254780182

254780182

DNA gyrase subunit A

GeneID in NCBI database:8209162Locus tag:CLIBASIA_00325
Protein GI in NCBI database:254780182Protein Accession:YP_003064595.1
Gene range:-(62743, 65475)Protein Length:910aa
Gene description:DNA gyrase subunit A
COG prediction:[L] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit
KEGG prediction:gyrA; DNA gyrase subunit A; K02469 DNA gyrase subunit A [EC:5.99.1.3]
SEED prediction:DNA gyrase subunit A (EC 5.99.1.3)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA topoisomerases, Type II, ATP-dependent;
Resistance to fluoroquinolones
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910
MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE
cccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHccccHHccccHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEcccccEEcccccccccccEEEEccccEEEccccccccccHHHHHHHHHHHHHcccccHHHHHHHccccccccccEEccHHHHHHHHHccccEEEEEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHcccccccEEEEccccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEcccHHccHHHHcccccEEEEEcccccEEEcccccccccccccccccccccccccEEEEEEEEccccEEEEEEccccEEEEEHHHccccccccccEEEHHHcccccccEEEEEEEEccccccccccEEEEEEcccEEEEEEHHHHcccccccEEEEEcccccEEEEEEEcccccEEEEEEcccEEEEEEHHHccccccccccccccccccccccEEEEEEEcccccccccHHHHHHHccccccccccccccccccccccccccccccccEEEEEccccEEEEEEcccEEEEEcHHHccccccccccEEEEEEcccccccEEEEEEEEccccEEEEEccccEEEEEEHHHccccccccccEEEEEcccccEEEEEEEEccccccccccccc
cccccccccccHccccccccHHHHHHHHHHHHHHHHHHHcccccHHccccHHHHHHHHHHHHcccccccccEcccEEcccccccccccccHHHHHHHHHHHcccccccEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEcccccEEEEEccccccccccHHEHHHHHHcccccccHHHHHHHcccccccHHHHHHcHHHHHHHHHccccEEEEEEEEEEEEcccccEEEEEEccccHHcHHHHHHHHHHHHHHHccccHHHccccccccccEEEEEEEcccHHHHHHHHHHHHccHHHHHcHHHEEEccccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHcccccEEEEEEcccEEEEEccHHHHHHHccccccHHHccccHHHHHEEEEEcccccEEEEEcccEEEEEEEEEccccccccccccEEEEcccccccEEEEEEEccccHHHccccEEEEEEcccEEEcccHHHHHcHcHccEEEEEcccccEEEEEEEcccccEEEEEEcccEEEEEccccEEEcccccccccEEEEcccccEEEEEEEEEcccccHHHHHHHHHccHHHHHHcccccHccccccccccccccccccEEEEEcccccEEEEEEcccccEEccccccccccccccEEEEEEccccccccEEEEEEEcccccEEEEEEcccEEEEEEccEEEEEEcccccEEEEEEccccEEEEEEEEccccccHHHHccc
mtehiissdeeeekgitsvSITDEMQNSYLTYAINVILGraipdlrdglkpVHRRILFGMMQMGVEWNKKYVKCARisgevmgkyhphgnAAIYDALARMAQDWSLRLLLIEgqgnfgsvdgdppaaerYTECRLQKAAHFLLDdlgkdtvdfrpnydgsfqepvvlcarypnvlvnggggiavgmatnipthnlgevVDGCvavidnpdidLDALMeiirgpdfptgavILGRTgiknayatgrgsivIRGVshiektsgdreqiVVTEIPYQVNKAAMLEKIAELVREKRIVDIadlrdesdrQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMValngykperfTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDliddssytigsdgtmyLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLsvkdeldtprrTRIVEGLldmededcivrEDMVVTVSHlgyvkrvplSVYRaqrrggkgrsgvvmrdedfvTDLFIVSTHTSVLFFSSLgfvykekvwrlpigspqaRGKALINILSLnqgerittimpfpedesswNNLYVVFATKhgnvrrnkLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTklgqcvrfpiSAIRVFAGrnsvgvrgislakgdqVISMAIVLHADADYDERICYMKHMSAqrrlisgdteeitslkndssvegniseERCQELKLKEQFILTVSekgfgkrtssydfrisnrsgkgiratdvskINEIGALVavfpvndndqiilvsdkgtlirvpvNEIRIASRATKGVVIFSTAKDERVVSVERIReseivdeaeste
mtehiissdeeeekgitsvsiTDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVShiektsgdreqivVTEIPYQVNKAAMLEKIAELVREKRIvdiadlrdesdrqgYRVVIelkrgasadVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLlnkardrahVLVGLAIAvanldevvriirfspnpetarrELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARltglgrddIRNELNSLGIEIKECLDILSSRSRLLGIIKqellsvkdeldtprrtriveglldmededcIVREDMVVTVshlgyvkrvplsvyraqrrggkgrsgvvmrdEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATkhgnvrrnklsdfiqinrsgkiamkldsrDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGislakgdqvISMAIVLHADADYDERICYMKHMSAQRrlisgdteeitslkndssvegnisEERCQELKLKEQFIltvsekgfgkrtssydfrisnrsgkgiratdvsKINEIGALVavfpvndndQIILvsdkgtlirvpvneiriasratkgvvifstakdervvsverireseivdeaeste
MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKafvafreevvvrrTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNAsdikdlidliddssYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE
********************ITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQ*R******GVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHM*******************DSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI*************
*****************SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRA*********GVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE*********
**********E*EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRR*********MRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT***********VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE
MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE
MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
254780353753 DNA topoisomerase IV subunit A [Candidatus Liberib 1e-105
>gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 753 Back     alignment
 Score =  375 bits (963), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 244/697 (35%), Positives = 374/697 (53%), Gaps = 65/697 (9%)

