254780185

254780185

glutamine synthetase protein

GeneID in NCBI database:8209165Locus tag:CLIBASIA_00340
Protein GI in NCBI database:254780185Protein Accession:YP_003064598.1
Gene range:+(69401, 70777)Protein Length:458aa
Gene description:glutamine synthetase protein
COG prediction:[E] Glutamine synthetase
KEGG prediction:glnA; glutamine synthetase protein; K01915 glutamine synthetase [EC:6.3.1.2]
SEED prediction:Glutamine synthetase type I (EC 6.3.1.2)
Pathway involved in KEGG:Nitrogen metabolism [PATH:las00910]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Arginine and proline metabolism [PATH:las00330]
Two-component system [PATH:las02020]
Subsystem involved in SEED:Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
ccccHHHHHHHHHcccccEEEEEEEcccccEEEEEEEHHHcccHHHHcccccccccccccccccccEEEEEEccccEEcccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHcccccEEEEEcccEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEcccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccEEccccccccEEEEcccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccHHHccHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHccc
ccccHHHHHHHHHHcccEEEEEEEEccccccEEEEEEcccccHHHcccccccccccccccEEccccEEEEEEEEEEEEcccccccEEEEEEEEEccccccEccccHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEcEEEEEEEccEEEEEEEccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccEEHEEccccccEEEEEEccEEHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccccEEEEEEEEEccEEccEcccHHHEcHHHHHHHHHHHHcHHHHHHHHcccHHHHHccccccccccEEEEEcccccEEEEccccccHHHccEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEccccHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccc
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSlfnentllngitfdsssidgwhskhpnlllipdietmhmdpfyaqSTVAFICnvydpitlqpynrdprytAQKAIDYLqttdigdtlLLGItteffvfdnvhctispiksgfalESTEFLqngnnkgydshakssytlppqdklhDMRSEIVSALNNIGVQITKYHNqindaqhsfglqseslLHASDNLQKYKYSVHQVANSYCkiatfmpkpiashngsgmylnmsihkgekaiftgnqhdrvsLKGLYYLGGIIKHAKSLNALTNASTNSYKRlltdsqsptkltysthnhsascripyenksdnksieirfpdlsanpylaPAAILMAGLDGiakkihpgknidelsleeqntiPRICISLRESLEnldkdreflkvgnvfdddqIDAFINLKMKEVLklesspspvefemycsi
mvdkatsiiqkiaqekvkfiDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTkltysthnhsascripyenkSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVlklesspspvefemycsi
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
***KATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
**DKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target458 glutamine synthetase protein [Candidatus Liberibacter a
254780503461 putative glutamine synthetase [Candidatus Liberiba 4e-24
>gi|254780503|ref|YP_003064916.1| putative glutamine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Back     alignment
 Score =  103 bits (258), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 94/394 (23%), Positives = 171/394 (43%), Gaps = 30/394 (7%)

Query: 66  NLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDT 125
           +L L PD+ T+ + P+    T   +C+V D    +     PR   ++ +++    ++   
Sbjct: 88  DLRLSPDLSTLSIVPWEMDPTAQIVCDVVD-YNGKEVTYTPRNVLKRVLNFYAQNELKP- 145

Query: 126 LLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHD 185
            ++    EF++         P++          L              SY++   ++  +
Sbjct: 146 -IIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSIL-----------GGQSYSIMGINEFDE 193

Query: 186 MRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCK 245
           +  +I       G++I    ++   AQ    ++    L  +D +  +K ++ + A  +  
Sbjct: 194 IIDDIWKFSEKQGLEIDTLIHEEGPAQFEINIRHGDPLKLADQVFLFKRTIREAAFKHDI 253

Query: 246 IATFMPKPIASHNGSGMYLNMSIH--KGEKAIFT---GNQHDRVSLKGLYYLGGIIKHAK 300
            ATFM KP+ ++ GS M+++ S+   K  + IF+   G++ D       Y++GG+ K+  
Sbjct: 254 YATFMAKPMQNYPGSAMHIHQSVLDIKSNQNIFSNPDGSETDNFR----YFIGGLQKYIP 309

Query: 301 SLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSAN 360
           +   +     NSY+RL+ D   P    +   N + + RIP+ + +  K IE R P    N
Sbjct: 310 NALVMLAPYGNSYRRLVLDMGCPVNNAWGYDNRTTAFRIPFSD-AKTKRIENRLPSSDTN 368

