254780183

254780183

single-strand binding protein (ssb)

GeneID in NCBI database:8209163Locus tag:CLIBASIA_00330
Protein GI in NCBI database:254780183Protein Accession:YP_003064596.1
Gene range:-(65616, 66095)Protein Length:159aa
Gene description:single-strand binding protein (ssb)
COG prediction:[L] Single-stranded DNA-binding protein
KEGG prediction:single-strand binding protein (ssb); K03111 single-strand DNA-binding protein
SEED prediction:Single-stranded DNA-binding protein
Pathway involved in KEGG:DNA replication [PATH:las03030]
Mismatch repair [PATH:las03430]
Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA repair, bacterial RecFOR pathway;
DNA repair, bacterial UmuCD system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF
ccccccEEEEEEEEccccEEEEcccccEEEEEEEEEcccEEccccccEEEccEEEEEEEEccHHHHHHHHHHccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEEEEEEEccccEEEEcccccEEEEEEEEEEEEEccccccccEEEEEEEEEEEEcHHHHHHHHHHcccccEEEEEEEEEEEEEccccccEEEEEEEEccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
MVASLNKVILIGnlgadpdvrhtqdgrKIVNIRIatsdswkdrvtnerrektewHSVIVFSEELCRIVEQYLRKGSKVYIEGSlqtrkwqdqsgnnrytTEIIMRSMVMLdgrrdslqgeeqrseqhsnnlkenvvgnrysspreesvfsdelddeipf
MVASLNKVILignlgadpdvrhtqdgrkivniriatsdswkdrvtnerrektewhsvivfSEELCRIVEQYLRKGSKVyiegslqtrkwqdqsgnnrytteIIMRSMVMLDGRRDSLQGEeqrseqhsnnlkenvvgnrysspreesvfsdelddeipf
MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF
***SLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWK*****ERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSM*********************************************LDDEIPF
MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRR***************NLKENVVGN*********************
**ASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLD************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRxxxxxxxxxxxxxxxxxxxxxVVGNRYSSPREESVFSDELDDEIPF
MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF
MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target159 single-strand binding protein (ssb) [Candidatus Liberib
254780564107 hypothetical protein CLIBASIA_02255 [Candidatus Li 0.038
>gi|254780564|ref|YP_003064977.1| hypothetical protein CLIBASIA_02255 [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Back     alignment
 Score = 29.3 bits (64), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 64  LCRIVEQYLRKGSKVY--IEGSLQTRKWQDQSGNNRYTTEII 103
           L  IV+QY+      Y  I+G +  RK+ DQ+  NR + E+I
Sbjct: 58  LLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI 99

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target159 single-strand binding protein (ssb) [Candidatus Liberib
315122781155 single-strand binding protein (ssb) [Candidatus Liberib 1 1e-66
49474367172 single-strand binding protein (ssb) [Bartonella quintan 1 3e-45
315364701193 Chain A, Crystal Structure Of A Single Strand Binding P 1 6e-45
146276503162 single-strand binding protein [Rhodobacter sphaeroides 1 7e-45
49475757172 single-strand binding protein (ssb) [Bartonella hensela 1 1e-44
240850766168 single-strand binding protein [Bartonella grahamii as4a 1 5e-44
121601719177 single-stranded DNA-binding protein [Bartonella bacilli 1 6e-44
15965311174 single-strand DNA-binding protein [Sinorhizobium melilo 1 2e-43
241204652169 single-stranded DNA-binding protein [Rhizobium legumino 1 4e-43
116252151169 single-stranded DNA-binding protein [Rhizobium legumino 1 4e-43
>gi|315122781|ref|YP_004063270.1| single-strand binding protein (ssb) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 155 Back     alignment and organism information
 Score =  255 bits (652), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/159 (76%), Positives = 146/159 (91%), Gaps = 4/159 (2%)

Query: 1   MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVF 60
           MVAS+NKVILIGNLGADPDVRHTQDGR+IVNIR+ATS++WKDRVT ERREKTEWHSV+VF
Sbjct: 1   MVASVNKVILIGNLGADPDVRHTQDGRRIVNIRVATSENWKDRVTGERREKTEWHSVVVF 60

Query: 61  SEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGE 120
            EEL ++VEQYL+KGSKVYIEGS+QTRKWQDQSGN RYTTEIIMR+MVMLDGR+DS QG 
Sbjct: 61  VEELGKVVEQYLKKGSKVYIEGSIQTRKWQDQSGNTRYTTEIIMRNMVMLDGRKDSPQG- 119

Query: 121 EQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF 159
              ++++++N K+N+V NRYSS  +++VFSD+LDDEIPF
Sbjct: 120 ---NQENNDNSKDNIVENRYSSLSKDNVFSDDLDDEIPF 155