Query: 3   EHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQ 62
           ++I +S+   E+ + +VS+   ++  YL YA++ I  RAIPDLRDG KPVHRRI+  M +
Sbjct: 4   DNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63

Query: 63  MGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDG 122
           MG+++   + K ARI GEV+GK HPHG+ ++YD+L R+AQ +  R  LI GQGNFG++DG
Sbjct: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123

Query: 123 DPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGI 182
           D  AA RYTE R+ + A  +L  + +D VDFR  Y+    EPVV  +++PN+L NG  GI
Sbjct: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183

Query: 183 AVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL-GRTGIKNAY 241
           AVGMAT+IP+HN+ E+ +  +A+IDNP+I ++ L+E I GPDFPTG +I+  R  I  +Y
Sbjct: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243

Query: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301
             GRG   +R    +E+       IVVTEIPYQV K+ ++EKIAEL+  KRI  + D+RD
Sbjct: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303

Query: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALN-GYKPERFTLIGILKA 360
           ES      V+    R    D+++  ++  + +++ F +NM  L+ G  P+   L GILK 
Sbjct: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKE 363

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           ++A R EV+ RR+ + +     R  +L GL IA  N+DE++ IIR    P+     ++ R
Sbjct: 364 WLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPV---MVSR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
                                       L+E Q  AIL LRL  L  L    I++EL++L
Sbjct: 421 --------------------------FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNL 454

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP-----RRTRIVEGLLDMED-----E 530
             E ++   +L+S  +    I  E+  VK+          RRT   E  +   D     +
Sbjct: 455 LAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCE--VSRADKATLQQ 512

Query: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590
             I +E + V +S+ G++        R+ +      S +  ++ D +       T   +L
Sbjct: 513 AMIEKEPITVVISNRGWI--------RSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564

Query: 591 FFSSLGFVYKEKVWRLPIG---SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
             S+ G     K + LP G   S +  G+A+  ++ LN  + I T   +     S   L 
Sbjct: 565 LLSTDG-----KAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY----DSTCKLL 615

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684
           VV  +  GN    + S+ I   R GK  +K+ S +++
Sbjct: 616 VV--SSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM 650

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
315122780909 DNA gyrase subunit A [Candidatus Liberibacter solanacea 1 0.0
222085986934 DNA gyrase, A subunit [Agrobacterium radiobacter K84] L 1 0.0
150396459931 DNA gyrase subunit A [Sinorhizobium medicae WSM419] Len 1 0.0
15965313931 DNA gyrase subunit A [Sinorhizobium meliloti 1021] Leng 1 0.0
307307939931 DNA gyrase, A subunit [Sinorhizobium meliloti BL225C] L 1 0.0
227822110927 DNA gyrase subunit A [Sinorhizobium fredii NGR234] Leng 1 0.0
307317170931 DNA gyrase, A subunit [Sinorhizobium meliloti AK83] Len 1 0.0
162329639941 DNA gyrase subunit A [Rhizobium etli CFN 42] Length = 9 1 0.0
209549340941 DNA gyrase subunit A [Rhizobium leguminosarum bv. trifo 1 0.0
325292861930 DNA gyrase subunit A [Agrobacterium sp. H13-3] Length = 1 0.0
>gi|315122780|ref|YP_004063269.1| DNA gyrase subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 909 Back     alignment and organism information
 Score = 1642 bits (4251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/907 (87%), Positives = 857/907 (94%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTEHI+ +DEE EKGITSVSI +EMQNSYLTYAINVILGRAIPDLRDGLK VHRRILFGM
Sbjct: 1   MTEHIVPNDEEGEKGITSVSIVEEMQNSYLTYAINVILGRAIPDLRDGLKSVHRRILFGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
           MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS+
Sbjct: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSI 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCA++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIPTHNLGEV++GC+A+IDNPDIDLD +M+II GPDFPTGA+ILGR+GI++A
Sbjct: 181 GIAVGMATNIPTHNLGEVIEGCIALIDNPDIDLDDMMKIILGPDFPTGAIILGRSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           YATGRGSIVIRGV+HIEKT GDRE+I+VTEIPYQVNK+AMLEKIAELVREKRIVDI+DLR
Sbjct: 241 YATGRGSIVIRGVTHIEKTEGDREKIIVTEIPYQVNKSAMLEKIAELVREKRIVDISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLI ILK 
Sbjct: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIEILKN 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+AFREEVV RRTKYLLNKARDRAHVLVGLAIAV+NLDEVVRIIRFSPNPE+ARRELMQR
Sbjct: 361 FIAFREEVVGRRTKYLLNKARDRAHVLVGLAIAVSNLDEVVRIIRFSPNPESARRELMQR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           +WNA DIKDLIDLIDDSSYTI SDG MYLSEVQTRAILELRLARLTGLGRDDIR+ELNSL
Sbjct: 421 NWNAVDIKDLIDLIDDSSYTINSDGKMYLSEVQTRAILELRLARLTGLGRDDIRDELNSL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+CL+ILSSRSRLL IIKQEL  +KDELDTPRRT IV+GLLDMEDEDCIVREDMVV
Sbjct: 481 GTEIKDCLEILSSRSRLLNIIKQELKFIKDELDTPRRTEIVDGLLDMEDEDCIVREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GYVKRVPLS+YRAQRRGGKGRSGVV R+EDFVTDLFIV+THT VLFFSSLGFVYK
Sbjct: 541 TVSHFGYVKRVPLSLYRAQRRGGKGRSGVVTRNEDFVTDLFIVNTHTPVLFFSSLGFVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIGSPQ+RGKALINILSL QGERITTIMP PEDESS ++LYVVFATK GNVRRN
Sbjct: 601 EKVWRLPIGSPQSRGKALINILSLQQGERITTIMPLPEDESSCSDLYVVFATKLGNVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF+Q+NRSGKIAMKLD  DEILSVETC + ND+LLTTKLGQC+RF I+ +RVF+GRN
Sbjct: 661 KLSDFVQVNRSGKIAMKLDEGDEILSVETCMEGNDVLLTTKLGQCIRFAITDVRVFSGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           SVGVRGI LA+ DQVISMAIVLHADADYDER+CYMK+M++ RRLI+ D +E   LKNDSS
Sbjct: 721 SVGVRGIVLAEDDQVISMAIVLHADADYDERVCYMKYMASHRRLIASDIDEGGVLKNDSS 780

