHGLGNNKADIDQIVEMSLKK 133

Query: 140 V----KIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIM 195
                ++ D+    +SLLSGG+ QR  IAR+L + P+++L DEP SALDP     V +++
Sbjct: 134 ASLFNEVKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELI 193

Query: 196 IELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFL 252
            EL  E +T+V VTH M  A +V+ R      G +VE++  ++ F  P  +RTQ ++
Sbjct: 194 HEL-RESLTIVIVTHSMQQAARVSQRAAMFHMGHLVEEDDTDKMFTAPSDQRTQDYI 249

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score =  114 bits (286), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 123/232 (53%), Gaps = 8/232 (3%)

Query: 18  VEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIIN 77
           +++  L   Y N     D  +N  + ER++I GPSG+GKSTL+  +   +    G I +N
Sbjct: 2   IKLDHLIYCYDNLKMQFDFQVN--KAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFLN 59

Query: 78  GIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYL 137
           G    +  R+    +R + ++FQ  NLFS+L+V +N  LG     ++      ++    L
Sbjct: 60  G---QNHTRS-SPSKRPLSILFQENNLFSHLTVWQNIALGIAPNLRLDHYQHAQVK-QML 114

Query: 138 NKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIE 197
            KV + D  +R  S +SGG+ QR A+AR L  Q  I+L DEP +  DP +  E+L ++ +
Sbjct: 115 EKVFLEDFFNRFPSQMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQ 174

Query: 198 LAEE-GMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERT 248
           + +E  +T++ ++H +  + Q+A R + +  GQIV    P+   N    E T
Sbjct: 175 VCDERQLTLLMISHNLEDSMQIATRFIVIAGGQIVYDGDPDRLMNGLIPEST 226

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score =  106 bits (265), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 115/217 (52%), Gaps = 14/217 (6%)

Query: 23  LNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLN 82
           L K  GN   L  +N NV  GE V + G SGSGKSTL+R I  +    +G+++  G    
Sbjct: 23  LKKISGNLLVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKG---- 78

Query: 83  DDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKI 142
              + I +  +D+ +VFQ F LF  L+VLEN  LG +  + + K++  + A+  ++ + +
Sbjct: 79  ---KKIKDPPKDISVVFQTFALFPWLTVLENVELG-LKAKGIDKEERRKRALSAIDLIGL 134

Query: 143 ADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEG 202
                  ++ +SGG  QR   AR+  + P ++L DEP SALD    + +   +I+L  EG
Sbjct: 135 DGFESAHTTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDLWIEG 194

Query: 203 M----TMVCVTHEMGFARQVADRVVFMDQ--GQIVEQ 233
                +M+ VTH +  A  + DRV+      G+I E+
Sbjct: 195 RLPIESMLMVTHNIEEAVLMCDRVLVFSSNPGRIAEE 231

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score =  105 bits (263), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 124/236 (52%), Gaps = 8/236 (3%)

Query: 27  YGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIIN---GI--PL 81
           YG   A+   NL V +GE +++ G SG+GKSTL+R IN +     GE++++   G   P 
Sbjct: 39  YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98

Query: 82  NDDIRNIHEVR-RDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKV 140
             D   + ++R   V MVFQ F L    +V  N  LG  ++  +P  + +     +L  V
Sbjct: 99  AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFL-DIPDVERKSRVAEHLEIV 157

Query: 141 KIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAE 200
            +   +    ++LSGG  QR   AR+      I+L DEP S+LDP +   + D ++ L  
Sbjct: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217

Query: 201 E-GMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQI 255
           +   T+V V+H++  A ++ +R+  M+ G+I++  +P+E   +P +     F+ ++
Sbjct: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKL 273

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score =  100 bits (250), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 113/207 (54%), Gaps = 7/207 (3%)

Query: 30  FHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIII-NGI--PLNDDIR 86
           F  L +++L++ +GE V +  PSG+GKST++     +E    G +II N +   L+DD +
Sbjct: 23  FPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKK 82

