254780181

254780181

phosphopantetheine adenylyltransferase

GeneID in NCBI database:8209161Locus tag:CLIBASIA_00320
Protein GI in NCBI database:254780181Protein Accession:YP_003064594.1
Gene range:-(61578, 62126)Protein Length:182aa
Gene description:phosphopantetheine adenylyltransferase
COG prediction:[H] Phosphopantetheine adenylyltransferase
KEGG prediction:coaD; phosphopantetheine adenylyltransferase (EC:2.7.7.3); K00954 pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
SEED prediction:Phosphopantetheine adenylyltransferase (EC 2.7.7.3)
Pathway involved in KEGG:Pantothenate and CoA biosynthesis [PATH:las00770]
Subsystem involved in SEED:Coenzyme A Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIFS
ccEEEEEccccccccHHHHHHHHHHHHHccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHccccEEEEccccccHHHHHHHHHHHcHHHcccccEEEEccccccccccHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHccccEEEccHHccc
cccEEEEccccccccccHHHHHHHHHHHHcEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHccccHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHcccccEcccccccc
mmrkavytgsfdpitngHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFhfipdssnrvsvISFEGLAVNLAKDISAQVIVRGLRdmtdfdyemrmtsvnrclcpeIATIALFAKESSRYVTSTLIRHLISidaditsfvpdpvcVFLKNIVISLVKydsiklfpntifs
MMRKAVYTgsfdpitnGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVnlakdisaqvIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISlvkydsiklfpntifs
MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIFS
*MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI************FPNTI**
MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIFS
*MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIF*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIFS
MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIFS
MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTIFS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target182 phosphopantetheine adenylyltransferase [Candidatus Libe
254780649216 nicotinic acid mononucleotide adenylyltransferase 0.025
>gi|254780649|ref|YP_003065062.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Back     alignment
 Score = 30.0 bits (66), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 2  MRKAVYTGSFDPITNGHMD---IIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQ 58
          M+  ++ G+F+P  +GH++   I I+ L+  +   I    NSVK     S  E+   + Q
Sbjct: 20 MKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQ 79

Query: 59 SIFHFIPDSSNRVSVISFEG 78
          S+       + R+ + +FE 
Sbjct: 80 SLI-----KNPRIRITAFEA 94

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target182 phosphopantetheine adenylyltransferase [Candidatus Libe
315122779165 phosphopantetheine adenylyltransferase [Candidatus Libe 1 2e-72
116252155164 phosphopantetheine adenylyltransferase [Rhizobium legum 1 3e-35
86357732164 phosphopantetheine adenylyltransferase [Rhizobium etli 1 7e-35
222148796164 phosphopantetheine adenylyltransferase [Agrobacterium v 1 7e-35
327193333164 phosphopantetheine adenylyltransferase protein [Rhizobi 1 9e-35
209549344164 phosphopantetheine adenylyltransferase [Rhizobium legum 1 1e-34
190891759164 phosphopantetheine adenylyltransferase protein [Rhizobi 1 2e-34
328543839168 Phosphopantetheine adenylyltransferase [Polymorphum gil 1 3e-34
15965335163 phosphopantetheine adenylyltransferase [Sinorhizobium m 1 4e-34
222085991167 pantetheine-phosphate adenylyltransferase [Agrobacteriu 1 4e-34
>gi|315122779|ref|YP_004063268.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 165 Back     alignment and organism information
 Score =  275 bits (703), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+RKAVYTGSF+PITNGH+DI+IQ+LSFVE++V++IGCN VK   FLSIQERSEL+ +S+
Sbjct: 1   MLRKAVYTGSFNPITNGHIDILIQSLSFVEEVVVSIGCNPVKQDDFLSIQERSELVMKSV 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              IP S NRVSVISFEGLAVNLAKD+SAQVI+RGLRDMTDFDYEMRMTSVNR LCPEI 
Sbjct: 61  ADVIPGSINRVSVISFEGLAVNLAKDLSAQVIIRGLRDMTDFDYEMRMTSVNRRLCPEIV 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           TIALFAKESSRYVTSTLIRHL+SI +DITSFVPDPVCVFLK 
Sbjct: 121 TIALFAKESSRYVTSTLIRHLVSIGSDITSFVPDPVCVFLKE 162


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116252155|ref|YP_767993.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 164 Back     alignment and organism information
>gi|86357732|ref|YP_469624.1| phosphopantetheine adenylyltransferase [Rhizobium etli CFN 42] Length = 164 Back     alignment and organism information
>gi|222148796|ref|YP_002549753.1| phosphopantetheine adenylyltransferase [Agrobacterium vitis S4] Length = 164 Back     alignment and organism information
>gi|327193333|gb|EGE60237.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CNPAF512] Length = 164 Back     alignment and organism information
>gi|209549344|ref|YP_002281261.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 164 Back     alignment and organism information
>gi|190891759|ref|YP_001978301.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CIAT 652] Length = 164 Back     alignment and organism information
>gi|328543839|ref|YP_004303948.1| Phosphopantetheine adenylyltransferase [Polymorphum gilvum SL003B-26A1] Length = 168 Back     alignment and organism information