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
           +EG ISEERC+ELK KEQFILTVSEKGFGKRTSSYDFRIS+R GKGI ATD SK++EIG 
Sbjct: 781 IEGKISEERCKELKSKEQFILTVSEKGFGKRTSSYDFRISSRGGKGILATDTSKMDEIGP 840

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           L++ FPVND DQIILVSDKGTLIRVPVN+IRIASR+TKGVVIFSTAKDERVVSVERI ES
Sbjct: 841 LISAFPVNDKDQIILVSDKGTLIRVPVNDIRIASRSTKGVVIFSTAKDERVVSVERISES 900

Query: 901 EIVDEAE 907
           +I+D +E
Sbjct: 901 DIIDVSE 907


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085986|ref|YP_002544518.1| DNA gyrase, A subunit [Agrobacterium radiobacter K84] Length = 934 Back     alignment and organism information
>gi|150396459|ref|YP_001326926.1| DNA gyrase subunit A [Sinorhizobium medicae WSM419] Length = 931 Back     alignment and organism information
>gi|15965313|ref|NP_385666.1| DNA gyrase subunit A [Sinorhizobium meliloti 1021] Length = 931 Back     alignment and organism information
>gi|307307939|ref|ZP_07587664.1| DNA gyrase, A subunit [Sinorhizobium meliloti BL225C] Length = 931 Back     alignment and organism information
>gi|227822110|ref|YP_002826081.1| DNA gyrase subunit A [Sinorhizobium fredii NGR234] Length = 927 Back     alignment and organism information
>gi|307317170|ref|ZP_07596611.1| DNA gyrase, A subunit [Sinorhizobium meliloti AK83] Length = 931 Back     alignment and organism information
>gi|162329639|ref|YP_469621.2| DNA gyrase subunit A [Rhizobium etli CFN 42] Length = 941 Back     alignment and organism information
>gi|209549340|ref|YP_002281257.1| DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 941 Back     alignment and organism information
>gi|325292861|ref|YP_004278725.1| DNA gyrase subunit A [Agrobacterium sp. H13-3] Length = 930 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
PRK05560805 PRK05560, PRK05560, DNA gyrase subunit A; Validated 0.0
TIGR01063800 TIGR01063, gyrA, DNA gyrase, A subunit 0.0
PRK13979957 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Pro 1e-154
COG0188804 COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/topo 0.0
PRK05561742 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Val 0.0
TIGR01061738 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, 1e-157
cd00187445 cd00187, TOP4c, DNA Topoisomerase, subtype IIA; domain 1e-163
smart00434445 smart00434, TOP4c, DNA Topoisomerase IV 1e-163
pfam00521428 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, 1e-158
TIGR01062735 TIGR01062, parC_Gneg, DNA topoisomerase IV, A subunit, 1e-130
PRK09631635 PRK09631, PRK09631, DNA topoisomerase IV subunit A; Pro 5e-55
PRK12758869 PRK12758, PRK12758, DNA topoisomerase IV subunit A; Pro 2e-48
PRK09630479 PRK09630, PRK09630, DNA topoisomerase IV subunit A; Pro 3e-43
PHA02592439 PHA02592, 52, DNA topisomerase II medium subunit; Provi 1e-40
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; P 2e-20
KOG0355842 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [C 7e-28
PLN031281135 PLN03128, PLN03128, DNA topoisomerase 2; Provisional 3e-19
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provisional 3e-16
TIGR01063800 TIGR01063, gyrA, DNA gyrase, A subunit 2e-12
KOG0355842 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [C 2e-11
PRK13979957 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Pro 2e-10
pfam0398950 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, 7e-09
pfam0398950 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, 1e-07
pfam0398950 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, 1e-06
pfam0398950 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, 3e-06
PRK05561742 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Val 2e-05
TIGR01061 738 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, 3e-05
TIGR01061738 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, 5e-05
TIGR01061738 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, 4e-04
pfam0398950 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, 2e-04
PRK05561 742 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Val 0.003
>gnl|CDD|180128 PRK05560, PRK05560, DNA gyrase subunit A; Validated Back     alignment and domain information
>gnl|CDD|162183 TIGR01063, gyrA, DNA gyrase, A subunit Back     alignment and domain information
>gnl|CDD|184434 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|30537 COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|180129 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>gnl|CDD|162182 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|29149 cd00187, TOP4c, DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II Back     alignment and domain information
>gnl|CDD|128711 smart00434, TOP4c, DNA Topoisomerase IV Back     alignment and domain information
>gnl|CDD|144201 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A Back     alignment and domain information
>gnl|CDD|130134 TIGR01062, parC_Gneg, DNA topoisomerase IV, A subunit, proteobacterial Back     alignment and domain information
>gnl|CDD|182004 PRK09631, PRK09631, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|183728 PRK12758, PRK12758, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|170022 PRK09630, PRK09630, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|177419 PHA02592, 52, DNA topisomerase II medium subunit; Provisional Back     alignment and domain information
>gnl|CDD|185451 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|35576 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|178674 PLN03128, PLN03128, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|178775 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|162183 TIGR01063, gyrA, DNA gyrase, A subunit Back     alignment and domain information
>gnl|CDD|35576 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|184434 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|146561 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>gnl|CDD|146561 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>gnl|CDD|146561 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>gnl|CDD|146561 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>gnl|CDD|180129 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>gnl|CDD|162182 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|162182 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|162182 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|146561 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>gnl|CDD|180129 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
TIGR01063864 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA top 100.0
PRK05560822 DNA gyrase subunit A; Validated 100.0
PRK13979959 DNA topoisomerase IV subunit A; Provisional,Validated 100.0
COG0188804 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topois 100.0
KOG0355842 consensus 100.0
PRK05561745 DNA topoisomerase IV subunit A; Validated 100.0
TIGR01061745 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IP 100.0
PRK12758879 DNA topoisomerase IV subunit A; Provisional 100.0