Query: 87  NIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKS 146
           +     + +G V+Q   L  + SV+EN    P  +  +  K A + AM  L+ + ++  +
Sbjct: 83  SFLRCSK-IGFVYQEHRLLMDFSVIENIIF-PQIIAGINHKTAYQRAMDLLSYMDMSQYA 140

Query: 147 HRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIEL-AEEGMTM 205
           +R SS +SGGE QR AI R++  +P I+L DEPT  LD +  ++V  I+  L    G+  
Sbjct: 141 NRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAA 200

Query: 206 VCVTHEMGFARQVADRVVFMDQGQIVE 232
           +  TH    A Q+ DR + +  G I +
Sbjct: 201 LIATHNHDLASQM-DRQITIRDGMIAD 226

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 91.7 bits (226), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 113/228 (49%), Gaps = 8/228 (3%)

Query: 23  LNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLN 82
           L K Y + + ++ ++L V  GE V + GP+G+GK+T    +  +    +G I I+G    
Sbjct: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDG---- 86

Query: 83  DDIRNIHEVRRD-VGMVF--QHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNK 139
           +DI  +   RR  +G+ +  Q  ++F  L+V EN  L  + V +  KK   E     L +
Sbjct: 87  NDITKMPMYRRARLGISYLPQEASIFRGLTVEENI-LAVLEVYEKDKKKRHEKLDSLLKE 145

Query: 140 VKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELA 199
             I    H  + LLSGG+ +R  IARSL   P  +L DEP + +DP  + ++  ++ +LA
Sbjct: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205

Query: 200 EEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHER 247
             G+ ++   H +     + DR   +  G ++   + +E  +N    R
Sbjct: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 113/210 (53%), Gaps = 9/210 (4%)

Query: 39  NVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLN-DDIRNIHEVRRDVGM 97
           ++LRGE + + G SG+GKS L+R I  +    +GE+ + G  LN    +        +G+
Sbjct: 35  DILRGEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGV 94

Query: 98  VFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSL----L 153
           +FQH  LFS+++V EN ++ PI        D  E  +H   K+ I      +++L    L
Sbjct: 95  LFQHGALFSSMTVQENISM-PIKEHLNLPADLIEHIVH--TKIAIVGLPPETANLMPFQL 151

Query: 154 SGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEE-GMTMVCVTHEM 212
           SGG  +R ++AR+L + P ++  DEPTS LDP   +E   ++I+L    G+++  +TH++
Sbjct: 152 SGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITHDL 211

Query: 213 GFARQVADRVVFMDQGQIVEQNSPEEFFNN 242
                  +RV  + +  I+++ +  +  ++
Sbjct: 212 NNLISTCNRVAVIQKKGIMKEGTISDIVDS 241

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 76.6 bits (187), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 106/210 (50%), Gaps = 15/210 (7%)

Query: 32  ALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEV 91
            L  INL    G+   + GPSGSGKST+I  +  +    +G I I+GI + D       +
Sbjct: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDI--TFSSL 425

Query: 92  RRDVGMVFQHFNLFSNLSVLENCTLG-PIWVRKMPKKDAEELAMH-YLNKVKIADKSH-- 147
           R  +  V Q   LFSN +V  N  +G P+   +   + A+    H ++  +     ++  
Sbjct: 426 RERISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVG 484

Query: 148 RSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPE---MVKEVLDIMIELAEEGMT 204
            + S LSGG+ QR AIAR++     I++ DE TSALD     +V++ L  ++    +G T
Sbjct: 485 ENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLM----QGRT 540

Query: 205 MVCVTHEMGFARQVADRVVFMDQGQIVEQN 234
            + + H +    + AD ++F++ G++ E  
Sbjct: 541 TIVIAHRISTIIE-ADHIIFIEDGKVSESG 569

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 70.5 bits (171), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 103/225 (45%), Gaps = 33/225 (14%)

Query: 33  LRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNI--HE 90
            + I+  +   ++  + G SG GKST+ + +  +   + G I I+G     DI+ I    
Sbjct: 373 FKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDG----QDIKKITKES 428