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|49474367|ref|YP_032409.1| single-strand binding protein (ssb) [Bartonella quintana str. Toulouse] Length = 172 Back     alignment and organism information
>gi|315364701|pdb|3PGZ|A Chain A, Crystal Structure Of A Single Strand Binding Protein (Ssb) From Bartonella Henselae Length = 193 Back     alignment and organism information
>gi|146276503|ref|YP_001166662.1| single-strand binding protein [Rhodobacter sphaeroides ATCC 17025] Length = 162 Back     alignment and organism information
>gi|49475757|ref|YP_033798.1| single-strand binding protein (ssb) [Bartonella henselae str. Houston-1] Length = 172 Back     alignment and organism information
>gi|240850766|ref|YP_002972166.1| single-strand binding protein [Bartonella grahamii as4aup] Length = 168 Back     alignment and organism information
>gi|121601719|ref|YP_989034.1| single-stranded DNA-binding protein [Bartonella bacilliformis KC583] Length = 177 Back     alignment and organism information
>gi|15965311|ref|NP_385664.1| single-strand DNA-binding protein [Sinorhizobium meliloti 1021] Length = 174 Back     alignment and organism information
>gi|241204652|ref|YP_002975748.1| single-stranded DNA-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 169 Back     alignment and organism information
>gi|116252151|ref|YP_767989.1| single-stranded DNA-binding protein [Rhizobium leguminosarum bv. viciae 3841] Length = 169 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target159 single-strand binding protein (ssb) [Candidatus Liberib
PRK06341166 PRK06341, PRK06341, single-stranded DNA-binding protein 6e-53
PRK09010177 PRK09010, PRK09010, single-stranded DNA-binding protein 6e-40
PRK06642152 PRK06642, PRK06642, single-stranded DNA-binding protein 2e-38
PRK06863168 PRK06863, PRK06863, single-stranded DNA-binding protein 7e-38
TIGR00621164 TIGR00621, ssb, single stranded DNA-binding protein (ss 6e-34
PRK05733172 PRK05733, PRK05733, single-stranded DNA-binding protein 4e-32
COG0629167 COG0629, Ssb, Single-stranded DNA-binding protein [DNA 2e-29
PRK08763164 PRK08763, PRK08763, single-stranded DNA-binding protein 4e-29
PRK08486182 PRK08486, PRK08486, single-stranded DNA-binding protein 2e-18
PRK07275162 PRK07275, PRK07275, single-stranded DNA-binding protein 2e-08
PRK06293161 PRK06293, PRK06293, single-stranded DNA-binding protein 1e-07
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding protein 2e-38
PRK13732175 PRK13732, PRK13732, single-stranded DNA-binding protein 6e-28
cd04496100 cd04496, SSB_OBF, SSB_OBF: A subfamily of OB folds simi 1e-24
KOG1653175 KOG1653, KOG1653, KOG1653, Single-stranded DNA-binding 2e-15
PRK06751173 PRK06751, PRK06751, single-stranded DNA-binding protein 2e-11
PRK07459121 PRK07459, PRK07459, single-stranded DNA-binding protein 8e-09
PRK06752112 PRK06752, PRK06752, single-stranded DNA-binding protein 2e-08
PRK07274131 PRK07274, PRK07274, single-stranded DNA-binding protein 2e-08
PRK07772186 PRK07772, PRK07772, single-stranded DNA-binding protein 5e-08
pfam00436104 pfam00436, SSB, Single-strand binding protein family 4e-30
>gnl|CDD|180534 PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181610 PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|135984 PRK06642, PRK06642, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|136097 PRK06863, PRK06863, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|161963 TIGR00621, ssb, single stranded DNA-binding protein (ssb) Back     alignment and domain information
>gnl|CDD|168214 PRK05733, PRK05733, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|30974 COG0629, Ssb, Single-stranded DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181549 PRK08763, PRK08763, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181446 PRK08486, PRK08486, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180915 PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180517 PRK06293, PRK06293, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184284 PRK13732, PRK13732, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72968 cd04496, SSB_OBF, SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>gnl|CDD|36866 KOG1653, KOG1653, KOG1653, Single-stranded DNA-binding protein [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|168659 PRK06751, PRK06751, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180986 PRK07459, PRK07459, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|168660 PRK06752, PRK06752, single-stranded DNA-binding protein; Validated Back     alignment and domain information
>gnl|CDD|180914 PRK07274, PRK07274, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181110 PRK07772, PRK07772, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|109492 pfam00436, SSB, Single-strand binding protein family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 159 single-strand binding protein (ssb) [Candidatus Liberib
PRK06958181 single-stranded DNA-binding protein; Provisional 100.0
PRK05733172 single-stranded DNA-binding protein; Provisional 100.0
PRK09010178 single-stranded DNA-binding protein; Provisional 100.0
PRK13732175 single-stranded DNA-binding protein; Provisional 100.0
PRK08486180 single-stranded DNA-binding protein; Provisional 100.0
PRK07772183 single-stranded DNA-binding protein; Provisional 100.0
PRK07275163 single-stranded DNA-binding protein; Provisional 100.0
PRK06751172 single-stranded DNA-binding protein; Provisional 100.0
PRK06293161 single-stranded DNA-binding protein; Provisional 100.0
PRK07274131 single-stranded DNA-binding protein; Provisional 100.0
PRK07459121 single-stranded DNA-binding protein; Provisional 100.0
PRK06752112 single-stranded DNA-binding protein; Validated 100.0
COG0629167 Ssb Single-stranded DNA-binding protein [DNA replicatio 100.0
TIGR00621180 ssb single-strand binding protein; InterPro: IPR011344 99.98
PRK05853168 hypothetical protein; Validated 99.97
pfam00436104 SSB Single-strand binding protein family. This family i 99.97
cd04496100 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the 99.94
KOG1653175 consensus 99.76
PRK05813217 single-stranded DNA-binding protein; Provisional 99.44
PRK02801101 primosomal replication protein N; Provisional 98.59
COG2965103 PriB Primosomal replication protein N [DNA replication, 97.83
PRK00036107 primosomal replication protein N; Reviewed 97.74