TIGR01062747 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IP 100.0
PRK09631626 DNA topoisomerase IV subunit A; Provisional 100.0
PRK09630479 DNA topoisomerase IV subunit A; Provisional 100.0
smart00434445 TOP4c DNA Topoisomerase IV. Bacterial DNA topoisomerase 100.0
cd00187445 TOP4c DNA Topoisomerase, subtype IIA; domain A'; bacter 100.0
pfam00521428 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A. 100.0
PTZ001081506 DNA topoisomerase II; Provisional 100.0
PRK13979959 DNA topoisomerase IV subunit A; Provisional,Validated 99.94
PRK05560822 DNA gyrase subunit A; Validated 99.92
TIGR01063864 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA top 99.91
KOG0355842 consensus 99.86
PRK05561745 DNA topoisomerase IV subunit A; Validated 99.85
TIGR01061745 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IP 99.52
TIGR01062747 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IP 98.71
COG0188804 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topois 99.72
PRK09631626 DNA topoisomerase IV subunit A; Provisional 98.06
pfam0398950 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propel 97.96
pfam0398950 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propel 97.86
PRK09630479 DNA topoisomerase IV subunit A; Provisional 97.56
KOG1240 1431 consensus 96.68
>TIGR01063 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>PRK13979 DNA topoisomerase IV subunit A; Provisional,Validated Back     alignment and domain information
>COG0188 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0355 consensus Back     alignment and domain information
>PRK05561 DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IPR005741 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK12758 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>TIGR01062 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IPR005742 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK09631 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>PRK09630 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>smart00434 TOP4c DNA Topoisomerase IV Back     alignment and domain information
>cd00187 TOP4c DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II Back     alignment and domain information
>pfam00521 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>PRK13979 DNA topoisomerase IV subunit A; Provisional,Validated Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>TIGR01063 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>KOG0355 consensus Back     alignment and domain information
>PRK05561 DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IPR005741 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>TIGR01062 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IPR005742 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG0188 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09631 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>pfam03989 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>pfam03989 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>PRK09630 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>KOG1240 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
2wl2_B522 Crystal Structure Of N-Terminal Domain Of Gyra With 1e-175
2xco_A726 The 3.1a Crystal Structure Of The Catalytic Core (B 1e-170
2xcr_B726 The 3.5a Crystal Structure Of The Catalytic Core (B 1e-169
2xcs_B692 The 2.1a Crystal Structure Of S. Aureus Gyrase Comp 1e-169
3nuh_A525 A Domain Insertion In E. Coli Gyrb Adopts A Novel F 1e-167
1ab4_A493 59kda Fragment Of Gyrase A From E. Coli Length = 49 1e-162
3ifz_A508 Crystal Structure Of The First Part Of The Mycobact 1e-160
3lpx_A500 Crystal Structure Of Gyra Length = 500 1e-156
3ilw_A470 Structure Of Dna Gyrase Subunit A N-Terminal Domain 1e-147
2inr_A514 Crystal Structure Of A 59 Kda Fragment Of Topoisome 1e-146
2nov_A496 Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Cr 1e-145
2xkj_E767 Crystal Structure Of Catalytic Core Of A. Baumannii 1e-130
2xkk_A767 Crystal Structure Of Moxifloxacin, Dna, And A. Baum 1e-128
2rgr_A759 Topoisomerase Iia Bound To G-Segment Dna Length = 7 4e-40
1bgw_A793 Topoisomerase Residues 410-1202 Length = 793 4e-40
3l4k_A722 Topoisomerase Ii-Dna Cleavage Complex, Apo Length = 5e-39
1zvu_A716 Structure Of The Full-Length E. Coli Parc Subunit L 1e-146
1zvu_A716 Structure Of The Full-Length E. Coli Parc Subunit L 0.002
1suu_A312 Structure Of Dna Gyrase A C-Terminal Domain Length 9e-15
1zvt_A256 Structure Of The E. Coli Parc C-Terminal Domain Len 0.001
3l6v_A370 Crystal Structure Of The Xanthomonas Campestris Gyr 2e-83
1zi0_A307 A Superhelical Spiral In Escherichia Coli Dna Gyras 1e-77
1wp5_A323 Crystal Structure Of The C-Terminal Domain Of Dna T 9e-42
1suu_A312 Structure Of Dna Gyrase A C-Terminal Domain Length 4e-32
3l6v_A370 Crystal Structure Of The Xanthomonas Campestris Gyr 6e-06
1zi0_A 307 A Superhelical Spiral In Escherichia Coli Dna Gyras 5e-11
1suu_A 312 Structure Of Dna Gyrase A C-Terminal Domain Length 2e-12
3kua_A153 Ccdbvfi:gyra14vfi Length = 153 8e-15
3ku8_A156 Ccdbvfi:gyra14ec Length = 156 2e-14
1x75_A132 Ccdb:gyra14 Complex Length = 132 5e-14
3no0_A276 Aquifex Aeolicus Type Iia Topoisomerase C-Terminal 2e-13
3no0_A276 Aquifex Aeolicus Type Iia Topoisomerase C-Terminal 4e-13
>gi|302148632|pdb|2XCO|A Chain A, The 3.1a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Length = 726 Back     alignment and structure
>gi|302148634|pdb|2XCR|B Chain B, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna Length = 726 Back     alignment and structure
>gi|302148642|pdb|2XCS|B Chain B, The 2.1a Crystal Structure Of S. Aureus Gyrase Complex With Gsk299423 And Dna Length = 692 Back     alignment and structure
>gi|302566244|pdb|3NUH|A Chain A, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function Length = 525 Back     alignment and structure
>gi|157829780|pdb|1AB4|A Chain A, 59kda Fragment Of Gyrase A From E. Coli Length = 493 Back     alignment and structure
>gi|301598495|pdb|3IFZ|A Chain A, Crystal Structure Of The First Part Of The Mycobacterium Tuberculosis Dna Gyrase Reaction Core: The Breakage And Reunion Domain At 2.7 A Resolution Length = 508 Back     alignment and structure
>gi|323462878|pdb|3LPX|A Chain A, Crystal Structure Of Gyra Length = 500 Back     alignment and structure
>gi|260656380|pdb|3ILW|A Chain A, Structure Of Dna Gyrase Subunit A N-Terminal Domain Length = 470 Back     alignment and structure
>gi|158428820|pdb|2INR|A Chain A, Crystal Structure Of A 59 Kda Fragment Of Topoisomerase Iv Subunit A (Grla) From Staphylococcus Aureus Length = 514 Back     alignment and structure
>gi|119390532|pdb|2NOV|A Chain A, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target Length = 496 Back     alignment and structure
>gi|305677637|pdb|2XKJ|E Chain E, Crystal Structure Of Catalytic Core Of A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 Back     alignment and structure
>gi|305677638|pdb|2XKK|A Chain A, Crystal Structure Of Moxifloxacin, Dna, And A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 Back     alignment and structure