>gi|15965335|ref|NP_385688.1| phosphopantetheine adenylyltransferase [Sinorhizobium meliloti 1021] Length = 163 Back     alignment and organism information
>gi|222085991|ref|YP_002544523.1| pantetheine-phosphate adenylyltransferase [Agrobacterium radiobacter K84] Length = 167 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target182 phosphopantetheine adenylyltransferase [Candidatus Libe
PRK00168159 PRK00168, coaD, phosphopantetheine adenylyltransferase; 2e-49
COG0669159 COG0669, CoaD, Phosphopantetheine adenylyltransferase [ 3e-43
TIGR01510155 TIGR01510, coaD_prev_kdtB, pantetheine-phosphate adenyl 7e-38
PRK13964140 PRK13964, coaD, phosphopantetheine adenylyltransferase; 3e-18
COG1057197 COG1057, NadD, Nicotinic acid mononucleotide adenylyltr 1e-05
cd02165192 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide 4e-04
TIGR01527165 TIGR01527, arch_NMN_Atrans, nicotinamide-nucleotide ade 0.001
cd02163153 cd02163, PPAT, Phosphopantetheine adenylyltransferase 5e-45
pfam01467148 pfam01467, CTP_transf_2, Cytidylyltransferase 2e-11
cd02039143 cd02039, cytidylyltransferase_like, Cytidylyltransferas 1e-05
COG1659267 COG1659, COG1659, Uncharacterized protein, linocin/CFP2 0.003
PRK05379 340 PRK05379, PRK05379, bifunctional nicotinamide mononucle 0.003
TIGR0012566 TIGR00125, cyt_tran_rel, cytidyltransferase-related dom 2e-07
PRK00071203 PRK00071, nadD, nicotinic acid mononucleotide adenylylt 4e-04
cd02168181 cd02168, NMNAT_Nudix, Nicotinamide/nicotinate mononucle 0.002
PRK01153174 PRK01153, PRK01153, nicotinamide-nucleotide adenylyltra 0.002
cd02156105 cd02156, nt_trans, nucleotidyl transferase superfamily 0.004
>gnl|CDD|178911 PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31013 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162396 TIGR01510, coaD_prev_kdtB, pantetheine-phosphate adenylyltransferase, bacterial Back     alignment and domain information
>gnl|CDD|184424 PRK13964, coaD, phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31257 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information
>gnl|CDD|162401 TIGR01527, arch_NMN_Atrans, nicotinamide-nucleotide adenylyltransferase Back     alignment and domain information
>gnl|CDD|173914 cd02163, PPAT, Phosphopantetheine adenylyltransferase Back     alignment and domain information
>gnl|CDD|144891 pfam01467, CTP_transf_2, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain Back     alignment and domain information
>gnl|CDD|31845 COG1659, COG1659, Uncharacterized protein, linocin/CFP29 homolog [Function unknown] Back     alignment and domain information
>gnl|CDD|180046 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|161722 TIGR00125, cyt_tran_rel, cytidyltransferase-related domain Back     alignment and domain information
>gnl|CDD|178839 PRK00071, nadD, nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|173919 cd02168, NMNAT_Nudix, Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain Back     alignment and domain information
>gnl|CDD|179235 PRK01153, PRK01153, nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|173912 cd02156, nt_trans, nucleotidyl transferase superfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 182 phosphopantetheine adenylyltransferase [Candidatus Libe
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provisiona 100.0
TIGR01510163 coaD_prev_kdtB pantetheine-phosphate adenylyltransferas 100.0
cd02163152 PPAT_a Phosphopantetheine adenylyltransferase (PPAT) is 100.0
PRK08887173 nicotinic acid mononucleotide adenylyltransferase; Prov 100.0
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenzyme m 100.0
PRK00071200 nadD nicotinic acid mononucleotide adenylyltransferase; 100.0
COG1057197 NadD Nicotinic acid mononucleotide adenylyltransferase 99.98
PRK07152 343 nadD putative nicotinate-nucleotide adenylyltransferase 99.97
cd02165194 NMNAT This family contains the predominant bacterial/eu 99.97
TIGR00482229 TIGR00482 nicotinate (nicotinamide) nucleotide adenylyl 99.96
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provisiona 99.96
PRK01153170 nicotinamide-nucleotide adenylyltransferase; Provisiona 99.95
cd02166163 NMNAT_Archaea This family of archaeal proteins exhibits 99.93
TIGR01527171 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 99.92
pfam01467148 CTP_transf_2 Cytidylyltransferase. This family includes 99.85
cd02168179 NMNAT_Nudix This domain represents the N-terminal NMNAT 99.83
PRK13793188 nicotinamide-nucleotide adenylyltransferase; Provisiona 99.8
COG1056172 NadR Nicotinamide mononucleotide adenylyltransferase [C 99.71
PRK05379 340 bifunctional nicotinamide mononucleotide adenylyltransf 99.67
cd02039141 cytidylyltransferase_like Cytidylyltransferase-like dom 99.66
cd02171129 G3P_Cytidylyltransferase These sequences describe glyce 99.45
PRK08099 411 nicotinamide-nucleotide adenylyltransferase; Provisiona 99.45
PRK00777155 phosphopantetheine adenylyltransferase; Provisional 99.38
TIGR01526 346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 99.38
PRK01170 328 phosphopantetheine adenylyltransferase/unknown domain f 99.37
cd02172143 RfaE_N RfaE is a protein involved in the biosynthesis o 99.27
KOG3199234 consensus 99.22