PRK05813217 single-stranded DNA-binding protein; Provisional 97.34
PRK07373447 DNA polymerase III subunit alpha; Reviewed 96.11
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 95.98
pfam0133675 tRNA_anti OB-fold nucleic acid binding domain. This fam 95.93
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds co 95.71
PRK00286 443 xseA exodeoxyribonuclease VII large subunit; Reviewed 95.44
PRK078921180 consensus 95.18
PRK089571159 consensus 95.06
PRK068261157 dnaE DNA polymerase III DnaE; Reviewed 95.05
PRK00448 1436 polC DNA polymerase III PolC; Validated 94.88
COG1570 440 XseA Exonuclease VII, large subunit [DNA replication, r 94.56
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds si 94.43
PRK056731143 dnaE DNA polymerase III subunit alpha; Validated 94.31
PRK066581145 consensus 94.26
PRK066371182 consensus 94.13
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 93.41
PRK090741149 consensus 92.65
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, antico 92.47
PRK13480 314 3'-5' exoribonuclease YhaM; Provisional 92.29
PRK073741171 dnaE DNA polymerase III subunit alpha; Validated 92.07
PRK072791033 dnaE DNA polymerase III DnaE; Reviewed 91.73
PRK070121173 consensus 91.65
PRK06863168 single-stranded DNA-binding protein; Provisional 100.0
PRK06341165 single-stranded DNA-binding protein; Provisional 100.0
PRK08763160 single-stranded DNA-binding protein; Provisional 100.0
PRK06642152 single-stranded DNA-binding protein; Provisional 100.0
PRK08182148 single-stranded DNA-binding protein; Provisional 100.0
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds correspondin 96.53
PRK07211473 replication factor A; Reviewed 94.73
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligonucle 92.4
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds correspo 91.32
>PRK06958 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK05733 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK09010 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK13732 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08486 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07772 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07275 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06751 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06293 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07274 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07459 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06752 single-stranded DNA-binding protein; Validated Back     alignment and domain information
>COG0629 Ssb Single-stranded DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00621 ssb single-strand binding protein; InterPro: IPR011344 All proteins in this family, for which functions are known, are single-stranded DNA-binding proteins that function in many processes including transcription, repair, replication and recombination Back     alignment and domain information
>PRK05853 hypothetical protein; Validated Back     alignment and domain information
>pfam00436 SSB Single-strand binding protein family Back     alignment and domain information
>cd04496 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>KOG1653 consensus Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK02801 primosomal replication protein N; Provisional Back     alignment and domain information
>COG2965 PriB Primosomal replication protein N [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00036 primosomal replication protein N; Reviewed Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>pfam01336 tRNA_anti OB-fold nucleic acid binding domain Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PRK07892 consensus Back     alignment and domain information
>PRK08957 consensus Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK06658 consensus Back     alignment and domain information
>PRK06637 consensus Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK09074 consensus Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK07012 consensus Back     alignment and domain information
>PRK06863 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06341 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08763 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06642 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08182 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target159 single-strand binding protein (ssb) [Candidatus Liberib
1eqq_A178 Single Stranded Dna Binding Protein And Ssdna Compl 7e-29
3pgz_A193 Crystal Structure Of A Single Strand Binding Protei 2e-28
1kaw_A135 Structure Of Single Stranded Dna Binding Protein (S 1e-24
1ue1_A164 Crystal Structure Of The Single-Stranded Dna-Bindin 2e-22
1x3e_A165 Crystal Structure Of The Single-Stranded Dna-Bindin 3e-21
3afp_A168 Crystal Structure Of The Single-Stranded Dna Bindin 1e-19
1z9f_A153 Crystal Structure Of Single Stranded Dna-Binding Pr 2e-16
1se8_A301 Structure Of Single-Stranded Dna-Binding Protein (S 4e-16
1se8_A 301 Structure Of Single-Stranded Dna-Binding Protein (S 2e-09
2vw9_A134 Single Stranded Dna Binding Protein Complex From He 1e-14
2fxq_A264 Single-Stranded Dna-Binding Protein From Thermus Aq 4e-14
2cwa_A263 Crystal Structure Of The Single-Stranded Dna Bindin 5e-13
1qvc_A145 Crystal Structure Analysis Of Single Stranded Dna B 3e-24
1eyg_A116 Crystal Structure Of Chymotryptic Fragment Of E. Co 6e-24
1sru_A113 Crystal Structure Of Full Length E. Coli Ssb Protei 1e-22
3a5u_A130 Promiscuity And Specificity In Dna Binding To Ssb: 4e-18
3lgj_A169 Crystal Structure Of Single-Stranded Binding Protei 5e-17
3eiv_A199 Crystal Structure Of Single-Stranded Dna-Binding Pr 3e-16
2dud_A133 Crystal Structure Of Human Mitochondrial Single-Str 2e-14
3ull_A132 Human Mitochondrial Single-Stranded Dna Binding Pro 2e-14
2fxq_A 264 Single-Stranded Dna-Binding Protein From Thermus Aq 2e-12
2cwa_A 263 Crystal Structure Of The Single-Stranded Dna Bindin 6e-09
2ihf_A239 Crystal Structure Of Deletion Mutant Delta 228-252 2e-12
2ihf_A239 Crystal Structure Of Deletion Mutant Delta 228-252 3e-11
gi|37926356|pdb|1EQQ|A Chain A, Single Stranded Dna Binding Protein And Ssdna Complex Length = 178 Back     alignment and structure
 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 68/179 (37%), Positives = 97/179 (54%), Gaps = 21/179 (11%)