>gi|163931058|pdb|2RGR|A Chain A, Topoisomerase Iia Bound To G-Segment Dna Length = 759 Back     alignment and structure
>gi|157830305|pdb|1BGW|A Chain A, Topoisomerase Residues 410-1202 Length = 793 Back     alignment and structure
>gi|71042522|pdb|1ZVU|A Chain A, Structure Of The Full-Length E. Coli Parc Subunit Length = 716 Back     alignment and structure
>gi|71042522|pdb|1ZVU|A Chain A, Structure Of The Full-Length E. Coli Parc Subunit Length = 716 Back     alignment and structure
>gi|48425718|pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312 Back     alignment and structure
>gi|71042520|pdb|1ZVT|A Chain A, Structure Of The E. Coli Parc C-Terminal Domain Length = 256 Back     alignment and structure
>gi|290790184|pdb|3L6V|A Chain A, Crystal Structure Of The Xanthomonas Campestris Gyrase A C- Terminal Domain Length = 370 Back     alignment and structure
>gi|67463753|pdb|1ZI0|A Chain A, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307 Back     alignment and structure
>gi|56554393|pdb|1WP5|A Chain A, Crystal Structure Of The C-Terminal Domain Of Dna Topoisomerase Iv Length = 323 Back     alignment and structure
>gi|48425718|pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312 Back     alignment and structure
>gi|290790184|pdb|3L6V|A Chain A, Crystal Structure Of The Xanthomonas Campestris Gyrase A C- Terminal Domain Length = 370 Back     alignment and structure
>gi|67463753|pdb|1ZI0|A Chain A, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307 Back     alignment and structure
>gi|48425718|pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312 Back     alignment and structure
>gi|312207859|pdb|3KUA|A Chain A, Ccdbvfi:gyra14vfi Length = 153 Back     alignment and structure
>gi|312207855|pdb|3KU8|A Chain A, Ccdbvfi:gyra14ec Length = 156 Back     alignment and structure
>gi|67464191|pdb|1X75|A Chain A, Ccdb:gyra14 Complex Length = 132 Back     alignment and structure
>gi|313103856|pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 Back     alignment and structure
>gi|313103856|pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
2wl2_A522 GYRA, DNA gyrase subunit A; isomerase, aminocoumarin an 0.0
2xcs_B692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 1e-155
2inr_A514 DNA topoisomerase 4 subunit A; topoisomerase II fold; H 1e-152
3ilw_A470 DNA gyrase subunit A; DNA topology, topoisomerase, anti 1e-141
2nov_A496 DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, 1e-136
2xkj_E767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 1e-135
3l4j_A757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 3e-86
1bjt_A793 Topoisomerase II; quaternary change, DNA-binding, DNA t 1e-73
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 1e-158
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 9e-09
1zi0_A 307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 3e-10
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 3e-85
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 2e-67
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 9e-54
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-invade 9e-44
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 2e-11
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 1e-05
3ku8_A156 GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, t 3e-36
1zvt_A256 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 4e-26
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Length = 692 Back     alignment and structure
>2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} Length = 514 Back     alignment and structure
>3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, structural genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} Length = 470 Back     alignment and structure
>2nov_A DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, GRAM-positive bacteria, quinolone target, DNA binding, DNA cleavage; HET: DNA; 2.67A {Streptococcus pneumoniae} PDB: 3foe_A* 3fof_A* Length = 496 Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757 Back     alignment and structure
>1bjt_A Topoisomerase II; quaternary change, DNA-binding, DNA topology; 2.50A {Saccharomyces cerevisiae} SCOP: e.11.1.1 PDB: 1bgw_A 2rgr_A* Length = 793 Back     alignment and structure
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 3.00A {Escherichia coli} Length = 716 Back     alignment and structure
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 3.00A {Escherichia coli} Length = 716 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Length = 307 Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Length = 370 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Length = 307 Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Length = 312 Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Length = 323 Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Length = 370 Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Length = 312 Back     alignment and structure
>3ku8_A GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, topoisomerase, toxin-isomerase compl; HET: DNA; 1.93A {Escherichia coli} PDB: 1x75_A* 3kua_A* Length = 156 Back     alignment and structure
>1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 1.70A {Escherichia coli} Length = 256 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target910 DNA gyrase subunit A [Candidatus Liberibacter asiaticus
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 100.0
2wl2_A522 GYRA, DNA gyrase subunit A; isomerase, aminocoumarin an 100.0
2inr_A514 DNA topoisomerase 4 subunit A; topoisomerase II fold; H 100.0
2xcs_B692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 100.0
3ilw_A470 DNA gyrase subunit A; DNA topology, topoisomerase, anti 100.0
2nov_A496 DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, 100.0
2xkj_E767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 100.0
3l4j_A757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 100.0
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 100.0
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 100.0
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 100.0
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-invade 100.0
1zvt_A256 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 100.0
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 99.92
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-invade 99.91
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 99.91
3ku8_A156 GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, t 99.96
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 99.91
1zvt_A256 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 99.76
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 99.74
3l4j_A757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 93.45
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 3.00A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=1748.20  Aligned_cols=692  Identities=34%  Similarity=0.549  Sum_probs=652.6

Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHCCCCCCCCCCCC
Q ss_conf             63137540008973678999999987899999811340425566436688704789999997122011156131478870
Q gi|254780182|r   38 LGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNF  117 (910)
Q Consensus        38 ~~RAlPd~rDGlKpv~Rrily~m~~~~~~~~~~~~K~a~ivg~v~gkyHPHGd~siy~a~v~maq~~~~r~plidg~Gnf  117 (910)
                      .+|||||+|||||||||||||||+++|++++++|+||||+||+||||||||||+|+|||||||||+|+|||||+||||||
T Consensus         1 l~RalP~~~DGlKpvqRril~~m~~~~~~~~~~~~k~a~~vg~v~g~yhpHGd~s~~~a~v~maq~~~~~~pl~~~~Gnf   80 (716)
T 1zvu_A            1 MDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNW   80 (716)
T ss_dssp             -CCCCCBTTTCCCHHHHHHHHHHSTTCC----------CCHHHHHTTTSCTTCHHHHHHHHHHTSTTSCSSCSEEECSCC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECCCCC
T ss_conf             98778972238857888999999862898999854435479887418889759999999999835323046216478987


Q ss_pred             CCCCCCC-CCHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCEECCCCCCCCHHCCCCCEEEHHHHCCCCCCHH
Q ss_conf             8877697-201357899978999999863076840533068988548503432273211016761010133178985478
Q gi|254780182|r  118 GSVDGDP-PAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLG  196 (910)
Q Consensus       118 Gs~dgd~-~AA~RYte~rl~~~~~~~l~~i~~~tv~~~~n~D~~~~EP~vlP~~~P~lL~nG~~GIAvGmaTnippHNl~  196 (910)
                      ||+||++ ||||||||||||+++++||.|+|++||+|+|||||+++||+|||++|||||||||+|||||||||||||||+
T Consensus        81 Gs~~~~~~~Aa~RY~e~rls~~~~~~~~~~~~~~~~~~~n~Dg~~~EP~~lp~~~P~lLvNG~~GIavG~aT~IpphNl~  160 (716)
T 1zvu_A           81 GAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR  160 (716)
T ss_dssp             SSSSSCCCTTSSCGGGEEECGGGHHHHTTTTSSCSCEEECTTSSSEEESSCCCSSCHHHHHCCCSCCSSCSCBCCCBCHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHCCCCCCHH
T ss_conf             89999965465667873557999998764065744766388987458730266564776357765456765277663368