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal domain. 99.15
pfam08218182 Citrate_ly_lig Citrate lyase ligase C-terminal domain. 99.12
cd02170136 cytidylyltransferase The cytidylyltransferase family in 99.1
cd02164142 PPAT_CoAS The PPAT domain of the bifunctional enzyme wi 99.03
cd02169296 Citrate_lyase_ligase Citrate lyase ligase, also known a 98.97
COG3053352 CitC Citrate lyase synthetase [Energy production and co 98.85
COG1019158 Predicted nucleotidyltransferase [General function pred 98.8
cd02174150 CCT CTP:phosphocholine cytidylyltransferase (CCT) catal 98.71
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) 98.71
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesis, ou 98.63
PRK07143277 hypothetical protein; Provisional 98.45
cd02064179 Flavokinase_C Riboflavin kinase (Flavokinase). This fam 98.4
PRK04149390 sat sulfate adenylyltransferase; Reviewed 98.3
cd00517356 ATPS ATP-sulfurylase (ATPS), also known as sulfate aden 98.25
pfam01747310 ATP-sulfurylase ATP-sulfurylase. This family consists o 98.22
KOG3351293 consensus 98.21
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1-phosp 98.14
TIGR01518126 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransfera 98.08
PRK05627303 bifunctional riboflavin kinase/FMN adenylyltransferase; 98.02
COG0196304 RibF FAD synthase [Coenzyme metabolism] 97.98
COG2046397 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Ino 97.97
TIGR00083296 ribF riboflavin biosynthesis protein RibF; InterPro: IP 97.85
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1/aden 97.71
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II; Inter 97.59
PTZ00308353 ethanolamine-phosphate cytidylytransferase; Provisional 97.24
TIGR00124342 cit_ly_ligase [citrate (pro-3S)-lyase] ligase; InterPro 96.61
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kinase/ad 95.29
PRK06973196 nicotinic acid mononucleotide adenylyltransferase; Prov 99.72
cd02167157 NMNAT_NadR The NMNAT domain of NadR protein. The NadR p 99.56
TIGR0012563 cyt_tran_rel cytidyltransferase-related domain; InterPr 98.97
PRK13670 390 hypothetical protein; Provisional 98.38
pfam05636 389 DUF795 Protein of unknown function (DUF795). This famil 98.27
PRK13671 298 hypothetical protein; Provisional 98.13
COG1323 358 Predicted nucleotidyltransferase [General function pred 98.05
PTZ00308 353 ethanolamine-phosphate cytidylytransferase; Provisional 97.57
KOG2803 358 consensus 97.06
KOG2803358 consensus 96.6
cd02158183 PanC_ATPS PanC_ATPS Pantothenate synthetase (PanC) and 96.55
pfam06574158 FAD_syn FAD synthetase. This family corresponds to the 95.72
TIGR00339424 sopT sulfate adenylyltransferase; InterPro: IPR002650 T 94.64
PRK00380283 panC pantoate--beta-alanine ligase; Reviewed 94.25
cd00560276 PanC PanC Pantoate-beta-alanine ligase, also known as p 94.06
pfam02569280 Pantoate_ligase Pantoate-beta-alanine ligase. Pantoate- 93.59
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Provisi 92.9
KOG2804348 consensus 92.86
TIGR00018310 panC pantoate--beta-alanine ligase; InterPro: IPR003721 90.1
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 98.79
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase; InterPro: IPR001980 Temperature-sensitive mutants of Escherichia coli, defective in the transfer of 3-deoxy-D-manno-octulosonic acid (KDO) from CMP-KDO to a tetraacyldisaccharide 1,4'-bisphosphate precursor of lipid A, have been used to map KDO transferase activity on the E Back     alignment and domain information
>cd02163 PPAT_a Phosphopantetheine adenylyltransferase (PPAT) is an essential enzyme in bacteria that catalyses a rate-limiting step in coenzyme A (CoA) biosynthesis, by transferring an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>cd02165 NMNAT This family contains the predominant bacterial/eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide Back     alignment and domain information
>TIGR00482 TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase; InterPro: IPR005248 This family contains the predominant bacterial/eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02166 NMNAT_Archaea This family of archaeal proteins exhibits nicotinamide-nucleotide adenylyltransferase (NMNAT) activity utilizing the salvage pathway to synthesize NAD Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006418 This family of archaeal proteins exhibits NAD salvage biosynthesis enzyme nicotinamide-nucleotide adenylyltransferase (2 Back     alignment and domain information
>pfam01467 CTP_transf_2 Cytidylyltransferase Back     alignment and domain information
>cd02168 NMNAT_Nudix This domain represents the N-terminal NMNAT (Nicotinamide/nicotinate mononucleotide adenylyltransferase) domain of a novel bifunctional enzyme endowed with NMN adenylyltransferase and #Nudix' hydrolase activities Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase These sequences describe glycerol-3-phosphate cytidylyltransferase, also called CDP-glycerol pyrophosphorylase Back     alignment and domain information
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006417 The NadR protein of Escherichia coli and closely related bacteria is both enzyme and regulatory protein Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd02172 RfaE_N RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis Back     alignment and domain information