Query: 361 PYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPRICISLRESLENLDKDREFLKV 420
           PYL  AA L  GL GI +KI P     + + +E   +PR    L E++  L+    F   
Sbjct: 369 PYLVLAASLACGLLGILQKIEPTPPTMKSANQEAINLPR---GLLEAVTLLENTSHF--- 422

Query: 421 GNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEM 454
            ++F    ID + NLK  E        SP E E 
Sbjct: 423 KDIFGSQFIDMYANLKRNEFETFMQVISPWEREF 456

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target458 glutamine synthetase protein [Candidatus Liberibacter a
315122783462 glutamine synthetase protein [Candidatus Liberibacter s 1 0.0
86357721469 glutamine synthetase protein [Rhizobium etli CFN 42] Le 1 1e-140
190891747469 glutamine synthetase protein [Rhizobium etli CIAT 652] 1 1e-140
327193321469 glutamine synthetase protein [Rhizobium etli CNPAF512] 1 1e-140
209549332469 glutamine synthetase [Rhizobium leguminosarum bv. trifo 1 1e-140
116252144469 glutamine synthetase I [Rhizobium leguminosarum bv. vic 1 1e-139
241204645469 glutamine synthetase, type I [Rhizobium leguminosarum b 1 1e-139
222085979469 glutamine synthetase protein [Agrobacterium radiobacter 1 1e-137
15965393469 glutamine synthetase I protein [Sinorhizobium meliloti 1 1e-137
222148742469 glutamine synthetase [Agrobacterium vitis S4] Length = 1 1e-137
>gi|315122783|ref|YP_004063272.1| glutamine synthetase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 462 Back     alignment and organism information
 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/462 (77%), Positives = 398/462 (86%), Gaps = 4/462 (0%)

Query: 1   MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGW 60
           MVD ATSIIQKI QE VKFID RFTDLQGKF HISM+ SLFNE  LLNGI FDSSSI GW
Sbjct: 1   MVDDATSIIQKIQQENVKFIDFRFTDLQGKFHHISMDASLFNEELLLNGIMFDSSSIAGW 60

Query: 61  HSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTT 120
           HS++P+LLLIPDIET+H+DPFYAQST+ FICNVYDPITLQPYNRDPRYT +KAI+YL+  
Sbjct: 61  HSQNPDLLLIPDIETIHIDPFYAQSTMIFICNVYDPITLQPYNRDPRYTTKKAIEYLKKK 120

Query: 121 DIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQ 180
           +IGDTLLLGI T+ F+FDNVH T+SP +SGF LESTEF  NG NKG+ S+AKS YTLPPQ
Sbjct: 121 EIGDTLLLGIKTDCFIFDNVHYTVSPTESGFTLESTEFANNGKNKGHYSNAKSGYTLPPQ 180

Query: 181 DKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVA 240
           DK HDMRSEIVSALNNIGVQITKYHNQ N+AQHSF LQ ESLL +SDNLQKYKY+VHQVA
Sbjct: 181 DKSHDMRSEIVSALNNIGVQITKYHNQANNAQHSFNLQHESLLRSSDNLQKYKYAVHQVA 240

Query: 241 NSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAK 300
           NSYCK ATFMPKPI ++NGSGM+L+MSI K +  +F G++   +S   LYY+GGIIKHAK
Sbjct: 241 NSYCKTATFMPKPIDNNNGSGMHLSMSIRKEDMPVFAGDECKGLSKTCLYYIGGIIKHAK 300

Query: 301 SLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSAN 360
           +LNALTNASTNSYKRLLT  QSP +L YSTHN SASCRIPY  K+D++ IEIRFPDL+AN
Sbjct: 301 ALNALTNASTNSYKRLLTCCQSPVQLVYSTHNRSASCRIPYAKKADDQHIEIRFPDLTAN 360

Query: 361 PYLAPAAILMAGLDGIAKKIHPG----KNIDELSLEEQNTIPRICISLRESLENLDKDRE 416
           PYLAPAAILMAGLDGIA KIHPG    KNI+ELS E + TIPRIC SLRE+LENLD DRE
Sbjct: 361 PYLAPAAILMAGLDGIANKIHPGKPMDKNINELSSEGKKTIPRICYSLREALENLDNDRE 420

Query: 417 FLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI 458
           FLK GNVFDDDQIDAFI +KMKEVL+LE SPSPVEFEMY SI
Sbjct: 421 FLKKGNVFDDDQIDAFIKIKMKEVLRLEQSPSPVEFEMYYSI 462