Query: 91  VRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSS 150
           +R+ +G++ Q   LF++ ++  N   G       P    +EL       V++A       
Sbjct: 429 LRQTIGIIPQDTILFND-TLRYNILYGN------PNASDQELCA----AVEVAQLKSFIM 477

Query: 151 SL--------------LSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMI 196
            L              LSGGE QR +IAR++   P I++FDE TS+LD    + +   + 
Sbjct: 478 KLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALA 537

Query: 197 ELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFN 241
            L++   T+V + H +      AD ++  DQG +VE  S E   +
Sbjct: 538 TLSKNRTTLV-IAHRLSTITD-ADNIIVFDQGTVVESGSHENLIS 580

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 104/225 (46%), Gaps = 33/225 (14%)

Query: 30  FHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAG------EIIINGIPLND 83
           +  L+DIN  +   E V + GP+GSGKST+ + I  I K   G      ++I+  +P   
Sbjct: 23  YKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLIVGYVPQKV 82

Query: 84  DIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIA 143
            I N                    LS++   TL       MP   + +  +  L++V + 
Sbjct: 83  TIENTLP-----------------LSLMRFMTL------SMP--SSRDDVLQILDRVNLI 117

Query: 144 DKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEE-G 202
            K +R+   LSGGE QRA +A++L  +P +++ DEP   +D      + +++  + +  G
Sbjct: 118 GKYNRNIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTG 177

Query: 203 MTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHER 247
             ++ ++H +       D V+ ++  +I  Q  P+   +N ++ R
Sbjct: 178 CGILLISHNLHMVMASTDTVICLNN-RICYQGPPQTIKDNAEYIR 221

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 69.3 bits (168), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 115/249 (46%), Gaps = 15/249 (6%)

Query: 3   NTPINSKNPPKNNFAV----EIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKST 58
           ++PI+S+  P           + F+         L+++N  V  GE + + G SG+GK++
Sbjct: 272 SSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTS 331

Query: 59  LIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGP 118
           +   I       +G + I GI L   + ++ E+RR +  V QH  + +  SV +N  +G 
Sbjct: 332 IFSLILRFYDPCSGSVEIEGIDLR--LLSLEEIRRFIAWVPQHPIMIAA-SVYDNIAIGC 388

Query: 119 IWVRKMPKKDAEELAMHYLNKVKIADKSHRS-----SSLLSGGESQRAAIARSLCMQPKI 173
               +   ++A  LA  +   +   +  + +     +  LS G+ QR AIAR++     I
Sbjct: 389 PHATRKEIQNAAMLAQAH-EFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPI 447

Query: 174 MLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQ 233
           +L DE  SALD E  +++  ++ E    G T +  +H +  A Q AD V  +    IVE+
Sbjct: 448 LLLDEMGSALDIENEQKIWKVLRE-QRRGRTTIFASHRLS-AIQDADMVFVLHDQVIVEK 505

Query: 234 NSPEEFFNN 242
              EE    
Sbjct: 506 GVHEELLKK 514

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 61.2 bits (147), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 109/250 (43%), Gaps = 36/250 (14%)

Query: 17  AVEIKFLNKWYGN-FHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEI- 74
            +E+K ++  Y N + AL D+NL +       + G +G+GKSTL + I  +     G I 
Sbjct: 11  GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70

Query: 75  -------------IINGIPLNDDIRNIHEVR-RDVGMV--FQHFNLFSNLSVLENCTLGP 118
                        +I  IP  + I     +   DV M+  ++H N               
Sbjct: 71  IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMN--------------- 115

Query: 119 IWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDE 178
            W R++   +   +    L  V ++    R    LS G+ +R  +AR+L  + ++++ DE
Sbjct: 116 -W-RRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDE 173

Query: 179 PTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEE 238
           P +A+D +  +E++ ++  L  E + ++  TH +       DR +F+ +  ++      +
Sbjct: 174 PFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSD 232