>KOG3199 consensus Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>pfam08218 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>cd02170 cytidylyltransferase The cytidylyltransferase family includes cholinephosphate cytidylyltransferase (CCT), glycerol-3-phosphate cytidylyltransferase, RafE and phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>cd02164 PPAT_CoAS The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase (CCT) catalyzes the condensation of CTP and phosphocholine to form CDP-choline as the rate-limiting and regulatory step in the CDP-choline pathway Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) catalyzes the conversion of phosphoethanolamine to CDP-ethanolamine as part of the CDP#ethanolamine biosynthesis pathway Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>cd02064 Flavokinase_C Riboflavin kinase (Flavokinase) Back     alignment and domain information
>PRK04149 sat sulfate adenylyltransferase; Reviewed Back     alignment and domain information
>cd00517 ATPS ATP-sulfurylase (ATPS), also known as sulfate adenylate transferase, catalyzes the transfer of an adenylyl group from ATP to sulfate, forming adenosine 5'-phosphosulfate (APS) Back     alignment and domain information
>pfam01747 ATP-sulfurylase ATP-sulfurylase Back     alignment and domain information
>KOG3351 consensus Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase; InterPro: IPR006409 These sequences describe glycerol-3-phosphate cytidyltransferase, also called CDP-glycerol pyrophosphorylase Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00083 ribF riboflavin biosynthesis protein RibF; InterPro: IPR002606 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II; InterPro: IPR011914 RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylytransferase; Provisional Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase; InterPro: IPR005216 [Citrate (pro-3S)-lyase] ligase (6 Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02167 NMNAT_NadR The NMNAT domain of NadR protein Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain; InterPro: IPR004821 Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>pfam05636 DUF795 Protein of unknown function (DUF795) Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylytransferase; Provisional Back     alignment and domain information
>KOG2803 consensus Back     alignment and domain information
>KOG2803 consensus Back     alignment and domain information
>cd02158 PanC_ATPS PanC_ATPS Pantothenate synthetase (PanC) and ATP-sulfurylase (ATPS) share a similar dinucleotide-binding domain Back     alignment and domain information
>pfam06574 FAD_syn FAD synthetase Back     alignment and domain information
>TIGR00339 sopT sulfate adenylyltransferase; InterPro: IPR002650 This entry consists of ATP-sulphurylase or sulphate adenylyltransferase (2 Back     alignment and domain information
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed Back     alignment and domain information
>cd00560 PanC PanC Pantoate-beta-alanine ligase, also known as pantothenate synthase, catalyzes the formation of pantothenate from pantoate and alanine Back     alignment and domain information
>pfam02569 Pantoate_ligase Pantoate-beta-alanine ligase Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>KOG2804 consensus Back     alignment and domain information
>TIGR00018 panC pantoate--beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target182 phosphopantetheine adenylyltransferase [Candidatus Libe
1b6t_A159 Phosphopantetheine Adenylyltransferase In Complex W 2e-39
1qjc_A158 Phosphopantetheine Adenylyltransferase In Complex W 1e-38
1vlh_A173 Crystal Structure Of Phosphopantetheine Adenylyltra 2e-38
3k9w_A170 Crystal Structure Of Phosphopantetheine Adenylyltra 3e-38
1od6_A160 The Crystal Structure Of Phosphopantetheine Adenyly 5e-38
3l92_A162 Phosphopantetheine Adenylyltransferase From Yersini 1e-37
1o6b_A169 Crystal Structure Of Phosphopantetheine Adenylyltra 8e-35
3nba_A177 Phosphopantetheine Adenylyltranferase From Mycobact 7e-34
3f3m_A168 Six Crystal Structures Of Two Phosphopantetheine Ad 7e-34
1tfu_A157 Phosphopantetheine Adenylyltransferase From Mycobac 7e-34
3lcj_A161 Phosphopantetheine Adenylyltransferase From Mycobac 7e-34
1kam_A194 Structure Of Bacillus Subtilis Nicotinic Acid Monon 2e-17
3dv2_A201 Crystal Structure Of Nicotinic Acid Mononucleotide 2e-15
3hfj_A191 Bacillus Anthracis Nicotinate Mononucleotide Adenyl 3e-15
2qtr_A189 Crystal Structure Of Nicotinate Mononucleotide Aden 4e-15
2qtm_A189 Crystal Structure Of Nicotinate Mononucleotide Aden 4e-15
2h29_A189 Crystal Structure Of Nicotinic Acid Mononucleotide 8e-15
2h2a_A189 Crystal Structure Of Nicotinic Acid Mononucleotide 1e-14
1f9a_A168 Crystal Structure Analysis Of Nmn Adenylyltransfera 6e-11
1yum_A242 Crystal Structure Of Nicotinic Acid Mononucleotide 6e-11
1k4k_A213 Crystal Structure Of E. Coli Nicotinic Acid Mononuc 2e-10
1ej2_A181 Crystal Structure Of Methanobacterium Thermoautotro 2e-10
3h05_A177 The Crystal Structure Of A Putative Nicotinate-Nucl 3e-10