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357721|ref|YP_469613.1| glutamine synthetase protein [Rhizobium etli CFN 42] Length = 469 Back     alignment and organism information
>gi|190891747|ref|YP_001978289.1| glutamine synthetase protein [Rhizobium etli CIAT 652] Length = 469 Back     alignment and organism information
>gi|327193321|gb|EGE60225.1| glutamine synthetase protein [Rhizobium etli CNPAF512] Length = 469 Back     alignment and organism information
>gi|209549332|ref|YP_002281249.1| glutamine synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 469 Back     alignment and organism information
>gi|116252144|ref|YP_767982.1| glutamine synthetase I [Rhizobium leguminosarum bv. viciae 3841] Length = 469 Back     alignment and organism information
>gi|241204645|ref|YP_002975741.1| glutamine synthetase, type I [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 469 Back     alignment and organism information
>gi|222085979|ref|YP_002544511.1| glutamine synthetase protein [Agrobacterium radiobacter K84] Length = 469 Back     alignment and organism information
>gi|15965393|ref|NP_385746.1| glutamine synthetase I protein [Sinorhizobium meliloti 1021] Length = 469 Back     alignment and organism information
>gi|222148742|ref|YP_002549699.1| glutamine synthetase [Agrobacterium vitis S4] Length = 469 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target458 glutamine synthetase protein [Candidatus Liberibacter a
TIGR00653460 TIGR00653, GlnA, glutamine synthetase, type I 1e-125
PRK09469469 PRK09469, glnA, glutamine synthetase; Provisional 1e-123
TIGR03105435 TIGR03105, gln_synth_III, glutamine synthetase, type II 9e-45
COG0174443 COG0174, GlnA, Glutamine synthetase [Amino acid transpo 1e-101
pfam00120257 pfam00120, Gln-synt_C, Glutamine synthetase, catalytic 3e-65
pfam0395184 pfam03951, Gln-synt_N, Glutamine synthetase, beta-Grasp 7e-20
KOG0683380 KOG0683, KOG0683, KOG0683, Glutamine synthetase [Amino 7e-07
>gnl|CDD|161979 TIGR00653, GlnA, glutamine synthetase, type I Back     alignment and domain information
>gnl|CDD|181884 PRK09469, glnA, glutamine synthetase; Provisional Back     alignment and domain information
>gnl|CDD|163137 TIGR03105, gln_synth_III, glutamine synthetase, type III Back     alignment and domain information
>gnl|CDD|30523 COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143894 pfam00120, Gln-synt_C, Glutamine synthetase, catalytic domain Back     alignment and domain information
>gnl|CDD|146534 pfam03951, Gln-synt_N, Glutamine synthetase, beta-Grasp domain Back     alignment and domain information
>gnl|CDD|35902 KOG0683, KOG0683, KOG0683, Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 458 glutamine synthetase protein [Candidatus Liberibacter a
TIGR00653486 GlnA glutamine synthetase, type I; InterPro: IPR004809 100.0
PRK09469469 glnA glutamine synthetase; Provisional 100.0
TIGR03105435 gln_synth_III glutamine synthetase, type III. This fami 100.0
COG0174443 GlnA Glutamine synthetase [Amino acid transport and met 100.0
pfam00120257 Gln-synt_C Glutamine synthetase, catalytic domain. 100.0
PRK13517371 carboxylate-amine ligase; Provisional 98.93
TIGR02050297 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR0117 98.85
PRK13515381 carboxylate-amine ligase; Provisional 98.78
PRK13516372 carboxylate-amine ligase; Provisional 98.69
KOG0683380 consensus 100.0
COG3968 724 Uncharacterized protein related to glutamine synthetase 99.92
pfam0395184 Gln-synt_N Glutamine synthetase, beta-Grasp domain. 99.71
PRK13518357 carboxylate-amine ligase; Provisional 98.7
pfam04107291 GCS2 Glutamate-cysteine ligase family 2(GCS2). Also kno 98.23
COG2170369 Uncharacterized conserved protein [Function unknown] 97.74
KOG0683380 consensus 97.07
>TIGR00653 GlnA glutamine synthetase, type I; InterPro: IPR004809 Glutamine synthetase type I (or glutamate-ammonia ligase) has a dodecameric form, which can be subdivided into 1-alpha and 1-beta forms Back     alignment and domain information
>PRK09469 glnA glutamine synthetase; Provisional Back     alignment and domain information
>TIGR03105 gln_synth_III glutamine synthetase, type III Back     alignment and domain information
>COG0174 GlnA Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00120 Gln-synt_C Glutamine synthetase, catalytic domain Back     alignment and domain information
>PRK13517 carboxylate-amine ligase; Provisional Back     alignment and domain information
>TIGR02050 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR011793 This family represents a division of a larger family, the other branch of which is predicted to act as glutamate--cysteine ligase (the first of two enzymes in glutathione biosynthesis) in the cyanobacteria Back     alignment and domain information
>PRK13515 carboxylate-amine ligase; Provisional Back     alignment and domain information
>PRK13516 carboxylate-amine ligase; Provisional Back     alignment and domain information
>KOG0683 consensus Back     alignment and domain information
>COG3968 Uncharacterized protein related to glutamine synthetase [General function prediction only] Back     alignment and domain information
>pfam03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain Back     alignment and domain information
>PRK13518 carboxylate-amine ligase; Provisional Back     alignment and domain information
>pfam04107 GCS2 Glutamate-cysteine ligase family 2(GCS2) Back     alignment and domain information
>COG2170 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0683 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target458 glutamine synthetase protein [Candidatus Liberibacter a
1f52_A468 Crystal Structure Of Glutamine Synthetase From Salm 1e-107
2gls_A469 Refined Atomic Model Of Glutamine Synthetase At 3.5 1e-107
1hto_A477 Crystallographic Structure Of A Relaxed Glutamine S 1e-103
2bvc_A486 Crystal Structure Of Mycobacterium Tuberculosis Glu 1e-103
2lgs_B446 Feedback Inhibition Of Fully Unadenylylated Glutami 5e-99
2uu7_A381 Crystal Structure Of Apo Glutamine Synthetase From 3e-20
3fky_A370 Crystal Structure Of The Glutamine Synthetase Gln1d 8e-20
2ojw_A384 Crystal Structure Of Human Glutamine Synthetase In 3e-19
2d3a_A356 Crystal Structure Of The Maize Glutamine Synthetase 2e-16
2j9i_A421 Lengsin Is A Survivor Of An Ancient Family Of Class 2e-06
2j9i_A421 Lengsin Is A Survivor Of An Ancient Family Of Class 0.002
>gi|9256961|pdb|1F52|A Chain A, Crystal Structure Of Glutamine Synthetase From Salmonella Typhimurium Co-Crystallized With Adp Length = 468 Back     alignment and structure
 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 197/468 (42%), Positives = 286/468 (61%), Gaps = 13/468 (2%)