Query: 1   MV-ASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIV 59
           M    +NKVIL+GNLG DP+VR+  +G  + NI +ATS+SW+D+ T E +E+TEWH V V
Sbjct: 1   MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRV-V 59

Query: 60  FSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMR---SMVMLDGRRDS 116
              +L  +  +YLRKGS+VYIEG L+TRKW DQSG +RYTTE+++    +M ML GR+  
Sbjct: 60  LFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGG 119

Query: 117 LQGEEQRSEQHSN----------------NLKENVVGNRYSSPREESVFSDELDDEIPF 159
                                        +        + +     +    + DD+IPF
Sbjct: 120 GAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF 178


>gi|315364701|pdb|3PGZ|A Chain A, Crystal Structure Of A Single Strand Binding Protein (Ssb) From Bartonella Henselae Length = 193 Back     alignment and structure
>gi|2780885|pdb|1KAW|A Chain A, Structure Of Single Stranded Dna Binding Protein (Ssb) Length = 135 Back     alignment and structure
gi|46015798|pdb|1UE1|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis Length = 164 Back     alignment and structure
gi|75765436|pdb|1X3E|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Smegmatis Length = 165 Back     alignment and structure
gi|308198445|pdb|3AFP|A Chain A, Crystal Structure Of The Single-Stranded Dna Binding Protein From Mycobacterium Leprae (Form I) Length = 168 Back     alignment and structure
>gi|66361394|pdb|1Z9F|A Chain A, Crystal Structure Of Single Stranded Dna-Binding Protein (Tm0604) From Thermotoga Maritima At 2.60 A Resolution Length = 153 Back     alignment and structure
>gi|50513525|pdb|1SE8|A Chain A, Structure Of Single-Stranded Dna-Binding Protein (Ssb) From D. Radiodurans Length = 301 Back     alignment and structure
>gi|50513525|pdb|1SE8|A Chain A, Structure Of Single-Stranded Dna-Binding Protein (Ssb) From D. Radiodurans Length = 301 Back     alignment and structure
>gi|238828079|pdb|2VW9|A Chain A, Single Stranded Dna Binding Protein Complex From Helicobacter Pylori Length = 134 Back     alignment and structure
gi|90109725|pdb|2FXQ|A Chain A, Single-Stranded Dna-Binding Protein From Thermus Aquaticus Length = 264 Back     alignment and structure
>gi|85544428|pdb|2CWA|A Chain A, Crystal Structure Of The Single-Stranded Dna Binding Protein From Thermus Thermophilus Hb8 Length = 263 Back     alignment and structure
>gi|8569289|pdb|1QVC|A Chain A, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli Length = 145 Back     alignment and structure
>gi|9954963|pdb|1EYG|A Chain A, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas Length = 116 Back     alignment and structure
>gi|51247433|pdb|1SRU|A Chain A, Crystal Structure Of Full Length E. Coli Ssb Protein Length = 113 Back     alignment and structure
>gi|303324825|pdb|3A5U|A Chain A, Promiscuity And Specificity In Dna Binding To Ssb: Insights From The Structure Of The Mycobacterium Smegmatis Ssb-Ssdna Complex Length = 130 Back     alignment and structure
>gi|288965853|pdb|3LGJ|A Chain A, Crystal Structure Of Single-Stranded Binding Protein (Ssb) From Bartonella Henselae Length = 169 Back     alignment and structure
gi|257471775|pdb|3EIV|A Chain A, Crystal Structure Of Single-Stranded Dna-Binding Protein From Streptomyces Coelicolor Length = 199 Back     alignment and structure
>gi|126030307|pdb|2DUD|A Chain A, Crystal Structure Of Human Mitochondrial Single-Stranded Dna-Binding Protein(Hmtssb) Length = 133 Back     alignment and structure
>gi|2624694|pdb|3ULL|A Chain A, Human Mitochondrial Single-Stranded Dna Binding Protein Length = 132 Back     alignment and structure
gi|90109725|pdb|2FXQ|A Chain A, Single-Stranded Dna-Binding Protein From Thermus Aquaticus Length = 264 Back     alignment and structure
>gi|85544428|pdb|2CWA|A Chain A, Crystal Structure Of The Single-Stranded Dna Binding Protein From Thermus Thermophilus Hb8 Length = 263 Back     alignment and structure
>gi|122920609|pdb|2IHF|A Chain A, Crystal Structure Of Deletion Mutant Delta 228-252 R190a Of The Single-Stranded Dna Binding Protein From Thermus Aquaticus Length = 239 Back     alignment and structure
>gi|122920609|pdb|2IHF|A Chain A, Crystal Structure Of Deletion Mutant Delta 228-252 R190a Of The Single-Stranded Dna Binding Protein From Thermus Aquaticus Length = 239 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target159 single-strand binding protein (ssb) [Candidatus Liberib
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT scratch 4e-38
1se8_A 301 Single-strand binding protein; DNA binding protein; 1.8 2e-36
1se8_A301 Single-strand binding protein; DNA binding protein; 1.8 1e-26
3k81_C164 MP18 RNA editing complex protein; krepa6, single domain 6e-34
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quaternar 5e-33
1eqq_A178 Single stranded DNA binding protein; beta barrel, prote 1e-32
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-editing 3e-31
2fxq_A 264 Single-strand binding protein; strand beta-sheet extend 2e-30
2fxq_A264 Single-strand binding protein; strand beta-sheet extend 8e-18
1x3e_A165 Single-strand binding protein; oligonucleotide binding 8e-30
1z9f_A153 Single-strand binding protein; TM0604, single stranded 2e-24
2vw9_A134 Single-stranded DNA binding protein; DNA replication, s 1e-21
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, DNA 1e-33
1qvc_A145 Single stranded DNA binding protein monomer; beta-barre 4e-28
3koj_A108 Uncharacterized protein YCF41; single-strand binding pr 9e-27
3ull_A132 DNA binding protein; DNA replication, mitochondrion, tr 8e-25
1v1q_A134 Primosomal replication protein N; primosome, DNA replic 1e-18
1txy_A104 Primosomal replication protein N; OB fold, dimer, DNA b 2e-18
3k8a_A103 Putative primosomal replication protein; beta-barrel, O 2e-17
3en2_A101 Probable primosomal replication protein N; PRIB RSR213C 3e-16
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RAY NES 6e-15
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Length = 169 Back     alignment and structure
 Score =  152 bits (384), Expect = 4e-38
 Identities = 64/159 (40%), Positives = 95/159 (59%), Gaps = 16/159 (10%)