Query: 239 FFNNPQHERT 248
            FN    ++T
Sbjct: 233 IFNEDNIQKT 242

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 60.5 bits (145), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 99/208 (47%), Gaps = 20/208 (9%)

Query: 16  FAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEII 75
             +E   + K Y +   ++D +L +  GE + I GP+G+GK+TL++ +    K   G I 
Sbjct: 283 LVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT 342

Query: 76  INGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMH 135
           +     N  I  I + R D+       +L S L+     +L       M + ++  +A +
Sbjct: 343 LGT---NLKIATIDQKREDID---PDKSLASYLTGSSGDSL-------MVRGESRHVAGY 389

Query: 136 YLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIM 195
             + +   D++H     LSGGE  RA +AR L      ++ DEPT+ LD E +  +   +
Sbjct: 390 IKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTI 449

Query: 196 IELAEEGMTMVCVTHEMGFARQVADRVV 223
            +L  +G T++ V+H+  F     DR V
Sbjct: 450 TQL--QG-TILIVSHDRDF----LDRTV 470

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 53.9 bits (128), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 97/203 (47%), Gaps = 27/203 (13%)

Query: 28  GNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRN 87
           G    L+D+ L++   ER+ + G +GSGKSTL++    I + Q+G + +           
Sbjct: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL----------- 64

Query: 88  IHEVRRDVGMVFQHFNL--FSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADK 145
            H   R +G + Q+ +L  FS +S   + T+           +A       L K  + ++
Sbjct: 65  -HSSSR-LGYLEQNPDLSHFSTISQYIDDTIKDTI-------EAPYSPYSLLKKFNLREQ 115

Query: 146 SHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTM 205
               +  LS G+++  A+ + L  +P I++ DEPT+ LD    + +  +  EL +    +
Sbjct: 116 DRIEN--LSVGQTRCVALMKMLISRPDILILDEPTNHLD---FRTIHWMEQELLKINSAL 170

Query: 206 VCVTHEMGFARQVADRVVFMDQG 228
           + V+H+  F   ++   V++D+G
Sbjct: 171 IFVSHDRRFLETLSTTTVWLDRG 193

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 50.8 bits (120), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 108/244 (44%), Gaps = 48/244 (19%)

Query: 16  FAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEI- 74
           F   +  L+K +G+   L DINL+     ++ I GP+G+GKST++R +  I+K   GE  
Sbjct: 5   FIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAW 64

Query: 75  IINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAM 134
           +  G                VG + Q   L  + +V EN   G    + +  +   EL M
Sbjct: 65  LATGFT--------------VGYLPQEPQLDLSKTVKENIIEGVAHKQAILDR-YNELMM 109

Query: 135 HYLNK-----------------------VKIADKSHRSS------SLLSGGESQRAAIAR 165
           +Y  K                       V++A +S          + LSGGE +R A+ +
Sbjct: 110 NYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCK 169

Query: 166 SLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFM 225
            L   P ++L DEPT+ LD E +  +   + E +     ++ VTH+  F   V + ++ +
Sbjct: 170 LLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYS---GAVLMVTHDRYFLDNVTNWILEV 226

Query: 226 DQGQ 229
           D+G+
Sbjct: 227 DRGK 230

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 49.3 bits (116), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 102/240 (42%), Gaps = 29/240 (12%)

Query: 18  VEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIIN 77
           +E K ++K Y +   + +++  +  G  V + GP+G+GK+TL R +   E   +G I + 
Sbjct: 318 IEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVG 377

Query: 78  G---IPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAM 134
               +   D  R+  E  +               +V E+ + G   V K+   +    A 
Sbjct: 378 ETVCLSYVDQSRDSLEAEK---------------TVWEDISGGDDIV-KLNGHEINSRAY 421

Query: 135 HYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDI 194
                 K  D+  R  SL SGG+  R  +A+ L     ++L DEPT+ LD E +  + D 
Sbjct: 422 CSAFNFKGGDQQQRIGSL-SGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDA 480