Query: 4   KATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHS- 62
            A  ++  + + +VKF+DLRFTD +GK +H+++     N      G  FD SSI GW   
Sbjct: 1   SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGI 60

Query: 63  KHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDI 122
              +++L+PD  T  +DPF+A ST+   C++ +P TLQ Y+RDPR  A++A DYL+ T I
Sbjct: 61  NESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGI 120

Query: 123 GDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQN-------GNNKGYDSHAKSSY 175
            DT+L G   EFF+FD++    S   S  A++  E   N       GN           +
Sbjct: 121 ADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGYF 180

Query: 176 TLPPQDKLHDMRSEIVSALNNIGVQITKYHNQI-NDAQHSFGLQSESLLHASDNLQKYKY 234
            +PP D   D+RSE+   +  +G+ +  +H+++    Q+    +  ++   +D +Q YKY
Sbjct: 181 PVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY 240

Query: 235 SVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGG 294
            VH VA+ + K ATFMPKP+   NGSGM+ +MS+ K    +F+G+++  +S + LYY+GG
Sbjct: 241 VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGG 300

Query: 295 IIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRF 354
           +IKHAK++NAL N +TNSYKRL+   ++P  L YS  N SAS RIP       + IE+RF
Sbjct: 301 VIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRF 360

Query: 355 PDLSANPYLAPAAILMAGLDGIAKKIHPGKNID----ELSLEEQNTIPRICISLRESLEN 410
           PD +ANPYL  AA+LMAGLDGI  KIHPG+ +D    +L  EE   IP++  SL E+L  
Sbjct: 361 PDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLPPEEAKEIPQVAGSLEEALNA 420

Query: 411 LDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI 458
           LD DREFLK G VF D+ IDA+I L+ +E  ++  +P PVEFE+Y S+
Sbjct: 421 LDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV 468