Query: 5   LNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEEL 64
           LNKV+LIG LG DP+ +    G ++VN R+AT +S+ ++ T+++ EKTEWHSV+VF+   
Sbjct: 23  LNKVMLIGYLGDDPESKTMTSGAEVVNFRMATFESYMNKNTHQKVEKTEWHSVVVFNPHF 82

Query: 65  CRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMR----SMVMLDGRRDSLQGE 120
            +I  QYL KGSKVYIEG LQTRKWQD++G++RYTTEI++      + +LD +++     
Sbjct: 83  AKIALQYLHKGSKVYIEGKLQTRKWQDKNGHDRYTTEIVLPQYKGELHLLDAKKEQSASS 142

Query: 121 EQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF 159
              + Q             Y+       +     D +PF
Sbjct: 143 SSVTSQ------------SYAIASGADDYGISAHDSMPF 169


>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Length = 301 Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Length = 301 Back     alignment and structure
>3k81_C MP18 RNA editing complex protein; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Trypanosoma brucei} Length = 164 Back     alignment and structure
>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Length = 168 Back     alignment and structure
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Length = 178 Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D Length = 148 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Length = 264 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Length = 264 Back     alignment and structure
>1x3e_A Single-strand binding protein; oligonucleotide binding fold, DNA-binding protein, DNA binding protein; 2.15A {Mycobacterium smegmatis} PDB: 1x3f_A 1x3g_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A Length = 165 Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Length = 153 Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Length = 134 Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Length = 199 Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Length = 145 Back     alignment and structure
>3koj_A Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Length = 108 Back     alignment and structure
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Length = 132 Back     alignment and structure
>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Length = 134 Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A Length = 104 Back     alignment and structure
>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Length = 103 Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Length = 101 Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein structure initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Length = 115 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 single-strand binding protein (ssb) [Candidatus Liberib
1se8_A301 Single-strand binding protein; DNA binding protein; 1.8 100.0
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quaternar 100.0
1eqq_A178 Single stranded DNA binding protein; beta barrel, prote 100.0
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, DNA 100.0
2fxq_A264 Single-strand binding protein; strand beta-sheet extend 100.0
1qvc_A145 Single stranded DNA binding protein monomer; beta-barre 100.0
3ull_A132 DNA binding protein; DNA replication, mitochondrion, tr 100.0
2fxq_A 264 Single-strand binding protein; strand beta-sheet extend 100.0
2vw9_A134 Single-stranded DNA binding protein; DNA replication, s 100.0
1se8_A 301 Single-strand binding protein; DNA binding protein; 1.8 100.0
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-editing 99.97
3k81_C164 MP18 RNA editing complex protein; krepa6, single domain 99.97
3koj_A108 Uncharacterized protein YCF41; single-strand binding pr 99.94
1v1q_A134 Primosomal replication protein N; primosome, DNA replic 99.93
1txy_A104 Primosomal replication protein N; OB fold, dimer, DNA b 99.9
3k8a_A103 Putative primosomal replication protein; beta-barrel, O 99.89
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RAY NES 99.85
3en2_A101 Probable primosomal replication protein N; PRIB RSR213C 99.85
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA polyme 95.45
2hpi_A1220 DNA polymerase III alpha subunit; POL-beta-like nucleot 94.86
1z9f_A153 Single-strand binding protein; TM0604, single stranded 100.0
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT scratch 100.0
2k50_A115 Replication factor A related protein; uncharacterized p 93.0
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
Probab=100.00  E-value=2.6e-39  Score=253.10  Aligned_cols=113  Identities=29%  Similarity=0.578  Sum_probs=104.6