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHCCCCCCCCCCCCCC-HHHHHHHHHHCCCEEEEEEEEEEEECCCCCEEEEEECCCCCC
Q ss_conf             9999998876187768888886345866887443447-588999987012038999988654336784599992464435
Q gi|254780182|r  197 EVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILG-RTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQV  275 (910)
Q Consensus       197 Ev~~a~~~~i~~p~~~~~eL~~~i~GPDFPTGG~I~~-~~~i~~~y~tGrG~i~iR~k~~ie~~~~~k~~ivItEiPY~v  275 (910)
                      ||++||+++|++|++++++||++||||||||||+|++ .++|.++|+||||+|++||+|++|+     ++||||||||||
T Consensus       161 ev~~a~~~~i~~~~~~~~~l~~~i~gPdfptgg~i~~~~~~i~~~y~tG~G~i~~r~~~~~e~-----~~ivItEiPy~~  235 (716)
T 1zvu_A          161 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWKKED-----GAVVISALPHQV  235 (716)
T ss_dssp             HHHHHHHHHHHCTTCCHHHHTTTCCSBCCSSSSEECSCTTHHHHHHHHTEEEEEEECEEEEET-----TEEEEEECCTTC
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCCEEECCHHHHHHHHHCCCEEEEEEEEEECCC-----CEEEEEECCCCC
T ss_conf             888778998629987889996137789989856697684888876526985999999982448-----749999788545


Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCEEEE--EEECCCCCHHHHHHHHHHHCCHHCCCCCEEEEE-ECCCCCCC
Q ss_conf             289999999999871665014458730374655799--994798877899999997610110000002455-41663000
Q gi|254780182|r  276 NKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVV--IELKRGASADVILNQLYRYTSLQSLFSVNMVAL-NGYKPERF  352 (910)
Q Consensus       276 nk~~lie~Ia~lv~~~ki~gI~dirDeSdr~giRiv--ielKr~~~~~~vln~Lyk~T~Lq~sf~~N~~aL-~~g~P~~l  352 (910)
                      ||++++|+|++++++||++||+|+|||||++|+|+|  ++.+++++++.|||+|||+|+||+||++||+++ ++|+|+++
T Consensus       236 ~~~~lie~i~~lv~~kki~~i~d~~DeSd~~~~~~vv~~~~~~~~~~e~vl~~Lyk~T~Lq~s~~~N~~~i~~~g~P~~~  315 (716)
T 1zvu_A          236 SGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVK  315 (716)
T ss_dssp             CHHHHHHHHHHHHHTTSCTTEEEEEECCCSSSTTCEEEEESSSSCCHHHHHHHHHHHSTTEEEEEEECEEECTTSCEEEC
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCHHHHHCCCCEEEEEECCCCCCC
T ss_conf             67889999998876489662000111356667579995055568899999999998442344313045788309964505


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             29999999999999999999999999998887789999998740699999986189978987877631269788999997
Q gi|254780182|r  353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID  432 (910)
Q Consensus       353 ~Lk~iL~~fi~hR~evi~rRt~~~L~ka~~R~HILeGL~~Al~nIDeVI~iIR~S~d~~eAk~~L~~~~~~~~~~~~~~~  432 (910)
                      +|+++|++|++||++|++||++|+|+|+++|+||||||++|+.+||+||++||+|+++.   .+||++            
T Consensus       316 ~l~eiL~~f~~~R~evi~rR~~~~L~k~~~rl~ilegl~~a~~~iD~vI~iIr~s~~~~---~~l~~~------------  380 (716)
T 1zvu_A          316 NLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPK---PALMSR------------  380 (716)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSHH---HHHHHS------------
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH---HHHHHH------------
T ss_conf             79999999999999999999999999999999999829999983999999996588558---999985------------


Q ss_pred             HCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             40221112223445236999999999878999988879999998999999999887530498999999999899999840
Q gi|254780182|r  433 LIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDEL  512 (910)
Q Consensus       433 ~~~~~~~~~~~~~~f~lSe~QA~AILdMrL~rLt~LE~~kl~~E~~eL~~~I~~l~~IL~s~~~l~~iI~~EL~eik~ky  512 (910)
                                    |+|||.||+|||+|||||||+||++||++|+++|.++|++|++||+|+++++++|++||.+++++|
T Consensus       381 --------------f~~se~Qa~aIL~mrL~~Lt~le~~kl~~E~~~l~~~i~~l~~IL~s~~~l~~~I~~EL~elkkkf  446 (716)
T 1zvu_A          381 --------------FGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAY  446 (716)
T ss_dssp             --------------TTCCTTHHHHHHTCCGGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHH
T ss_pred             --------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             --------------599989999999757878778889999999999999999997420488898999998999999971


Q ss_pred             CCCCCCEEECCC--CCCCCCCCCCCCCEEEEEECCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHEEEEEECCCCEEE
Q ss_conf             568833100134--345301014567818999079705233100000233456521100014641010113323777399
Q gi|254780182|r  513 DTPRRTRIVEGL--LDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL  590 (910)
Q Consensus       513 gd~RRT~I~~~~--~~i~~EdlI~~E~vvV~lS~~GyIKr~~~~~yr~Q~RggkG~~~~~~ke~D~v~~~~~~~t~d~LL  590 (910)
                      |++|||.|.+..  .+++.+++|++|+++|++|+.|||||++.++|+.|        +++++++|.+.+++.|+|||+|+
T Consensus       447 gd~RRT~i~~~~~~~~~~~edli~~e~v~V~ls~~GyIkr~~~~~~~~~--------~~~~k~~D~~~~~~~~~t~d~ll  518 (716)
T 1zvu_A          447 GDDRRSPLQEREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAP--------GLNYKAGDSFKAAVKGKSNQPVV  518 (716)
T ss_dssp             CCCCCSCBCCCCCCCCCCSSTTSCCCCCCEEEETTTEEEECCC-----------------------CCEEECCCSSSCEE
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHCCCCCEEEEECCCCEEEECCCCCCCCC--------CCCCCCCCCCEEEEEEECCCCEE
T ss_conf             8988742214532245788780767650688636876862367765544--------54232366534789971576406