Query: 195 MIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQ 254
           +   A      V ++H+  F  ++A  ++        E N   E+F     E  +  LS+
Sbjct: 481 LENFA---GCAVIISHDRMFLDRLATHILAF------EGNGHVEWFEGNFEEYEKDKLSR 531

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 49.3 bits (116), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 5/180 (2%)

Query: 34  RDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRR 93
           ++++  +  G   IIAGPSG GKS  + C+  +   + G I      ++ D   I +   
Sbjct: 349 QNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDF--IEKFSA 406

Query: 94  DVGMVFQHFNLFSNLSVLENCTLGPIW-VRKMPKKDAEELAMHY-LNKVKIADKSHRSSS 151
            +G + QH +LF  +S+ EN  L        + +K A+ +  H  +  +K   ++   S 
Sbjct: 407 QIGYLSQHCSLFP-ISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSD 465

Query: 152 LLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHE 211
            +     Q+  ++R +   P I+L DEP   LD E       ++ +  E   T+V ++H+
Sbjct: 466 EIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHD 525

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 46.2 bits (108), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 148 RSSSLLSGGESQRAAIARSLCMQPK---IMLFDEPTSALDPEMVKEVLDIMIELAEEGMT 204
           +S++ LSGGESQR  +A+ L  Q     + + DEPT+ L    + ++L+I+  L + G +
Sbjct: 841 QSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNS 900

Query: 205 MVCVTHEM 212
           ++ + H +
Sbjct: 901 IIVIEHNL 908

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 41.2 bits (95), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 148 RSSSLLSGGESQRAAIARSL--CMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTM 205
           R+S++LS GESQR  +A  +   +   + + DEP+  L      ++++ +  L + G T+
Sbjct: 499 RNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTV 558

Query: 206 VCVTHE---MGFARQVAD--RVVFMDQGQIVEQNSPEEFFNNP 243
           + V H+   M  A  + D      ++ G+IV + SP +   +P
Sbjct: 559 IVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHP 601

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 97/212 (45%), Gaps = 14/212 (6%)

Query: 33  LRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQ--AGEIIINGIPLNDDIRNIHE 90
           +R +NL V   E V I GP+GSGKSTL   ++  + ++  AG+I+  G  +  D   +  
Sbjct: 19  IRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESIL-DWSIVER 77

Query: 91  VRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKV-KIA------ 143
             + + + FQ+      + +++   +     RK  + + E L   +  KV KI       
Sbjct: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRK-ARNEKELLIPDFTRKVRKITAELGIN 136

Query: 144 -DKSHRSSSL-LSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEE 201
            D   R  +L  SGGE + A I +   ++P + + DE  S LD + +K     +  L  +
Sbjct: 137 MDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQ 196

Query: 202 GMTMVCVTHEMGFARQVA-DRVVFMDQGQIVE 232
             + + +TH       +  D +  +  G+I++
Sbjct: 197 DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIK 228

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target257 ABC transporter related protein [Candidatus Liberibacte
315122676256 ABC transporter related protein [Candidatus Liberibacte 1 1e-131
150378348258 ABC transporter related [Sinorhizobium medicae WSM419] 1 1e-110
15888897257 ABC transporter, nucleotide binding/ATPase protein (ami 1 1e-110
227821877258 putative ATP-binding component of a transport system [S 1 1e-109
306846382263 Glutamate/glutamine/aspartate/asparagine transport ATP- 1 1e-109
325292973257 general L-amino acid transport ATP-binding protein AapP 1 1e-109
306843691269 Glutamate/glutamine/aspartate/asparagine transport ATP- 1 1e-109
254713864271 Glutamate/glutamine/aspartate/asparagine transport ATP- 1 1e-109
254717079269 Glutamate/glutamine/aspartate/asparagine transport ATP- 1 1e-108
118589037267 general L-amino acid ABC transporter, ATP-binding prote 1 1e-108
>gi|315122676|ref|YP_004063165.1| ABC transporter related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 256 Back     alignment and organism information
 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/256 (85%), Positives = 242/256 (94%)