Q ss_pred             CCCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCEEECEEEECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             98778379999642588667986999869999998345642026884530112430211015898772211047715999
Q gi|254780183|r    1 MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYI   80 (159)
Q Consensus         1 mm~~mN~v~l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~~~~~~~~d~t~~~~v~~~g~~~Ae~~~~~l~KG~~V~V   80 (159)
                      |+.+||+|+|+|||++|||+|++++|.++++|+||++++|+|+. ++|++.|+||+|++||+ +|+++ +||+||++|+|
T Consensus       125 m~~~~N~V~l~G~l~~dpe~r~t~~G~~~~~f~la~~~~~~~~~-g~~~~~t~~~~v~~w~~-~Ae~~-~~l~KG~~V~V  201 (301)
T 1se8_A          125 MSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQDRQ-GQRQEKVHYIDATLWRD-LAENM-KELRKGDPVMI  201 (301)
T ss_dssp             EETCEEEEEEEEEECSCCEEEECTTCCEEEEEEEEEEEEEECTT-SCEEEEEEEEEEEEETH-HHHHH-TTCCTTCEEEE
T ss_pred             CCCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCEECCC-CCEEEEEEEEEEEEECE-EEEEE-EEECCCCEEEE
T ss_conf             01475189999886998679999999889999999889879899-97874318999999763-46875-11338948999


Q ss_pred             EECCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCC
Q ss_conf             841333332046883768899999776984667776
Q gi|254780183|r   81 EGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDS  116 (159)
Q Consensus        81 ~Grl~~~~~~~kdG~~r~~~~V~a~~i~~l~~~~~~  116 (159)
                      +|||++++|++++|++|+.++|+|++|.||..+...
T Consensus       202 ~G~l~~~~~~~~dG~~r~~~~i~a~~v~~l~~~~~~  237 (301)
T 1se8_A          202 MGRLVNEGWTDKDGNKRNSTRVEATRVEALARGAGN  237 (301)
T ss_dssp             EEEEEEEECC------CEEEEEEEEEEEECCC----
T ss_pred             EEEEEEEEEECCCCCEEEEEEEEEEEEEECCCCCCC
T ss_conf             987333365758996899999999999986577777



>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Back     alignment and structure
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} PDB: 3a5u_A* Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Back     alignment and structure
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D Back     alignment and structure
>3k81_C MP18 RNA editing complex protein; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Trypanosoma brucei} Back     alignment and structure
>3koj_A Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A Back     alignment and structure
>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein structure initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 159 single-strand binding protein (ssb) [Candidatus Liberib
d1se8a_231 b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiod 3e-32
d1qvca_145 b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [ 1e-26
d1v1qa_111 b.40.4.3 (A:) Primosomal replication protein N, PriB {E 3e-18
d1se8a_231 b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiod 2e-24
d1ue1a_118 b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tube 1e-24
d3ulla_115 b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapien 4e-23
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Length = 231 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: ssDNA-binding protein
species: Deinococcus radiodurans [TaxId: 1299]
 Score =  131 bits (330), Expect = 3e-32
 Identities = 34/140 (24%), Positives = 57/140 (40%), Gaps = 1/140 (0%)

Query: 4   SLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEE 63
            +N V LIG L  DP++R+T +G  +    +A  D          R    +H V +  + 
Sbjct: 2   GMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGN-DGRERNLPWYHRVSILGKP 60

Query: 64  LCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQR 123
                E+ L+ G  V +EG+L+ R+W+   G  R    +    M  L  + + +Q     
Sbjct: 61  AEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGG 120

Query: 124 SEQHSNNLKENVVGNRYSSP 143
                   +  V+GN    P
Sbjct: 121 VRMSGAMNEVLVLGNVTRDP 140


>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Length = 231 Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Length = 115 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 single-strand binding protein (ssb) [Candidatus Liberib
d1qvca_145 ssDNA-binding protein {Escherichia coli [TaxId: 562]} 100.0
d3ulla_115 ssDNA-binding protein {Human (Homo sapiens), mitochondr 100.0
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [TaxId: 100.0
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [TaxId: 99.97
d1ue1a_118 ssDNA-binding protein {Mycobacterium tuberculosis [TaxI 99.97
d1v1qa_111 Primosomal replication protein N, PriB {Escherichia col 99.93
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccha 90.92
d1jmca1116 Replication protein A 70 KDa subunit (RPA70) {Human (Ho 90.53
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: ssDNA-binding protein
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=7.9e-35  Score=225.02  Aligned_cols=114  Identities=54%  Similarity=1.011  Sum_probs=105.1

Q ss_pred             CCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCEEECEEEECCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             87783799996425886679869998699999983456420268845301124302110158987722110477159998
Q gi|254780183|r    2 VASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIE   81 (159)
Q Consensus         2 m~~mN~v~l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~~~~~~~~d~t~~~~v~~~g~~~Ae~~~~~l~KG~~V~V~   81 (159)
                      ..+||+|+|+|||++|||+|++++|.++++|+||++++|+++.+++|++.|+||+|++|++ +|+++.+||+||++|+|+
T Consensus         2 ~~~mN~v~LiG~l~~dpe~r~~~~G~~v~~f~va~~~~~~~~~~~~~~~~t~w~~v~~~g~-~Ae~~~~~l~KG~~V~V~   80 (145)
T d1qvca_           2 SRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGK-LAEVASEYLRKGSQVYIE   80 (145)
T ss_dssp             CCCEEEEEEEEEESSCCEEECCSSSCCEEEEEEEECCCCSCCSSSSCCCCCEEEEEEEETH-HHHHHHHHCCTTCEEEEE
T ss_pred             CCCCEEEEEEEECCCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEECC-HHHHHHHHCCCCCEEEEE
T ss_conf             8760299999988879889888999989999987244534456544323404772587320-145676540357789999