Q ss_pred             EEECCCCEEEEECCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEECCCCCCCCCCEEEEEECCCCEEEECHHHHHHCCC
Q ss_conf             99548939998200043224445655412454536556200256630125666871799994799189842368620477
Q gi|254780182|r  591 FFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINR  670 (910)
Q Consensus       591 fFTs~Gkvy~l~v~~IP~~sr~skG~pi~nll~l~~~E~I~ail~~~~~~~~~~~~~Lvl~Tk~G~VKkt~l~ef~~~r~  670 (910)
                      |||+.||||++++|+||++  +++|.|+.|+++++++|+|++++++.      ++.+++|+|++|++||+++++|.+.++
T Consensus       519 ~fT~~Grvy~l~v~~lP~~--~~kG~pi~~~l~l~~~E~I~~i~~~~------~d~~lll~T~~G~~K~~~l~~~~~~~k  590 (716)
T 1zvu_A          519 FVDSTGRSYAIDPITLPSA--RGQGEPLTGKLTLPPGATVDHMLMES------DDQKLLMASDAGYGFVCTFNDLVARNR  590 (716)
T ss_dssp             EEETTSEEEEECTTTSCCC--C---CBSTTTSCCCTTCCEEEEECCC------TTCEEEEEBTTSEEEEEEGGGGCCCST
T ss_pred             EECCCCCEEEEEEEECCCC--CCCCCCCCCCCCCCCCCEEEEEEECC------CCCEEEEEECCCCEEEEEHHHHCCCCC
T ss_conf             8835882799741457677--67886543410479998489987327------886799997589589985136105475


Q ss_pred             CCEEEEEECCCCEEEEEEECCC-CCEEEEEECCCEEEEEEHHHCCCCCCCCCCCEEEEECCC------CCEEEEEEEECC
Q ss_conf             7227866158985788896189-826999936985999758762354786655357675289------986999897336
Q gi|254780182|r  671 SGKIAMKLDSRDEILSVETCTQ-ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAK------GDQVISMAIVLH  743 (910)
Q Consensus       671 ~G~~aikLkegD~Li~v~~~~~-~~~Iil~T~~G~~lrF~~~evr~~~GR~a~GVkgIkL~~------~D~Vv~~~vi~~  743 (910)
                      +|+.||+|++||+|+.|..+++ +++|+++|++|++|||++++||+| || ++||+||+|++      +|.|+++.++++
T Consensus       591 ~Gk~aikLke~Deli~~~~~~~~~d~vl~vT~~Gk~lrF~~~ev~~~-gr-g~GVkgikL~~~~~~~~~d~v~~~~v~~~  668 (716)
T 1zvu_A          591 AGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDLPQL-SK-GKGNKIINIPSAEAARGEDGLAQLYVLPP  668 (716)
T ss_dssp             TCEECBCCCTTCCBCCCEECCCTTCEEEEEETTSEEEEEESTTSCBC-SS-BSCEESSCCCHHHHHTTSSCEEEEEEECS
T ss_pred             CCCEEEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEEEHHHCCCC-CC-CCCCCEEECCCCCCCCCCCEEEEEEEECC
T ss_conf             77377876899889989996599988999888982999788998865-75-47712073065555567855999999779


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEEECCCCEEEEEHH-HCCCCCC
Q ss_conf             665420000012223333333455544444444333222223200111012568679999759934530178-8486675
Q gi|254780182|r  744 ADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSY-DFRISNR  822 (910)
Q Consensus       744 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~IL~vTe~G~GKRt~~~-eyr~q~R  822 (910)
                      .                                                     ..++++|++|++|+++.+ +|+.++|
T Consensus       669 ~-----------------------------------------------------~~llv~t~~g~~k~~~~~~~~~~~~R  695 (716)
T 1zvu_A          669 Q-----------------------------------------------------STLTIHVGKRKIKLRPEELQKVTGER  695 (716)
T ss_dssp             S-----------------------------------------------------CCEEEEETTEEEEECHHHHTTSBCCT
T ss_pred             C-----------------------------------------------------CEEEEEECCCEEEECHHHHHHHCCCC
T ss_conf             9-----------------------------------------------------86999988980785878830201787


Q ss_pred             CCCCEEEEECCC
Q ss_conf             774148876067
Q gi|254780182|r  823 SGKGIRATDVSK  834 (910)
Q Consensus       823 GgkGv~~ik~~~  834 (910)
                      ||+|++.+++.+
T Consensus       696 g~kG~~~~~~~k  707 (716)
T 1zvu_A          696 GRRGTLMRGLQR  707 (716)
T ss_dssp             TSCCEECTTCCS
T ss_pred             CCCCCCCCCCCC
T ss_conf             888879977766



>2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Back     alignment and structure
>3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, struct genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} PDB: 3ifz_A* Back     alignment and structure
>2nov_A DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, GRAM-positive bacteria, quinolone target, DNA binding, DNA cleavage; HET: DNA; 2.67A {Streptococcus pneumoniae} PDB: 3foe_A* 3fof_A* 3k9f_A* 3ksa_A* 3ksb_A* 3ltn_A* Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Back     alignment and structure