1yul_A242 Crystal Structure Of Nicotinic Acid Mononucleotide 5e-10
1m8f_A181 Crystal Structure Of Methanobacterium Thermoautotro 5e-10
1m8g_A181 Crystal Structure Of Methanobacterium Thermoautotro 7e-10
1m8j_A181 Crystal Structure Of Methanobacterium Thermoautotro 1e-08
2qjo_A 341 Crystal Structure Of A Bifunctional Nmn Adenylyltra 2e-08
1hyb_A181 Crystal Structure Of An Active Site Mutant Of Metha 3e-08
1m8k_A181 Crystal Structure Of Methanobacterium Thermoautotro 5e-08
1coz_A129 Ctp:glycerol-3-Phosphate Cytidylyltransferase From 4e-07
1lw7_A 365 Nadr Protein From Haemophilus Influenzae Length = 3 7e-07
2b7l_A132 Crystal Structure Of Ctp:glycerol-3-Phosphate Cytid 8e-06
3op1_A308 Crystal Structure Of Macrolide-Efflux Protein Sp_11 0.003
1gzu_A290 Crystal Structure Of Human Nicotinamide Mononucleot 0.001
1kku_A279 Crystal Structure Of Nuclear Human Nicotinamide Mon 0.002
1kqn_A279 Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE CO 0.002
2qjt_B 352 Crystal Structure Of A Bifunctional Nmn Adenylyltra 0.003
gi|7767003|pdb|1B6T|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With 3'- Dephospho-Coa From Escherichia Coli Length = 159 Back     alignment and structure
 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMF-TLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H          V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHLGNVE-----VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   +   +++S+L++ +     D+T F+P+ V   L   + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA 159


>gi|14719581|pdb|1QJC|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With Ampcpp And 4'-Phosphopantetheine From Escherichia Coli Length = 158 Back     alignment and structure
>gi|52696203|pdb|1VLH|A Chain A, Crystal Structure Of Phosphopantetheine Adenylyltransferase (Tm0741) From Thermotoga Maritima At 2.20 A Resolution Length = 173 Back     alignment and structure
>gi|262368174|pdb|3K9W|A Chain A, Crystal Structure Of Phosphopantetheine Adenylyltransferase From Burkholderia Pseudomallei With Hydrolyzed 3'-Dephospho Coenzyme A Length = 170 Back     alignment and structure
gi|29726926|pdb|1OD6|A Chain A, The Crystal Structure Of Phosphopantetheine Adenylyltransferase From Thermus Thermophilus In Complex With 4'-Phosphopantetheine Length = 160 Back     alignment and structure
>gi|284055782|pdb|3L92|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia Pestis Complexed With Coenzyme A. Length = 162 Back     alignment and structure
>gi|39654326|pdb|1O6B|A Chain A, Crystal Structure Of Phosphopantetheine Adenylyltransferase With Adp Length = 169 Back     alignment and structure
>gi|306991780|pdb|3NBA|A Chain A, Phosphopantetheine Adenylyltranferase From Mycobacterium Tuberculosis In Complex With Adenosine-5'-[(Alpha,Beta)-Methyleno]triphosphate (Ampcpp) Length = 177 Back     alignment and structure
>gi|261824810|pdb|3F3M|A Chain A, Six Crystal Structures Of Two Phosphopantetheine Adenylyltransferases Reveal An Alternative Ligand Binding Mode And An Associated Structural Change Length = 168 Back     alignment and structure
>gi|55669913|pdb|1TFU|A Chain A, Phosphopantetheine Adenylyltransferase From Mycobacterium Tuberculosis Length = 157 Back     alignment and structure
gi|301015833|pdb|3LCJ|A Chain A, Phosphopantetheine Adenylyltransferase From Mycobacterium Tuberculosis Complexed With Coa Length = 161 Back     alignment and structure
>gi|22218984|pdb|1KAM|A Chain A, Structure Of Bacillus Subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase Length = 194 Back     alignment and structure
>gi|211939185|pdb|3DV2|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Bacillus Anthracis Length = 201 Back     alignment and structure
>gi|257471912|pdb|3HFJ|A Chain A, Bacillus Anthracis Nicotinate Mononucleotide Adenylytransferase (Nadd) In Complex With Inhibitor Cid 3289443 Length = 191 Back     alignment and structure
gi|194319955|pdb|2QTR|A Chain A, Crystal Structure Of Nicotinate Mononucleotide Adenylyltransferase Length = 189 Back     alignment and structure
gi|194319951|pdb|2QTM|A Chain A, Crystal Structure Of Nicotinate Mononucleotide Adenylyltransferase Length = 189 Back     alignment and structure
gi|114794185|pdb|2H29|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Staphylococcus Aureus: Product Bound Form 1 Length = 189 Back     alignment and structure
>gi|114794187|pdb|2H2A|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Staphylococcus Aureus: Product Bound Form 2 Length = 189 Back     alignment and structure
>gi|13096704|pdb|1F9A|A Chain A, Crystal Structure Analysis Of Nmn Adenylyltransferase From Methanococcus Jannaschii Length = 168 Back     alignment and structure
>gi|83753741|pdb|1YUM|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Pseudomonas Aeruginosa Length = 242 Back     alignment and structure
gi|24987436|pdb|1K4K|A Chain A, Crystal Structure Of E. Coli Nicotinic Acid Mononucleotide Adenylyltransferase Length = 213 Back     alignment and structure
gi|13787044|pdb|1EJ2|A Chain A, Crystal Structure Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase With Bound Nad+ Length = 181 Back     alignment and structure