Query: 1   MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLI 60
           MKN+ +NSK+  KNN  ++IK LNKWYG+FHALRDINLNV+RGERVIIAGPSGSGKSTLI
Sbjct: 1   MKNSSVNSKDSKKNNIIIQIKLLNKWYGHFHALRDINLNVVRGERVIIAGPSGSGKSTLI 60

Query: 61  RCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIW 120
           RCINHIEKHQ GEIII+GIPLN D+RNI EVRRD+GMVFQHFNLF NLS+L+NCTLGPIW
Sbjct: 61  RCINHIEKHQEGEIIIDGIPLNSDVRNIDEVRRDIGMVFQHFNLFPNLSILDNCTLGPIW 120

Query: 121 VRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPT 180
           VRKMPKK+AEELAMHYL KVKIADK+ RSS LLSGGE+QRAAIARSLCM+PK+MLFDEPT
Sbjct: 121 VRKMPKKEAEELAMHYLEKVKIADKAQRSSLLLSGGENQRAAIARSLCMKPKVMLFDEPT 180

Query: 181 SALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFF 240
           SALDPEMVKEVLD MIELAEEGMTM+CVTHEMGFARQVA+R+VFMDQGQIVEQN+PEEFF
Sbjct: 181 SALDPEMVKEVLDTMIELAEEGMTMICVTHEMGFARQVANRIVFMDQGQIVEQNNPEEFF 240