>gi|21730903|pdb|2GLS|A Chain A, Refined Atomic Model Of Glutamine Synthetase At 3.5 Angstroms Resolution Length = 469 Back     alignment and structure
>gi|22218713|pdb|1HTO|A Chain A, Crystallographic Structure Of A Relaxed Glutamine Synthetase From Mycobacterium Tuberculosis Length = 477 Back     alignment and structure
>gi|73536298|pdb|2BVC|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Glutamine Synthetase In Complex With A Transition State Mimic Length = 486 Back     alignment and structure
>gi|158430851|pdb|2UU7|A Chain A, Crystal Structure Of Apo Glutamine Synthetase From Dog ( Canis Familiaris) Length = 381 Back     alignment and structure
gi|260656232|pdb|3FKY|A Chain A, Crystal Structure Of The Glutamine Synthetase Gln1deltan18 From The Yeast Saccharomyces Cerevisiae Length = 370 Back     alignment and structure
>gi|145580062|pdb|2OJW|A Chain A, Crystal Structure Of Human Glutamine Synthetase In Complex With Adp And Phosphate Length = 384 Back     alignment and structure
>gi|112490284|pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate Length = 356 Back     alignment and structure
>gi|122920859|pdb|2J9I|A Chain A, Lengsin Is A Survivor Of An Ancient Family Of Class I Glutamine Synthetases In Eukaryotes That Has Undergone Evolutionary Re-Engineering For A Tissue-Specific Role In The Vertebrate Eye Lens. Length = 421 Back     alignment and structure
>gi|122920859|pdb|2J9I|A Chain A, Lengsin Is A Survivor Of An Ancient Family Of Class I Glutamine Synthetases In Eukaryotes That Has Undergone Evolutionary Re-Engineering For A Tissue-Specific Role In The Vertebrate Eye Lens. Length = 421 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target458 glutamine synthetase protein [Candidatus Liberibacter a
1f52_A468 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A 1e-119
2bvc_A486 Glutamine synthetase 1; ligase, transition state mimic; 8e-88
2j9i_A421 Glutamate-ammonia ligase domain-containing protein 1; 1 2e-63
2ojw_A384 Glutamine synthetase; amino-acid biosynthesis, ligase, 2e-37
3fky_A370 Glutamine synthetase; beta-grAsp, catalytic domain, ace 8e-37
2d3a_A356 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea 4e-35
>1f52_A Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} SCOP: d.15.9.1 d.128.1.1 PDB: 1f1h_A* 1fpy_A* 1lgr_A* 2lgs_A* 2gls_A Length = 468 Back     alignment and structure
 Score =  424 bits (1092), Expect = e-119
 Identities = 202/464 (43%), Positives = 291/464 (62%), Gaps = 13/464 (2%)

Query: 8   IIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKH-PN 66
           ++  + + +VKF+DLRFTD +GK +H+++     N      G  FD SSI GW   +  +
Sbjct: 5   VLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESD 64

Query: 67  LLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTL 126
           ++L+PD  T  +DPF+A ST+   C++ +P TLQ Y+RDPR  A++A DYL+ T I DT+
Sbjct: 65  MVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTV 124

Query: 127 LLGITTEFFVFDNVHCTISPIKSGFALESTEFLQN------GNNKGYDSHAKSSY-TLPP 179
           L G   EFF+FD++    S   S  A++  E   N      G NKG+    K  Y  +PP
Sbjct: 125 LFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGYFPVPP 184

Query: 180 QDKLHDMRSEIVSALNNIGVQITKYHNQINDA-QHSFGLQSESLLHASDNLQKYKYSVHQ 238
            D   D+RSE+   +  +G+ +  +H+++  A Q+    +  ++   +D +Q YKY VH 
Sbjct: 185 VDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKYVVHN 244

Query: 239 VANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKH 298
           VA+ + K ATFMPKP+   NGSGM+ +MS+ K    +F+G+++  +S + LYY+GG+IKH
Sbjct: 245 VAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKH 304

Query: 299 AKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLS 358
           AK++NAL N +TNSYKRL+   ++P  L YS  N SAS RIP       + IE+RFPD +
Sbjct: 305 AKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPA 364

Query: 359 ANPYLAPAAILMAGLDGIAKKIHPG----KNIDELSLEEQNTIPRICISLRESLENLDKD 414
           ANPYL  AA+LMAGLDGI  KIHPG    KN+ +L  EE   IP++  SL E+L  LD D
Sbjct: 365 ANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLPPEEAKEIPQVAGSLEEALNALDLD 424