gi|227343879|pdb|3H05|A Chain A, The Crystal Structure Of A Putative Nicotinate-Nucleotide Adenylyltransferase From Vibrio Parahaemolyticus Length = 177 Back     alignment and structure
>gi|83753740|pdb|1YUL|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Pseudomonas Aeruginosa Length = 242 Back     alignment and structure
>gi|34811403|pdb|1M8F|A Chain A, Crystal Structure Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Mutant R11a Complexed With Nad Length = 181 Back     alignment and structure
>gi|34811404|pdb|1M8G|A Chain A, Crystal Structure Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Mutant R11k Complexed With Nad Length = 181 Back     alignment and structure
>gi|34811405|pdb|1M8J|A Chain A, Crystal Structure Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Mutant R136a Complexed With Nad Length = 181 Back     alignment and structure
>gi|169791697|pdb|2QJO|A Chain A, Crystal Structure Of A Bifunctional Nmn AdenylyltransferaseADP RIBOSE PYROPHOSPHATASE (NADM) Complexed With Adprp And Nad From Synechocystis Sp. Length = 341 Back     alignment and structure
>gi|13787123|pdb|1HYB|A Chain A, Crystal Structure Of An Active Site Mutant Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Length = 181 Back     alignment and structure
>gi|34811406|pdb|1M8K|A Chain A, Crystal Structure Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Mutant H19a Complexed With Nad Length = 181 Back     alignment and structure
gi|6137341|pdb|1COZ|A Chain A, Ctp:glycerol-3-Phosphate Cytidylyltransferase From Bacillus Subtilis Length = 129 Back     alignment and structure
>gi|22219314|pdb|1LW7|A Chain A, Nadr Protein From Haemophilus Influenzae Length = 365 Back     alignment and structure
gi|110590849|pdb|2B7L|A Chain A, Crystal Structure Of Ctp:glycerol-3-Phosphate Cytidylyltransferase From Staphylococcus Aureus Length = 132 Back     alignment and structure
>gi|307776578|pdb|3OP1|A Chain A, Crystal Structure Of Macrolide-Efflux Protein Sp_1110 From Streptococcus Pneumoniae Length = 308 Back     alignment and structure
>gi|22218688|pdb|1GZU|A Chain A, Crystal Structure Of Human Nicotinamide Mononucleotide Adenylyltransferase In Complex With Nmn Length = 290 Back     alignment and structure
>gi|21730493|pdb|1KKU|A Chain A, Crystal Structure Of Nuclear Human Nicotinamide Mononucleotide Adenylyltransferase Length = 279 Back     alignment and structure
gi|28373465|pdb|1KQN|A Chain A, Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE COMPLEXED With Nad Length = 279 Back     alignment and structure
>gi|169404580|pdb|2QJT|B Chain B, Crystal Structure Of A Bifunctional Nmn AdenylyltransferaseADP RIBOSE PYROPHOSPHATASE COMPLEXED With Amp And Mn Ion From Francisella Tularensis Length = 352 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target182 phosphopantetheine adenylyltransferase [Candidatus Libe
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: 3e-28
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A bios 1e-25
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coenzyme 2e-24
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; dinucl 5e-23
1o6b_A169 Phosphopantetheine adenylyltransferase; structural geno 2e-22
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 5e-21
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, structu 7e-21
3k9w_A170 Phosphopantetheine adenylyltransferase; niaid, ssgcid, 3e-20
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coenzyme 8e-20
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transferase, s 8e-20
1tfu_A157 Phosphopantetheine adenylyltransferase; transport prote 3e-18
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two indivi 5e-17
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl trans 2e-12
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, transfe 2e-12
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltransfera 5e-12
1nup_A252 FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyri 1e-11
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; HET: 2e-11
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltransferas 2e-10
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase; NAD 2e-10
3do8_A148 Phosphopantetheine adenylyltransferase; protein with un 5e-09
3glv_A143 Lipopolysaccharide core biosynthesis protein; structura 2e-07
1yum_A242 'probable nicotinate-nucleotide adenylyltransferase; al 3e-07
1kqn_A279 Nmnat, nicotinamide mononucleotide adenylyl transferase 2e-06
3gmi_A 357 UPF0348 protein MJ0951; protein with unknown function, 1e-04
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossmann fol 2e-04
3elb_A 341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 0.002
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase); HE 0.001
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3lcj_A* 1tfu_A Length = 177 Back     alignment and structure
 Score =  119 bits (300), Expect = 3e-28
 Identities = 51/161 (31%), Positives = 87/161 (54%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AV  GSFDP+T GH+DI  +A +  +++V+AI  N  KT  F  + ER  ++K+S  
Sbjct: 21  MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMF-DLDERIAMVKESTT 79

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        + V    GL V+  +      IV+GLR  TDF+YE++M  +N+ +   + T