Query: 241 NNPQHERTQAFLSQII 256
           NNPQHERT+AFLSQII
Sbjct: 241 NNPQHERTKAFLSQII 256


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150378348|ref|YP_001314942.1| ABC transporter related [Sinorhizobium medicae WSM419] Length = 258 Back     alignment and organism information
>gi|15888897|ref|NP_354578.1| ABC transporter, nucleotide binding/ATPase protein (amino acid) [Agrobacterium tumefaciens str. C58] Length = 257 Back     alignment and organism information
>gi|227821877|ref|YP_002825847.1| putative ATP-binding component of a transport system [Sinorhizobium fredii NGR234] Length = 258 Back     alignment and organism information
>gi|306846382|ref|ZP_07478929.1| Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein bztD [Brucella sp. BO1] Length = 263 Back     alignment and organism information
>gi|325292973|ref|YP_004278837.1| general L-amino acid transport ATP-binding protein AapP [Agrobacterium sp. H13-3] Length = 257 Back     alignment and organism information
>gi|306843691|ref|ZP_07476291.1| Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein bztD [Brucella sp. BO1] Length = 269 Back     alignment and organism information
>gi|254713864|ref|ZP_05175675.1| Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein bztD [Brucella ceti M644/93/1] Length = 271 Back     alignment and organism information
>gi|254717079|ref|ZP_05178890.1| Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein bztD [Brucella ceti M13/05/1] Length = 269 Back     alignment and organism information
>gi|118589037|ref|ZP_01546444.1| general L-amino acid ABC transporter, ATP-binding protein [Stappia aggregata IAM 12614] Length = 267 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target257 ABC transporter related protein [Candidatus Liberibacte
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 3e-99
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 2e-82
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 6e-75
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 9e-73
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 3e-72
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 5e-66
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 1e-64
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 3e-64
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 2e-62
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 1e-60
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 1e-59
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 4e-59
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 2e-56
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 8e-56
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 1e-55
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 3e-55
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 2e-54
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 2e-53
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 7e-52
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 2e-51
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 2e-51
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 2e-51
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 3e-51
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 4e-51
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 8e-51
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 4e-50
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 5e-49
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 2e-48
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 3e-48
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 7e-48
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 2e-47
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 9e-47
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 1e-46
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 1e-46
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 3e-46
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 4e-46
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 6e-46
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 6e-46
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 6e-46
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 1e-45
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 2e-45
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 2e-45
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 2e-45
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 3e-45
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 5e-45
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 6e-45
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 7e-45
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 8e-45
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 2e-44
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 5e-44
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 1e-43
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 2e-43
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 3e-43
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 7e-43
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 9e-43
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 1e-42
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 1e-42
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 6e-42
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 9e-42
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 2e-41
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 3e-41
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 4e-41
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 4e-41
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 4e-41
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 5e-41
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 7e-41
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 8e-41
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 8e-41
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 3e-40
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 4e-40
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 4e-40
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 5e-40
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 7e-40
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 8e-40
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 9e-40
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 1e-39
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 2e-39
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 5e-39
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 7e-39
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 1e-38
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 1e-38
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 2e-38
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-38
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 2e-38
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 2e-38
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transporter A 3e-38
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 3e-38
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 4e-38
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 4e-38
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 6e-38
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 6e-38
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-37
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 2e-37
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 2e-37
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 3e-37
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 3e-37
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 4e-37
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 4e-37
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 4e-37
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 4e-37
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 8e-37
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 9e-37
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 1e-36
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 2e-36
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 2e-36
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 3e-36
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 3e-36
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 5e-36
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 6e-36
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 7e-36
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding subu 2e-35
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 2e-35
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 3e-35
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 4e-35
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 4e-35
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 4e-35
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 5e-35
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 6e-35
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 6e-35
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 7e-35
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transporter 8e-35
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 1e-34
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 1e-34
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 2e-34
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 2e-34
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 3e-34
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 5e-34
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 5e-34
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 1e-33
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 1e-33
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 1e-33
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 1e-33
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 1e-33
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 2e-33
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 5e-33
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 5e-33
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 5e-33
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 5e-33
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 5e-33
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 8e-33
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 1e-32
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 1e-32
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 2e-32
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 2e-32
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 2e-32
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 2e-32
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 2e-32
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 2e-32
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 2e-32
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 3e-32
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 9e-32
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 9e-32
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 1e-31
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 1e-31
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 1e-31
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 2e-31
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 2e-31
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 2e-31
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 3e-31
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 4e-31
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 5e-31
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 1e-30
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 1e-30
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 2e-30
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 3e-30
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 3e-30
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 3e-30
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 6e-30
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 7e-30
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 7e-30
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 7e-30
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 1e-29
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 1e-29
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 2e-29
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 3e-29
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 3e-29
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 3e-29
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 6e-29
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 7e-29
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 7e-29
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 7e-29
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 8e-29
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 9e-29
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 9e-29
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 1e-28
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 1e-28
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 1e-28
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 2e-28
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 3e-28
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 4e-28
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 5e-28
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 5e-28
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 6e-28
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 6e-28
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 1e-27
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 2e-27
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 2e-27
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 3e-27
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 3e-27
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 3e-27
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 5e-27
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 7e-27
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 7e-27
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 8e-27