Query: 415 REFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI 458
           REFLK G VF D+ IDA+I L+ +E  ++  +P PVEFE+Y S+
Sbjct: 425 REFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV 468


>2bvc_A Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} SCOP: d.15.9.1 d.128.1.1 PDB: 2wgs_A* 2whi_A* 1hto_A* 1htq_A* Length = 486 Back     alignment and structure
>2j9i_A Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Length = 421 Back     alignment and structure
>2ojw_A Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Length = 384 Back     alignment and structure
>3fky_A Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Length = 370 Back     alignment and structure
>2d3a_A Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Length = 356 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target458 glutamine synthetase protein [Candidatus Liberibacter a
1f52_A468 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A 100.0
2bvc_A486 Glutamine synthetase 1; ligase, transition state mimic; 100.0
2j9i_A421 Glutamate-ammonia ligase domain-containing protein 1; 1 100.0
3fky_A370 Glutamine synthetase; beta-grAsp, catalytic domain, ace 100.0
2ojw_A384 Glutamine synthetase; amino-acid biosynthesis, ligase, 100.0
2d3a_A356 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea 100.0
1r8g_A372 Hypothetical protein YBDK; structural genomics, unknown 98.61
2gwd_A 449 Glutamate cysteine ligase; disulfide bridges, glutathio 97.04
>1f52_A Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} SCOP: d.15.9.1 d.128.1.1 PDB: 1f1h_A* 1fpy_A* 1lgr_A* 2lgs_A* 2gls_A Back     alignment and structure
Probab=100.00  E-value=0  Score=934.38  Aligned_cols=455  Identities=43%  Similarity=0.745  Sum_probs=408.4

Q ss_pred             CHHHHHHHHHHCCCCEEEEEEECCCCCEEEEEEEHHHHHHHHHHCCCCCCCCCHHCCCC-CCCCEEEEEECCCCEECCCC
Q ss_conf             98999999985798399999978998252378778783055884598456651002468-99888999641105877568
Q gi|254780185|r    4 KATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHS-KHPNLLLIPDIETMHMDPFY   82 (458)
Q Consensus         4 ~~~~i~~~l~~~~I~~V~~~~~Dl~G~~R~k~ip~~~f~~~~~~~G~~fd~s~i~g~~~-~~~D~~l~PD~~T~~~~Pw~   82 (458)
                      ++++|+++|++++|+||+++|+|++|++|+|.||++.|.+.++.+|++||+|++.||.. +++|++++||++|++++||.
T Consensus         1 s~e~v~~~l~~~~i~~V~~~~~Dl~G~~R~k~ip~~~~~~~~~~~G~~fdgssi~g~~~~~~sD~~l~PD~sT~~~~Pw~   80 (468)
T 1f52_A            1 SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFF   80 (468)
T ss_dssp             CHHHHHHHHHHTTCCEEEEEEECTTSCEEEEEEEGGGCCHHHHHHCEEEEGGGSTTSCCSSCCEEEEEECGGGCEECSSC
T ss_pred             CHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECCCCEEECCCC
T ss_conf             97999999998898399999999999878999829997699985898656225257677998898999827840889868


Q ss_pred             CCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCC----
Q ss_conf             9722799852014754485302555323556799873034522577313308997067777786547766676545----
Q gi|254780185|r   83 AQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEF----  158 (458)
Q Consensus        83 ~~~~~~v~~d~~~~~~g~P~~~~PR~~Lk~~~~~l~~~~~G~~~~~g~E~EF~Lf~~~~~~~~p~~~~~~~~~~~~----  158 (458)
                      ++++++|+||++.+.++.|+..|||++|+++++++++.+++..+.+|+|+|||+|+.............+....+.    
T Consensus        81 ~~~~~~v~cd~~~~~~~~p~~~~PR~~l~~~~~~~~~~G~~~~~~~~~E~ef~l~~~~~~~~~~~~~~~~~~~~e~~~~~  160 (468)
T 1f52_A           81 ADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS  160 (468)
T ss_dssp             SSCEEEEEEEEECTTTCCCCTTCHHHHHHHHHHHHHHHTSCSEEEEEEEEEEEEESEEEEEEETTEEEEEEECTTCGGGG
T ss_pred             CCCEEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             98628999998636767887788558999999999875996423414556999631433467878874545762224577