Q ss_pred             ECCCCCCCCCCCCCEEEEEEEEEE---EEEECCCCCCC
Q ss_conf             413333320468837688999997---76984667776
Q gi|254780183|r   82 GSLQTRKWQDQSGNNRYTTEIIMR---SMVMLDGRRDS  116 (159)
Q Consensus        82 Grl~~~~~~~kdG~~r~~~~V~a~---~i~~l~~~~~~  116 (159)
                      |+|++++|+++||++|+.++|+|+   .+.+|.++...
T Consensus        81 G~l~~~~~~~kdG~~r~~~ei~~~~~~~l~~l~~r~~~  118 (145)
T d1qvca_          81 GQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGG  118 (145)
T ss_dssp             EEEEEEEECSSSSCEEEEEEEECTTCEEEECCCCSCCC
T ss_pred             EEEEEEEEECCCCCEEEEEEEEEECCCCEEECCCCCCC
T ss_conf             98877345879999899999999237857898676677



>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 159 single-strand binding protein (ssb) [Candidatus Li
1x3e_A_165 (A:) Single-strand binding protein; oligonucleotid 1e-33
3eiv_A_199 (A:) Single-stranded DNA-binding protein 2; DNA da 6e-32
3lgj_A_169 (A:) Single-stranded DNA-binding protein; niaid, C 8e-31
1eqq_A_178 (A:) Single stranded DNA binding protein; beta bar 2e-30
1z9f_A_153 (A:) Single-strand binding protein; TM0604, single 2e-28
1qvc_A_145 (A:) Single stranded DNA binding protein monomer; 3e-28
1se8_A_301 (A:) Single-strand binding protein; DNA binding pr 7e-16
2vw9_A_134 (A:) Single-stranded DNA binding protein; DNA repl 2e-25
3fhw_A_115 (A:) Primosomal replication protein N; PRIB BPR162 4e-22
3ull_A_132 (A:) DNA binding protein; DNA replication, mitocho 1e-26
1se8_A_ 301 (A:) Single-strand binding protein; DNA binding pr 8e-26
1txy_A_104 (A:) Primosomal replication protein N; OB fold, di 9e-24
1v1q_A_113 (A:) Primosomal replication protein N; primosome, 1e-23
3koj_A_108 (A:) Uncharacterized protein YCF41; single-strand 2e-22
3k8a_A_103 (A:) Putative primosomal replication protein; beta 5e-22
3en2_A_101 (A:) Probable primosomal replication protein N; PR 8e-22
2fxq_A_ 264 (A:) Single-strand binding protein; strand beta-sh 5e-21
2fxq_A_264 (A:) Single-strand binding protein; strand beta-sh 1e-11
>1x3e_A (A:) Single-strand binding protein; oligonucleotide binding fold, DNA-binding protein, DNA binding protein; 2.15A {Mycobacterium smegmatis} PDB: 1x3f_A 1x3g_A 1ue1_A 1ue5_A 1ue6_A 1ue7_ALength = 165 Back     alignment and structure
 Score =  136 bits (343), Expect = 1e-33
 Identities = 38/164 (23%), Positives = 67/164 (40%), Gaps = 7/164 (4%)

Query: 3   ASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSE 62
           A    + ++GNL ADP++R T  G  + N  +A++    DR + E ++            
Sbjct: 2   AGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWR 61

Query: 63  ELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGEEQ 122
           E    V + L +GS+V + G L+ R ++ + G  R   E+ +  +        +   +  
Sbjct: 62  EAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKAS 121

Query: 123 RSEQHSNNLKENVVGNRYSSPREESV-------FSDELDDEIPF 159
           RS            G+R S P+++              DDE PF
Sbjct: 122 RSGGGGGGFGSGGGGSRQSEPKDDPWGSAPASGSFSGADDEPPF 165


>3eiv_A (A:) Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor}Length = 199 Back     alignment and structure
>3lgj_A (A:) Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae}Length = 169 Back     alignment and structure
>1eqq_A (A:) Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli}Length = 178 Back     alignment and structure
>1z9f_A (A:) Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima}Length = 153 Back     alignment and structure
>1qvc_A (A:) Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli}Length = 145 Back     alignment and structure
>1se8_A (A:) Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans}Length = 301 Back     alignment and structure
>2vw9_A (A:) Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori}Length = 134 Back     alignment and structure
>3fhw_A (A:) Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein structure initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_ALength = 115 Back     alignment and structure
>3ull_A (A:) DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens}Length = 132 Back     alignment and structure
>1se8_A (A:) Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans}Length = 301 Back     alignment and structure
>1txy_A (A:) Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli}Length = 104 Back     alignment and structure
>3koj_A (A:) Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301}Length = 108 Back     alignment and structure
>3k8a_A (A:) Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090}Length = 103 Back     alignment and structure
>3en2_A (A:) Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum}Length = 101 Back     alignment and structure
>2fxq_A (A:) Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_ALength = 264 Back     alignment and structure
>2fxq_A (A:) Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_ALength = 264 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 single-strand binding protein (ssb) [Candidatus Liberib
3eiv_A_199 Single-stranded DNA-binding protein 2; DNA damage, 100.0
1eqq_A_178 Single stranded DNA binding protein; beta barrel, 100.0
1se8_A_301 Single-strand binding protein; DNA binding protein 100.0
1qvc_A_145 Single stranded DNA binding protein monomer; beta- 100.0
2fxq_A_ 264 Single-strand binding protein; strand beta-sheet e 100.0
2vw9_A_134 Single-stranded DNA binding protein; DNA replicati 99.97
3ull_A_132 DNA binding protein; DNA replication, mitochondrio 99.97
1se8_A_ 301 Single-strand binding protein; DNA binding protein 99.97
3koj_A_108 Uncharacterized protein YCF41; single-strand bindi 99.94
1txy_A_104 Primosomal replication protein N; OB fold, dimer, 99.93
3fhw_A_115 Primosomal replication protein N; PRIB BPR162 X-RA 99.93
1v1q_A_134 Primosomal replication protein N; primosome, DNA r 99.92
3k8a_A_103 Putative primosomal replication protein; beta-barr 99.92
3en2_A_101 Probable primosomal replication protein N; PRIB RS 99.92
3f2b_A_1-110110 DNA-directed DNA polymerase III alpha chain; DNA p 97.72
2hpi_A_1024-1128105 DNA polymerase III alpha subunit; POL-beta-like nu 96.16
1gm5_A_160-24889 RECG; helicase, replication restart; HET: DNA ADP; 94.58
1xjv_A_1-145145 Protection of telomeres 1; protein-DNA complex, si 93.74
1l0w_A_1-113113 Aspartyl-tRNA synthetase; space-grown crystal, dim 92.17
1x3e_A_165 Single-strand binding protein; oligonucleotide bin 100.0
3lgj_A_169 Single-stranded DNA-binding protein; niaid, CAT sc 100.0
1z9f_A_153 Single-strand binding protein; TM0604, single stra 100.0
2fxq_A_264 Single-strand binding protein; strand beta-sheet e 99.72
3dm3_A_105 Replication factor A; probably plays AN essential 91.04
>3eiv_A (A:) Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Back     alignment and structure
Probab=100.00  E-value=2.1e-38  Score=248.69  Aligned_cols=112  Identities=25%  Similarity=0.426  Sum_probs=106.7