Sbjct: 80  HL-----PNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDT 133

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
             +       +V+S+L + +  +  D++  +P+PV   L++
Sbjct: 134 FFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRD 174


>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* Length = 158 Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Length = 160 Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacterthermautotrophicus} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Length = 181 Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Length = 169 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrolase; two individual domains; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural genomics, JCSG, protein structure initiative, PSI; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Length = 173 Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease, coenzyme A; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei 1710B} PDB: 3ikz_A* Length = 170 Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A biosynthetic pathway, coenzyme A biosynthesis, cytoplasm, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Length = 168 Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Length = 168 Back     alignment and structure
>1tfu_A Phosphopantetheine adenylyltransferase; transport protein, structural genomics, PSI, protein structure initiative; 1.99A {Mycobacterium tuberculosis} SCOP: c.26.1.3 Length = 157 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structural genomics, PSI; 1.65A {Vibrio parahaemolyticus} Length = 177 Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Length = 194 Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyridine adenylyltransferase, enzyme catalysi; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Length = 252 Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Length = 213 Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltransferase; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesis; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3e27_A* 2qtn_A* 2qtm_A* Length = 189 Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Length = 189 Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural genomics, PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Length = 143 Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Length = 242 Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Length = 279 Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; 1.91A {Methanocaldococcus jannaschii DSM2661} Length = 357 Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target182 phosphopantetheine adenylyltransferase [Candidatus Libe
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: 100.0
1o6b_A169 Phosphopantetheine adenylyltransferase; structural geno 100.0
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, structu 100.0
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A bios 100.0
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coenzyme 100.0
3k9w_A170 Phosphopantetheine adenylyltransferase; niaid, ssgcid, 99.98
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, transfe 99.98
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coenzyme 99.98
1yum_A242 'probable nicotinate-nucleotide adenylyltransferase; al 99.97
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase; NAD 99.97
1kqn_A279 Nmnat, nicotinamide mononucleotide adenylyl transferase 99.96
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 99.95
1nup_A252 FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyri 99.95
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltransferas 99.94
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; dinucl 99.94
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transferase, s 99.94
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; HET: 99.93
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltransfera 99.93
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two indivi 99.85
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl trans 99.77
3do8_A148 Phosphopantetheine adenylyltransferase; protein with un 99.66
3gmi_A357 UPF0348 protein MJ0951; protein with unknown function, 99.61
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase); HE 99.56
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossmann fol 99.56
3glv_A143 Lipopolysaccharide core biosynthesis protein; structura 99.44
3elb_A 341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 99.09
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 99.08
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann fold 98.81
1v47_A349 ATP sulfurylase; product binding complex, zinc, riken s 98.45
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfate syn 98.4
1jhd_A396 Sulfate adenylyltransferase; sulfurylase, APS, chemoaut 98.17
2x0k_A 338 Riboflavin biosynthesis protein RIBF; riboflavin kinase 98.17
1g8f_A 511 Sulfate adenylyltransferase; alpha-beta protein, beta-b 98.03
1r6x_A395 ATP:sulfate adenylyltransferase; APS kinase-like domain 98.02
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosphosulf 98.02
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfurylase; 97.97