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 8e-27
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 1e-26
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 1e-26
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 1e-26
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 2e-26
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 2e-26
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 5e-26
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 5e-26
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 6e-26
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 6e-26
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 9e-26
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 1e-25
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 1e-25
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding prote 1e-25
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 2e-25
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 2e-25
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 2e-25
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 4e-25
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 5e-25
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 5e-25
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 7e-25
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 1e-24
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 1e-24
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 1e-24
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 1e-24
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 1e-24
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 2e-24
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 2e-24
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 2e-24
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 2e-24
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-binding 3e-24
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 3e-24
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 5e-24
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 8e-24
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 9e-24
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 1e-23
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 2e-23
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 3e-23
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 4e-23
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 4e-23
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 6e-23
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 7e-23
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 9e-23
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 2e-22
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 2e-22
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 3e-22
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 3e-22
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 5e-22
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 6e-22
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 7e-22
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 7e-22
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 9e-22
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 1e-21
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 1e-21
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 1e-21
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 2e-21
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 4e-21
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 4e-21
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 1e-20
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 1e-20
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 2e-20
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 2e-20
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 2e-20
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 3e-20
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 3e-20
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 5e-20
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 5e-20
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 7e-20
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 8e-20
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 1e-19
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 2e-19
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 2e-19
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 2e-19
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 3e-19
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 4e-19
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 6e-19
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 1e-18
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 4e-18
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 7e-18
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 8e-18
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 8e-18
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 8e-18
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 1e-17
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 2e-17
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 2e-17
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 3e-17
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 5e-17
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 5e-17
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 1e-16
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 1e-16
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 1e-16
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 1e-16
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 1e-16
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 5e-16
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 5e-16
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 6e-16
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 7e-16
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-15
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 5e-15
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 6e-15
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 6e-15
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 6e-15
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 8e-15
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 9e-15
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 1e-14
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 1e-14
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 3e-14
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 3e-14
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 1e-13
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 2e-13
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 2e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 2e-13
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 3e-13
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 3e-13
cd03271261 cd03271, ABC_UvrA_II, The excision repair protein UvrA 4e-13
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 4e-13
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 5e-13
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 1e-12
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 3e-12
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 4e-12
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 6e-12
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 7e-12
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 7e-12
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 9e-12
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 1e-11
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 2e-11
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 2e-11
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 2e-11
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 7e-11
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 8e-11
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 9e-11
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 1e-10
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 3e-10
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 6e-10
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 6e-10
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 1e-09
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 1e-09
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 2e-09
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 2e-09
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-09
cd03288257 cd03288, ABCC_SUR2, The SUR domain 2 3e-09
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 5e-09
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 7e-09
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 7e-09
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 1e-08
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 2e-08
smart00382148 smart00382, AAA, ATPases associated with a variety of c 2e-08
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 4e-08
PRK13546264 PRK13546, PRK13546, teichoic acids export protein ATP-b 4e-08
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 6e-08
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 7e-08
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 7e-08
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 8e-08
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 8e-08
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 1e-07
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 2e-07
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase component; 8e-07
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 1e-06
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 1e-06
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 2e-06
KOG0066 807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 4e-06
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 7e-06
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 1e-05
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 4e-05
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 4e-05
COG3044 554 COG3044, COG3044, Predicted ATPase of the ABC class [Ge 6e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 7e-05
COG3910233 COG3910, COG3910, Predicted ATPase [General function pr 1e-04
cd03279213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 2e-04
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 4e-04
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 1e-108
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 5e-28
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 8e-17
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 3e-10
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 2e-06
pfam00005119 pfam00005, ABC_tran, ABC transporter 1e-25
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 3e-10
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 3e-09
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 1e-10
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 2e-10
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 3e-09
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase component; R 7e-09
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 2e-08
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 1e-06
TIGR00630 924 TIGR00630, uvra, excinuclease ABC, A subunit 3e-06
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Provision 7e-06
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-05
pfam09818447 pfam09818, ABC_ATPase, Predicted ATPase of the ABC clas 2e-04
PRK00349943 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed 4e-04
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 5e-04
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 8e-04
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 9e-08
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 3e-04
TIGR00630 924 TIGR00630, uvra, excinuclease ABC, A subunit 4e-04
TIGR01420343 TIGR01420, pilT_fam, pilus retraction protein PilT 4e-04
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 7e-04
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 8e-04
cd01131198 cd01131, PilT, Pilus retraction ATPase PilT 0.001
COG2805353 COG2805, PilT, Tfp pilus assembly protein, pilus retrac 0.001
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.002
PRK00349 943 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed 0.002
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 6e-07
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 7e-06
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport ATP-b 4e-05
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 2e-04
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family member; Pr 2e-04
TIGR006181042 TIGR00618, sbcc, exonuclease SbcC 0.003
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 2e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 2e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 3e-04
>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184581 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184583 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|130034 TIGR00960, 3a0501s02, Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|184589 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>gnl|CDD|184592 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172763 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184595 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>gnl|CDD|139715 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163250 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|172753 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183084 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184193 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184201 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters Back     alignment and domain information
>gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132456 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|162807 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183258 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>gnl|CDD|163051 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information