Q ss_pred             CCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCEEE-CEEEECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             8778379999642588667986999869999998345642026884530-112430211015898772211047715999
Q gi|254780183|r    2 VASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERRE-KTEWHSVIVFSEELCRIVEQYLRKGSKVYI   80 (159)
Q Consensus         2 m~~mN~v~l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~~~~~~~~d-~t~~~~v~~~g~~~Ae~~~~~l~KG~~V~V   80 (159)
                      |++||+|+|+|||++|||||++++|..+++|+||++++|+++.+++|.+ .|.||.|++|+ ++|+++++||+||++|+|
T Consensus         1 M~~mn~v~l~G~l~~dPe~~~~~~g~~~~~~~ia~~~~~~~~~~~~~~~~~t~~~~v~~~~-~~Ae~~~~~l~KG~~V~V   79 (199)
T 3eiv_A            1 MAGETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPRTFDRQTNEWKDGESLFLTCSVWR-QAAENVAESLQRGMRVIV   79 (199)
T ss_dssp             ---CCEEEEEEEESSCCEEEECTTCCEEEEEEEEECC-----------CCCCEEEEEEEET-HHHHHHHHHCCTTCEEEE
T ss_pred             CCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCEECCCCCCCCCCCEEEEEEECC-HHHHHHHHHCCCCCEEEE
T ss_conf             9987879999880779989888999989999999748702056783325543465666230-679999974689999999


Q ss_pred             EECCCCCCCCCCCCCEEEEEEEEEEEEEECCCCC
Q ss_conf             8413333320468837688999997769846677
Q gi|254780183|r   81 EGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRR  114 (159)
Q Consensus        81 ~Grl~~~~~~~kdG~~r~~~~V~a~~i~~l~~~~  114 (159)
                      +|+|+.++|++++|++++.++|+|++|.++..+.
T Consensus        80 ~G~l~~~~~~d~dG~~~~~~~i~a~~i~~~~~~~  113 (199)
T 3eiv_A           80 QGRLKQRSYEDREGVKRTVYELDVDEVGASLRSA  113 (199)
T ss_dssp             EEEEEEEC--------CCEEEEEEEEEEEECSSE
T ss_pred             EEEEEECEEECCCCCEEEEEEEEEEECCCCCCCC
T ss_conf             9898825069999989769999952526312323



>1eqq_A (A:) Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} Back     alignment and structure
>1se8_A (A:) Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} Back     alignment and structure
>1qvc_A (A:) Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} Back     alignment and structure
>2fxq_A (A:) Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>2vw9_A (A:) Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>3ull_A (A:) DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} Back     alignment and structure
>1se8_A (A:) Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} Back     alignment and structure
>3koj_A (A:) Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>1txy_A (A:) Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} Back     alignment and structure
>3fhw_A (A:) Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein structure initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>1v1q_A (A:) Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} Back     alignment and structure
>3k8a_A (A:) Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>3en2_A (A:) Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Back     alignment and structure
>3f2b_A (A:1-110) DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>2hpi_A (A:1024-1128) DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
>1gm5_A (A:160-248) RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} Back     alignment and structure
>1xjv_A (A:1-145) Protection of telomeres 1; protein-DNA complex, single-stranded DNA, transcription/DNA complex; 1.73A {Homo sapiens} Back     alignment and structure
>1l0w_A (A:1-113) Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} Back     alignment and structure
>1x3e_A (A:) Single-strand binding protein; oligonucleotide binding fold, DNA-binding protein, DNA binding protein; 2.15A {Mycobacterium smegmatis} PDB: 1x3f_A 1x3g_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A Back     alignment and structure
>3lgj_A (A:) Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Back     alignment and structure
>1z9f_A (A:) Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>2fxq_A (A:) Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>3dm3_A (A:) Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure