254780184

254780184

excinuclease ABC subunit A

GeneID in NCBI database:8209164Locus tag:CLIBASIA_00335
Protein GI in NCBI database:254780184Protein Accession:YP_003064597.1
Gene range:+(66299, 69178)Protein Length:959aa
Gene description:excinuclease ABC subunit A
COG prediction:[L] Excinuclease ATPase subunit
KEGG prediction:uvrA; excinuclease ABC subunit A; K03701 excinuclease ABC subunit A
SEED prediction:Excinuclease ABC subunit A
Pathway involved in KEGG:Nucleotide excision repair [PATH:las03420]
Subsystem involved in SEED:DNA repair, UvrABC system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96
MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK
ccccccEEEEccccccccccEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHcccEEEEEccEEEEccccccccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccEEEEEEcHHHcccccccccccccEEcccccccHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHcccccEEEEEEccccEEccccccEEEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccEEEEccEEHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHcccHHHccHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHcccEEEEccccEEEccEEEEEccHHHHHcccccEEEHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHcccccccccEEEEcccccHHHHHHccHHHHHHHHHccccHHHHHHHHHHccccHHHHcccHHHccHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEcccccccccEEEEEccHHHHHHccHHHHHHHHHHHHccc
cccccEEEEEcccHcccccccEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHccHHHHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHHcccEEEEEccEEEEccccccHHccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccHHHHHcHHcccccccccccccccccccccccccccccccccccEEcccHHHEcccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHccHHHHHHHHcccccEEEEEEEEcccccEEcccccccccHHHHHcccccHHHHHHHHHHHccccccccccccccHHHHEEEEcccccccHccccHHHHHHHHHHccHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcHHHccEEEEEEccHHHHHHccEEEEEEEEccEEEEEEcccccHHHHHHcccccccccccccEEEccccccccccccEEEEEEccccccEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccEcccHcccEEEEccccccccccccccccccccccHHHHHHHccccHccccccccEEEEEEccccccHcccccEEEEEEEccccEEEEcccccccEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHEEEccccccccccEEEEEccHHHHHccccccHHHHHHHHHHcc
mskiknisirgarehnlqnisielprnkLIVMTgvsgsgksslafdTIHAEGQRRYVESLSTYARQFLgtikkpdveqidglsptisieqkntshnprstvgtITEIHDYLRLLFArigiphspttglpiesQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVqidgvfyhisdapdldkkykhTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATiadstfhndektspnlshnssdhilfsenlscpvsgfsiaeieprifsfnnpagachhcdglgtrqkvdeklvipnsklalnngaiapwsnplsaYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHkkssysnlsfrgIIPTLEKRWSEADSSLLQEIIQRYmssspctichgyrlkdESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLtlsrnsnmlsngESQRIRLASQIGSALTGVLYildepsiglhqrdnTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIvdigpeaginggkivaegspsqiiahptsltgkymsgkmsikipekrrqynpnrMIHVINARsnnlknvtgsiplGLFTAitgisgggkSTFLISTLYKAAARIIMgskynpgiydridgleYIDKVVsinqspightprsnpatyvgaftpirdlfsnlpeskacgykagcfsfnvkggrcevcegngVIKIAMHFlpdvyitcdvcqgqrynpetlqirfkdkSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKigqsantlsggeSQRVKLAKELSkqatgntlyildepttglhyhDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADwildfgpeggdgggeiiasgppeaiakeplsyTGKFLKSILKNK
mskiknisirgarehnlqnisielprNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLgtikkpdveqIDGLSptisieqkntshnprstvgTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHIsdapdldkkyKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALArhkkssysnlsfRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAhptsltgkymsGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQspightprsnpatyVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQsantlsggeSQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEaiakeplsytgkfLKSILKNK
MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFgpeggdgggeiiasgpPEAIAKEPLSYTGKFLKSILKNK
****KNI*IRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDE*********SSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILK**
MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK
***IKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADS**************NSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQS********S*R*K*AKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK
MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK
MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target959 excinuclease ABC subunit A [Candidatus Liberibacter asi
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 2e-05
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 4e-04
254780917596 ABC transporter, nucleotide binding/ATPase protein 3e-05
254780917596 ABC transporter, nucleotide binding/ATPase protein 0.003
254780718240 putative high-affinity zinc uptake system ATP-bind 7e-05
254780576597 ABC transporter related protein [Candidatus Liberi 2e-04
254780871227 lipoprotein-releasing system ATP-binding protein l 5e-04
254780559234 thiamine transporter ATP-binding subunit [Candidat 8e-04
254780273539 putative ABC transporter ATP-binding protein [Cand 0.001
254780744262 ABC transporter nucleotide binding/ATPase protein 0.002
254780173257 ABC transporter related protein [Candidatus Liberi 0.002
254780139257 putative ATP-binding component of ABC transporter 0.002
254780538280 ABC transporter, nucleotide binding/ATPase protein 0.003
254780704254 ABC transporter, nucleotide binding/ATPase protein 0.003
254780193528 lipid A ABC exporter family, fused ATPase and inne 0.009
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 0.035
>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 502 NMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHL-RDTGNTVIV 560
           NMLS G  QR+  A    +     + ++DEP   L      +L + L  L R    T++ 
Sbjct: 168 NMLSGGMKQRVGFARAFATG--APILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225

Query: 561 VEHD-EETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTS 603
           V HD  E     + I      A + GG+I+  G+P +II HP +
Sbjct: 226 VSHDINEAFRLGNRI------AIMEGGRIIQCGTPQEIILHPAN 263

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 38.9 bits (89), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 12/115 (10%)

Query: 844 NTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDR-GNSII 902
           N LSGG  QRV  A+     ATG  + ++DEP + L      +L + L  L  +   +I+
Sbjct: 168 NMLSGGMKQRVGFARAF---ATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224

Query: 903 VIEHNL-EVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLS-YTGKFLKSI 955
            + H++ E  +  + I          GG II  G P+ I   P + Y  +F++ +
Sbjct: 225 FVSHDINEAFRLGNRIAIM------EGGRIIQCGTPQEIILHPANCYVSEFIQKL 273

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 8/113 (7%)

Query: 807 MTVDESLDFFAAIPTIHNKLTTLKEVGLGY-IKIGQSANTLSGGESQRVKLAKELSKQAT 865
           M  +E +   A     H+ + +L +   GY   +G++ + LSGG+ QR+ +A+ + +   
Sbjct: 453 MATEEEMIEIAKSANAHDFIMSLPQ---GYDTYVGENGSNLSGGQKQRIAIARAMLRD-- 507

Query: 866 GNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWIL 918
           G+ L +LDE T+ L  H    +   L  L+ +G + IVI H +  I  AD I+
Sbjct: 508 GHIL-VLDEATSALDTHTENLVRQALSRLM-QGRTTIVIAHRISTIIEADHII 558

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 500 NSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVI 559
           N + LS G+ QRI +A  +     G + +LDE +  L       +   L  L   G T I
Sbjct: 486 NGSNLSGGQKQRIAIARAM--LRDGHILVLDEATSALDTHTENLVRQALSRLMQ-GRTTI 542

Query: 560 VVEHDEETMLAADHIVDI 577
           V+ H   T++ ADHI+ I
Sbjct: 543 VIAHRISTIIEADHIIFI 560

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 41.2 bits (95), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 12/105 (11%)

Query: 838 KIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDR 897
           K  ++   LSGGE QR  LAK L ++     L +LDEP  G+ +     L  ++ ++   
Sbjct: 119 KYNRNIKDLSGGEFQRALLAKALLRKP---NLLVLDEPLQGIDFPGELSLYELITSVRQS 175

Query: 898 -GNSIIVIEHNLE-VIKTADWILDFGPEGGDGGGEIIASGPPEAI 940
            G  I++I HNL  V+ + D ++            I   GPP+ I
Sbjct: 176 TGCGILLISHNLHMVMASTDTVICL-------NNRICYQGPPQTI 213

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 10/115 (8%)

Query: 839 IGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRG 898
           +G+    LSGGE QRV +A+ + K      + I DE T+ L       +   L TL  + 
Sbjct: 487 VGERGLKLSGGEKQRVSIARAILKNP---PIIIFDEATSSLDIITERHIQTALATL-SKN 542

Query: 899 NSIIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLK 953
            + +VI H L  I  AD I+ F        G ++ SG  E +  +   YT  + K
Sbjct: 543 RTTLVIAHRLSTITDADNIIVFDQ------GTVVESGSHENLISQGGIYTSMWKK 591

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 38.5 bits (88), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 9/118 (7%)

Query: 804 VLSMTVDESLDFFAAIPTIHNKLTTLKEVGL-GYIKIGQSAN----TLSGGESQRVKLAK 858
           ++  +V E++ F   I  I++K    + + L  Y+ + Q AN     +SGGE QRV + +
Sbjct: 100 LMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICR 159

Query: 859 ELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDR-GNSIIVIEHNLEVIKTAD 915
            ++ +     + + DEPT  L      ++ +IL  LV R G + ++  HN ++    D
Sbjct: 160 AIANKP---LIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMD 214

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 37.7 bits (86), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 15/99 (15%)

Query: 846 LSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVD-RGNSIIVI 904
           +SGG+ QRV LA+ L +Q     + +LDEP          ++L +L  + D R  ++++I
Sbjct: 130 MSGGQRQRVALARCLIRQ---KPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLMI 186

Query: 905 EHNLE---VIKTADWILDFGPEGGDGGGEIIASGPPEAI 940
            HNLE    I T   ++         GG+I+  G P+ +
Sbjct: 187 SHNLEDSMQIATRFIVI--------AGGQIVYDGDPDRL 217

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 11/113 (9%)

Query: 841 QSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNS 900
           Q   +LSGG+  RV LAK L    +G  + +LDEPT  L    ++ L + L      G +
Sbjct: 434 QRIGSLSGGQRGRVHLAKILK---SGGNVILLDEPTNDLDTETLSALEDALENFA--GCA 488

Query: 901 IIVIEHNLEVIKTADWILDFGPEGGDGGGEI-IASGPPEAIAKEPLSYTGKFL 952
           +I+    + + + A  IL F     +G G +    G  E   K+ LS + + L
Sbjct: 489 VIISHDRMFLDRLATHILAF-----EGNGHVEWFEGNFEEYEKDKLSRSSRVL 536

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 843 ANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSII 902
           A  LSGG+ +R+++A+ L    +  +  +LDEP  G+    I+ +  ++  L  RG  I+
Sbjct: 156 APLLSGGQRRRLEIARSL---VSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGIL 212

Query: 903 VIEHNLEVIKT 913
           + +HN+  I T
Sbjct: 213 ITDHNVHEILT 223

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 11/107 (10%)

Query: 852 QRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVI 911
           QR  +A+ L  Q     + + DEPT+ L    + ++L+I+  L + G +++ + H +   
Sbjct: 159 QRAAIARSLCMQPK---IMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFA 215

Query: 912 K-TADWILDFGPEGGDGGGEIIASGPPEAIAKEPL-SYTGKFLKSIL 956
           +  AD ++          G+I+    PE     P    T  FL  I+
Sbjct: 216 RQVADRVVFM------DQGQIVEQNSPEEFFNNPQHERTQAFLSQII 256

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 57/119 (47%), Gaps = 15/119 (12%)

Query: 796 FKDKSIADVLSMTVDESLDFFAAI--PTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQR 853
           F   ++ + +SM + E L+  A +    +H K+     VGL           LSGG  +R
Sbjct: 102 FSSMTVQENISMPIKEHLNLPADLIEHIVHTKIAI---VGLPPETANLMPFQLSGGMIKR 158

Query: 854 VKLAKELSKQATGNTLYILDEPTTGLH---YHDIAKLL-NILHTLVDRGNSIIVIEHNL 908
           V LA+ L   A    L  LDEPT+GL      +  KLL  + H+L   G S+ +I H+L
Sbjct: 159 VSLARAL---AIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSL---GLSVYMITHDL 211

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 829 LKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLL 888
           L+ VG+  ++  Q    LS G+ +RV LA+ L++++    + I+DEP   + +    +++
Sbjct: 132 LENVGMSSMRQRQIGE-LSIGQQKRVFLARALAQKSQ---VIIMDEPFAAIDFKTEREMI 187

Query: 889 NILHTLVDRGNSIIVIEHNLEVI 911
            +L +L++    I+V  HN+  I
Sbjct: 188 FLLKSLLNEDIMILVSTHNINSI 210

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 35.8 bits (81), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 838 KIGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDR 897
           ++   A+ LSGG+ QRV +A+ L   A    + ++DEP + L     A +  ++H L + 
Sbjct: 143 RLFHDASLLSGGQQQRVCIARAL---AVNPEVILMDEPCSALDPIATASVEELIHELRE- 198

Query: 898 GNSIIVIEHNLE 909
             +I+++ H+++
Sbjct: 199 SLTIVIVTHSMQ 210

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 34.3 bits (77), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 839 IGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRG 898
           +G  A  LS G+ QR+ +A+ + K    + + +LDE  + L   +  K+  +L     RG
Sbjct: 420 LGDGAVHLSTGQIQRIAIARAILKD---SPILLLDEMGSALDIENEQKIWKVLREQ-RRG 475

Query: 899 NSIIVIEHNLEVIKTADWIL 918
            + I   H L  I+ AD + 
Sbjct: 476 RTTIFASHRLSAIQDADMVF 495

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 32.3 bits (72), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%)

Query: 510 QRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETML 569
           Q+IRL+  I +     + ++DEP   L           LK  ++   T++++ HD   + 
Sbjct: 473 QKIRLSRIIAN--NPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIIS 530

Query: 570 AADHIVDIGPEAG 582
            +D  +   P  G
Sbjct: 531 MSDFSLIFHPIQG 543

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target959 excinuclease ABC subunit A [Candidatus Liberibacter asi
315122782959 excinuclease ABC subunit A [Candidatus Liberibacter sol 1 0.0
15965310973 excinuclease ABC subunit A [Sinorhizobium meliloti 1021 1 0.0
163868583971 excinuclease ABC subunit A [Bartonella tribocorum CIP 1 1 0.0
49474368963 excinuclease ABC subunit A [Bartonella quintana str. To 1 0.0
150396453973 excinuclease ABC subunit A [Sinorhizobium medicae WSM41 1 0.0
240850767971 excinuclease ABC, A subunit [Bartonella grahamii as4aup 1 0.0
163760271973 excinuclease ABC subunit A [Hoeflea phototrophica DFL-4 1 0.0
227822107973 excinuclease ABC subunit A [Sinorhizobium fredii NGR234 1 0.0
116252150973 excinuclease ABC subunit A [Rhizobium leguminosarum bv. 1 0.0
190891752973 excinuclease ABC protein, A subunit [Rhizobium etli CIA 1 0.0
>gi|315122782|ref|YP_004063271.1| excinuclease ABC subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 959 Back     alignment and organism information
 Score = 1705 bits (4416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/959 (85%), Positives = 888/959 (92%)

Query: 1   MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESL 60
           M KIKNISI GAREHNLQNISIELPRNKLIV+TGVSGSGKSSLAFDTIHAEGQRRY+ESL
Sbjct: 1   MCKIKNISIHGAREHNLQNISIELPRNKLIVITGVSGSGKSSLAFDTIHAEGQRRYIESL 60

Query: 61  STYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGI 120
           STYARQFLGTIKKPDV++IDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGI
Sbjct: 61  STYARQFLGTIKKPDVDRIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLFARIGI 120

Query: 121 PHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKGEYKKELAEILKKGFQRV 180
           PHSPTTGLPIE QT+SQMADR+L+FEQGTRMY+LAPIVRNRKGEYKKELA +LK+GFQR+
Sbjct: 121 PHSPTTGLPIEKQTVSQMADRILTFEQGTRMYMLAPIVRNRKGEYKKELAALLKQGFQRI 180

Query: 181 QIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVNSLRTCLQLTNGLAIATIA 240
           +IDG FY ISDAP+LDKKYKH IEVVVDRIV+HENIR+RIVNSL+TCLQL NGL IA I 
Sbjct: 181 KIDGEFYQISDAPNLDKKYKHNIEVVVDRIVIHENIRDRIVNSLKTCLQLANGLCIAEII 240

Query: 241 DSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIEPRIFSFNNPAGACHHCDGL 300
           DS+   D+KT  +++H++  +ILFSE ++CPVSGFSIAEIEPRIFSFNNPAGACHHCDGL
Sbjct: 241 DSSQSCDKKTPDDMNHSTPQNILFSEKVACPVSGFSIAEIEPRIFSFNNPAGACHHCDGL 300

Query: 301 GTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILTALGKDLGFSINDSWDLLSNE 360
           G  QK+DE L+IPN KLAL+NGAIAPWS PLS YHT ILT LG++LGFS++D W  +S E
Sbjct: 301 GISQKIDENLIIPNPKLALHNGAIAPWSTPLSEYHTKILTTLGEELGFSLSDRWCNISEE 360

Query: 361 NQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKRWSEADSSLLQEIIQRYMSSSP 420
            Q+ILLYGTKKN    + +KKSS++N  F+GIIPTLE+RW++ DS+  QEIIQRYMSSSP
Sbjct: 361 IQKILLYGTKKNDTIPSLNKKSSHTNCCFKGIIPTLEQRWNKEDSAFFQEIIQRYMSSSP 420

Query: 421 CTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWFEQLPTQITQKANKISESILKEI 480
           C  C+GYRLK E+ A+KI GKHIGEI DMSIKK QIWFE+LP QI+QKANKI+ESIL+EI
Sbjct: 421 CPACNGYRLKSEAFAIKINGKHIGEITDMSIKKVQIWFEKLPAQISQKANKIAESILEEI 480

Query: 481 QKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRD 540
           QKRI FLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGS LTGVLY+LDEPSIGLHQRD
Sbjct: 481 QKRIRFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQIGSGLTGVLYVLDEPSIGLHQRD 540

Query: 541 NTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAH 600
           N KLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGP+AG+NGG IVAEGSPSQIIAH
Sbjct: 541 NAKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVDIGPDAGVNGGNIVAEGSPSQIIAH 600

Query: 601 PTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINARSNNLKNVTGSIPLGLFTAITGISG 660
           PTSLTGKYMSG+M IKIP+KRRQ+NPN+MIHVINARSNNLKN+T SIP+GLFTAITGISG
Sbjct: 601 PTSLTGKYMSGEMKIKIPQKRRQHNPNKMIHVINARSNNLKNITASIPIGLFTAITGISG 660

Query: 661 GGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDGLEYIDKVVSINQSPIGHTPRSNPATY 720
           GGKSTFLISTLYKAAAR+IMG+KYNPGIYDRIDGLEYIDKVV+INQSPIGHTPRSNPATY
Sbjct: 661 GGKSTFLISTLYKAAARLIMGAKYNPGIYDRIDGLEYIDKVVNINQSPIGHTPRSNPATY 720

Query: 721 VGAFTPIRDLFSNLPESKACGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCD 780
           VGAFTPIRD FSNLPESKA GYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCD
Sbjct: 721 VGAFTPIRDWFSNLPESKALGYKAGCFSFNVKGGRCEVCEGNGVIKIAMHFLPDVYITCD 780

Query: 781 VCQGQRYNPETLQIRFKDKSIADVLSMTVDESLDFFAAIPTIHNKLTTLKEVGLGYIKIG 840
           +CQG+RYNPETL I FK KSIAD+L+MTV+ES+DFF  IP IHNKL TLKEVGLGYIKIG
Sbjct: 781 ICQGKRYNPETLNICFKGKSIADILAMTVEESVDFFTTIPAIHNKLKTLKEVGLGYIKIG 840

Query: 841 QSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNS 900
           QSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLL+ILHTLV+RGNS
Sbjct: 841 QSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLDILHTLVERGNS 900

Query: 901 IIVIEHNLEVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLSYTGKFLKSILKNK 959
           IIVIEHNLEVIKTADWILDFGPEGGD GG+IIASG PE IAKE  SYTGKFLKSILK K
Sbjct: 901 IIVIEHNLEVIKTADWILDFGPEGGDNGGKIIASGTPEDIAKEASSYTGKFLKSILKEK 959


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965310|ref|NP_385663.1| excinuclease ABC subunit A [Sinorhizobium meliloti 1021] Length = 973 Back     alignment and organism information
>gi|163868583|ref|YP_001609792.1| excinuclease ABC subunit A [Bartonella tribocorum CIP 105476] Length = 971 Back     alignment and organism information
>gi|49474368|ref|YP_032410.1| excinuclease ABC subunit A [Bartonella quintana str. Toulouse] Length = 963 Back     alignment and organism information
>gi|150396453|ref|YP_001326920.1| excinuclease ABC subunit A [Sinorhizobium medicae WSM419] Length = 973 Back     alignment and organism information
>gi|240850767|ref|YP_002972167.1| excinuclease ABC, A subunit [Bartonella grahamii as4aup] Length = 971 Back     alignment and organism information
>gi|163760271|ref|ZP_02167354.1| excinuclease ABC subunit A [Hoeflea phototrophica DFL-43] Length = 973 Back     alignment and organism information
>gi|227822107|ref|YP_002826078.1| excinuclease ABC subunit A [Sinorhizobium fredii NGR234] Length = 973 Back     alignment and organism information
>gi|116252150|ref|YP_767988.1| excinuclease ABC subunit A [Rhizobium leguminosarum bv. viciae 3841] Length = 973 Back     alignment and organism information
>gi|190891752|ref|YP_001978294.1| excinuclease ABC protein, A subunit [Rhizobium etli CIAT 652] Length = 973 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target959 excinuclease ABC subunit A [Candidatus Liberibacter asi
PRK00349943 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed 0.0
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 0.0
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 1e-177
PRK006351809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 1e-97
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 0.0
cd03271261 cd03271, ABC_UvrA_II, The excision repair protein UvrA 1e-115
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 6e-56
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 2e-15
cd03271261 cd03271, ABC_UvrA_II, The excision repair protein UvrA 9e-15
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 4e-50
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 6e-32
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 2e-12
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 8e-12
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 1e-11
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 1e-10
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 7e-10
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 2e-09
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 2e-09
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 3e-09
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 5e-09
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 6e-09
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 9e-09
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 1e-08
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 2e-08
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine transport 2e-08
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 3e-08
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transporter 4e-08
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 5e-08
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 8e-08
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 1e-07
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 2e-07
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 2e-07
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 3e-07
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 3e-07
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 4e-07
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-binding / 4e-07
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 4e-07
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 5e-07
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 6e-07
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding subu 6e-07
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 7e-07
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 7e-07
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 9e-07
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 9e-07
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 1e-06
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 1e-06
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 1e-06
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 1e-06
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 1e-06
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 2e-06
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 2e-06
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 2e-06
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 2e-06
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 3e-06
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 6e-06
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 1e-05
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 1e-05
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 1e-05
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 1e-05
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-05
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 1e-05
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 1e-05
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 1e-05
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 1e-05
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 2e-05
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 2e-05
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 2e-05
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 2e-05
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 2e-05
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 3e-05
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 3e-05
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 3e-05
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 4e-05
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 4e-05
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 5e-05
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 5e-05
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 5e-05
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 5e-05
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 5e-05
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 5e-05
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 6e-05
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 7e-05
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 8e-05
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 8e-05
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 8e-05
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 8e-05
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 9e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 9e-05
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 9e-05
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 1e-04
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine transpo 1e-04
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 1e-04
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 1e-04
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 1e-04
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 2e-04
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 2e-04
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transporter A 2e-04
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 3e-04
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 3e-04
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 3e-04
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 4e-04
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 4e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein; Pro 4e-04
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 4e-04
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 5e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 5e-04
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 5e-04
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 5e-04
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 6e-04
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 6e-04
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 7e-04
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 8e-04
COG4148352 COG4148, ModC, ABC-type molybdate transport system, ATP 8e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 8e-04
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 0.001
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 0.001
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 0.001
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 0.001
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 0.001
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 0.001
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 0.002
KOG0061613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 0.002
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 0.002
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 0.002
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 0.002
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 0.002
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 0.003
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 0.003
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 0.003
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 0.003
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 0.003
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 0.004
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 0.004
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 0.004
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 0.004
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 0.004
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 0.004
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 0.004
TIGR00630 924 TIGR00630, uvra, excinuclease ABC, A subunit 2e-46
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 1e-34
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 5e-30
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 5e-14
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 1e-10
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 5e-09
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 9e-09
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 2e-07
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 4e-06
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 6e-06
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 8e-06
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 1e-05
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 1e-05
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 2e-05
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 5e-05
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 9e-05
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 1e-04
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 0.002
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 0.004
cd03271261 cd03271, ABC_UvrA_II, The excision repair protein UvrA 6e-41
PRK006351809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 1e-20
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 9e-11
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 3e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 3e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 8e-04
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 0.002
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 2e-38
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 4e-33
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 1e-13
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 2e-13
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 6e-13
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 1e-12
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 4e-12
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 6e-12
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 1e-11
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 8e-11
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 9e-11
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 1e-10
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 2e-10
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 4e-10
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 8e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 1e-09
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 2e-09
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 2e-09
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 5e-09
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 6e-09
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 2e-08
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 3e-08
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 3e-08
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 3e-08
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 4e-08
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 5e-08
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 6e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 7e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 7e-08
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 9e-08
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 1e-07
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 2e-07
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 3e-07
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 3e-07