3op1_A308 Macrolide-efflux protein; structural genomics, PSI-2, p 97.83
1mrz_A 293 Riboflavin kinase/FMN adenylyltransferase; rossmann fol 97.74
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase; APS 97.65
2ejc_A280 Pantoate--beta-alanine ligase; X-RAY diffraction, struc 95.22
1v8f_A276 Pantoate-beta-alanine ligase; rossmann fold, dimer, str 94.09
3n8h_A264 Pantothenate synthetase; alpha-beta sandwich, ligase, s 94.04
1iho_A283 Pantoate--beta-alanine ligase; rossman fold, dimer, APO 93.79
3guz_A176 Pantothenate synthetase; pantothenate biosynthesis, sub 93.47
3ag6_A283 Pantothenate synthetase; ATP-dependent enzyme, ATP-bind 93.45
3inn_A314 Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, 93.37
3cov_A301 Pantothenate synthetase; pantothenate biosynthesis, enz 91.26
3mxt_A285 Pantothenate synthetase; alpha-beta-alpha, structural g 90.32
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3lcj_A* 1tfu_A Back     alignment and structure
Probab=100.00  E-value=1.6e-34  Score=224.59  Aligned_cols=156  Identities=29%  Similarity=0.459  Sum_probs=117.0

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCC
Q ss_conf             65999658998784899999999997489799964558887665789899999999976420133554412420333332
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAV   81 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~~~~~~~~~   81 (182)
                      ||||||||||||||+||+.+|++|+++||+|+|+++.+|++++.....+.+..+..........      ..........
T Consensus        21 mriai~~GsFdPiH~GHl~i~~~a~~~~D~viv~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~   94 (177)
T 3nbk_A           21 MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNL------RVQVGHGLVV   94 (177)
T ss_dssp             CCEEEEEECCTTCCHHHHHHHHHHHHHSSEEEEEECCCTTSCCSSCHHHHHHHHHHHCTTCTTE------EEEECCSCHH
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC------CCCCCCCHHH
T ss_conf             6699968677988789999999999869989998345787666557999999998765402454------2233321025


Q ss_pred             CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHCCCHHHHHHHH
Q ss_conf             21001497079994376520124677998987647998689970685721132699999998599955839999999999
Q gi|254780181|r   82 NLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK  161 (182)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~l~~~~~~~~ISST~IR~~i~~g~~i~~lVP~~V~~yIk  161 (182)
                      .........................+.....+.+. ..+++++..++++.+||||+||+++++|++|++|||++|++|||
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-~~~~i~~~~~~~~~~ISST~IRe~i~~g~~i~~lVP~~V~~yIk  173 (177)
T 3nbk_A           95 DFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIA-GVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLR  173 (177)
T ss_dssp             HHHHHTTCCEEEEEECTTCCHHHHHHHHHHHHHHH-CCEEEEEECCGGGSSCCHHHHHHHHHTTCCCGGGSCHHHHHHHH
T ss_pred             HHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHHCCHHHHHHHH
T ss_conf             56653487087521021411554626999999728-97779996588777533599999998499867956999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780181|r  162 NIV  164 (182)
Q Consensus       162 ~~~  164 (182)
                      ||+
T Consensus       174 ekl  176 (177)
T 3nbk_A          174 DRL  176 (177)
T ss_dssp             HHH
T ss_pred             HHC
T ss_conf             862



>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural genomics, JCSG, protein structure initiative, PSI; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease, coenzyme A; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei 1710B} PDB: 3ikz_A* Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structural genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A biosynthetic pathway, coenzyme A biosynthesis, cytoplasm, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrolase; two individual domains; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyridine adenylyltransferase, enzyme catalysi; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltransferase; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesis; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacterthermautotrophicus} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; 1.91A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural genomics, PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-binding, multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel, nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure
>1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A Back     alignment and structure
>3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} Back     alignment and structure
>1iho_A Pantoate--beta-alanine ligase; rossman fold, dimer, APO, high, KSMKS, flexible domains, multidomain; 1.70A {Escherichia coli} SCOP: c.26.1.4 PDB: 3mue_A Back     alignment and structure
>3guz_A Pantothenate synthetase; pantothenate biosynthesis, substrate binding, competitive inhibition, rossmann fold; HET: PAF; 1.67A {Escherichia coli} Back     alignment and structure
>3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* Back     alignment and structure
>3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} Back     alignment and structure