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 3e-07
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 4e-07
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 4e-07
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 5e-07
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 7e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 8e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 9e-07
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 1e-06
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 1e-06
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-06
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 1e-06
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 1e-06
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 1e-06
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 1e-06
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 2e-06
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 2e-06
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 2e-06
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 2e-06
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 2e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 3e-06
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 3e-06
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 3e-06
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 4e-06
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 5e-06
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 6e-06
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 7e-06
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 8e-06
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 1e-05
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 1e-05
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 1e-05
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 1e-05
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 1e-05
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 1e-05
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 2e-05
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 3e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 3e-05
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 3e-05
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 4e-05
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 4e-05
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 5e-05
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 7e-05
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 8e-05
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 9e-05
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 9e-05
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 9e-05
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 1e-04
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 1e-04
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 1e-04
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 1e-04
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 1e-04
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 1e-04
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 1e-04
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 1e-04
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 1e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 1e-04
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 1e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 2e-04
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 2e-04
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 2e-04
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 2e-04
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 4e-04
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 4e-04
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 4e-04
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 4e-04
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 4e-04
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 5e-04
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 5e-04
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 6e-04
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 6e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 6e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 6e-04
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 6e-04
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 6e-04
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 6e-04
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 6e-04
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 7e-04
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 7e-04
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 8e-04
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 9e-04
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 0.001
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 0.001
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 0.001
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 0.001
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 0.001
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 0.001
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 0.001
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 0.001
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 0.001
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 0.001
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 0.002
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 0.002
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 0.002
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 0.002
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 0.002
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 0.003
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 0.003
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 0.003
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 0.004
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 6e-14
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 0.002
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 0.002
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 4e-12
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 2e-11
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 1e-09
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 2e-08
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 2e-08
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 3e-08
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 6e-08
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 1e-06
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 2e-06
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 3e-06
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 4e-06
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 6e-06
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 8e-06
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 1e-05
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 1e-05
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 2e-05
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 2e-05
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 3e-05
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 3e-05
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 4e-05
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 8e-05
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 9e-05
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 1e-04
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 1e-04
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 1e-04
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 1e-04
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 2e-04
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 2e-04
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 4e-04
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 0.002
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 0.003
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 3e-11
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 5e-11
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 3e-09
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 3e-09
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 4e-08
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 5e-08
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 5e-08
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 7e-08
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 7e-08
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 2e-07
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 3e-07
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 5e-06
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 7e-06
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 8e-06
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 9e-06
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 1e-05
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 2e-05
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 2e-05
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 4e-05
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 5e-05
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 5e-05
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 5e-05
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 8e-05
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 8e-05
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 9e-05
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 1e-04
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 1e-04
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 1e-04
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 1e-04
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 2e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 2e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-04
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 3e-04
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 3e-04
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 3e-04
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 4e-04
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 4e-04
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 5e-04
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 8e-04
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 0.001
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 0.001
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 0.002
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 0.004
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 4e-10
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 1e-06
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 1e-04
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 0.003
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-09
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 4e-06
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 3e-05
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 4e-04
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 3e-08
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 2e-06
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 6e-06
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 8e-06
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 6e-05
PRK02224880 PRK02224, PRK02224, chromosome segregation protein; Pro 5e-04
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 0.002
>gnl|CDD|178984 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|161968 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|167016 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|167016 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|30527 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|73029 cd03270, ABC_UvrA_I, The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|161968 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|73029 cd03270, ABC_UvrA_I, The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|72997 cd03238, ABC_UvrA, The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>gnl|CDD|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|179632 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184193 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|72981 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30745 COG0396, SufC, ABC-type transport system involved in Fe-S cluster assembly, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>gnl|CDD|169949 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|72996 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|183331 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|132456 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|162130 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|161968 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|72997 cd03238, ABC_UvrA, The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|167016 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|72996 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|30745 COG0396, SufC, ABC-type transport system involved in Fe-S cluster assembly, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|167016 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163251 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|167016 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|73029 cd03270, ABC_UvrA_I, The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|179632 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|72990 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162807 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information