Q ss_pred             --CCCCCCCEEC-CCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CHHHCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             --7777775003-65545563552444689999999999860541122213356-2121036555668887769999999
Q gi|254780185|r  159 --LQNGNNKGYD-SHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQIN-DAQHSFGLQSESLLHASDNLQKYKY  234 (458)
Q Consensus       159 --~~~~~~~g~~-~~~~~~y~~~~~~~~~~~~~ei~~~l~~~Gi~ie~~h~E~g-pGQ~Ei~~~~~~~l~aAD~~~~~k~  234 (458)
                        ....++.++. ....++|++.+.+...++++++++.|+++||+|+++|+|+| +||+||++.|+++|+|||+++++|+
T Consensus       161 ~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~gi~ve~~~~E~~~~GQ~Ei~~~~~d~L~aAD~~~~~K~  240 (468)
T 1f52_A          161 STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY  240 (468)
T ss_dssp             GCCCTTCCCCCCCCTTCCSSBCTTSSCCHHHHHHHHHHHHHTTCCEEEEEECSSTTTEEEEEECCEEHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             87666788675104788712326642067799999999997398721101265678618870567755554679999999


Q ss_pred             HHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCHHCCCCCHHHH
Q ss_conf             99999874497544412101456860120111111467631221555657899999999999886410000066700144
Q gi|254780185|r  235 SVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYK  314 (458)
Q Consensus       235 ~ik~iA~~~G~~ATFmpKP~~~~~GsG~Hih~Sl~~~~~n~f~~~~~~~ls~~~~~fiaGil~h~~al~a~~~PtvNSYk  314 (458)
                      +||+||++||++|||||||+.+.+|||||+|+|||++|+|+|+++++.+||.++++||||||+|+|+++||+|||+||||
T Consensus       241 ~vk~iA~~~Gl~ATFmpKP~~~~~GsG~H~H~Sl~~~g~n~f~~~~~~~lS~~~~~~iaGlL~h~~~l~a~~~PtvNSYk  320 (468)
T 1f52_A          241 VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYK  320 (468)
T ss_dssp             HHHHHHHHTTCEEECCSCSSTTSCCCCEEEEEEEEETTEETTBCSSGGGBCHHHHHHHHHHHHTHHHHHHHHSCSGGGGG
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHC
T ss_conf             99999996196468840126888887437999835899606689887772899999999999863766605558815641


Q ss_pred             HHCCCCCCCEEEEECCCCCCCEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHH--
Q ss_conf             318885212010113688764010257887654124404675321279999999999998788559998665578877--
Q gi|254780185|r  315 RLLTDSQSPTKLTYSTHNHSASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLE--  392 (458)
Q Consensus       315 Rl~p~~~ap~~~~WG~~NR~a~iRip~~~~~~~~riE~R~~da~aNPYL~lAailaAgl~Gi~~~l~p~~~~~~~~~~--  392 (458)
                      ||+|++|||+++|||.+||+++||||..++++++|||+|++|++|||||++||+|+|||+||+++++|++|+.+++++  
T Consensus       321 Rl~p~~~AP~~~~WG~~NR~~~iRip~~~~~~~~riE~R~~da~aNPYL~lAa~laagl~Gi~~~l~p~~p~~~~~~~~~  400 (468)
T 1f52_A          321 RLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP  400 (468)
T ss_dssp             TSSSCSSCCCEEEEESSCTTEEEECCCCSCGGGCCEEECCCCTTSCHHHHHHHHHHHHHHHHHTTCCCCSCCCSCCSSSC
T ss_pred             CCCCCCCCCCCCEECCCCCCEEEEECCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCC
T ss_conf             67898758863352222584207815578987615784379987698999999999999999837999986778814499


Q ss_pred             --HHHCCCCCCCCHHHHHHHHHHCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCC
Q ss_conf             --771320001798999999873989898413378899999999999999999659997899863579
Q gi|254780185|r  393 --EQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI  458 (458)
Q Consensus       393 --~~~~~~~LP~~L~eAl~~l~~d~~~~~~~~~lG~~~v~~~~~~K~~E~~~~~~~vt~wE~~~Y~~~  458 (458)
                        +...+++||+||.|||++|++|+++++..++||++||+.|+++||+||++|++.||+||+++||+|
T Consensus       401 ~~~~~~~~~LP~sl~eAl~~l~~d~~~~~a~~~fg~~~v~~~~~~K~~E~~~~~~~vt~wE~~~Y~~~  468 (468)
T 1f52_A          401 PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV  468 (468)
T ss_dssp             CSSTTCCCBCCSSHHHHHHHHHHTCHHHHGGGSSCHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHTTC
T ss_pred             HHHHHCHHCCCCCHHHHHHHHHCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCC
T ss_conf             86761310161379999999973969888655156999999999999999999779999999740689



>2bvc_A Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} SCOP: d.15.9.1 d.128.1.1 PDB: 2wgs_A* 2whi_A* 1hto_A* 1htq_A* Back     alignment and structure
>2j9i_A Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>3fky_A Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojw_A Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2d3a_A Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>1r8g_A Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} SCOP: d.128.1.3 PDB: 1tt4_A Back     alignment and structure
>2gwd_A Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 458 glutamine synthetase protein [Candidatus Liberibacter a
d1f52a2368 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal 8e-74
d2bvca2374 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal 5e-65
d1f52a1100 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal dom 2e-22
d2bvca1100 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal dom 2e-20
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 368 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamine synthetase catalytic domain
domain: Glutamine synthetase, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]
 Score =  271 bits (694), Expect = 8e-74
 Identities = 164/368 (44%), Positives = 231/368 (62%), Gaps = 12/368 (3%)

Query: 103 NRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQN- 161
           +RDPR  A++A DYL+ T I DT+L G   EFF+FD++    S   S  A++  E   N 
Sbjct: 1   DRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS 60

Query: 162 -----GNNKGYDSHAKSSY-TLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQ-HS 214
                G NKG+    K  Y  +PP D   D+RSE+   +  +G+ +  +H+++  A  + 
Sbjct: 61  STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNE 120

Query: 215 FGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKA 274
              +  ++   +D +Q YKY VH VA+ + K ATFMPKP+   NGSGM+ +MS+ K    
Sbjct: 121 VATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTN 180

Query: 275 IFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHS 334
           +F+G+++  +S + LYY+GG+IKHAK++NAL N +TNSYKRL+   ++P  L YS  N S
Sbjct: 181 LFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRS 240

Query: 335 ASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPG----KNIDELS 390
           AS RIP       + IE+RFPD +ANPYL  AA+LMAGLDGI  KIHPG    KN+ +L 
Sbjct: 241 ASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP 300

Query: 391 LEEQNTIPRICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPV 450
            EE   IP++  SL E+L  LD DREFLK G VF D+ IDA+I L+ +E  ++  +P PV
Sbjct: 301 PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPV 360

Query: 451 EFEMYCSI 458
           EFE+Y S+
Sbjct: 361 EFELYYSV 368


>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 374 Back     information, alignment and structure
>d1f52a1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 100 Back     information, alignment and structure
>d2bvca1 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 100 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target458 glutamine synthetase protein [Candidatus Liberibacter a
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonella typ 100.0
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacterium 100.0
d1f52a1100 Glutamine synthetase, N-terminal domain {Salmonella typ 99.91
d2bvca1100 Glutamine synthetase, N-terminal domain {Mycobacterium 99.91
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 98.37
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamine synthetase catalytic domain
domain: Glutamine synthetase, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]
Probab=100.00  E-value=0  Score=752.02  Aligned_cols=356  Identities=44%  Similarity=0.747  Sum_probs=313.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCC------CCCCCCCCEECCC-CCCCC
Q ss_conf             0255532355679987303452257731330899706777778654776667654------5777777500365-54556
Q gi|254780185|r  103 NRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTE------FLQNGNNKGYDSH-AKSSY  175 (458)
Q Consensus       103 ~~~PR~~Lk~~~~~l~~~~~G~~~~~g~E~EF~Lf~~~~~~~~p~~~~~~~~~~~------~~~~~~~~g~~~~-~~~~y  175 (458)
                      +.|||++|||+++++++.++..++.+|+|+|||||+++...........+.+...      ....+.+.++... ..++|
T Consensus         1 ~~dPR~iLkr~~~~l~~~G~~~~~~~g~E~EF~Lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (368)
T d1f52a2           1 DRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGYF   80 (368)
T ss_dssp             TTCHHHHHHHHHHHHHHHTSCSEEEEEEEEEEEEESEEEEEEETTEEEEEEECTTCGGGGGCCCTTCCCCCCCCTTCCSS
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEECEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             98879999999999997699870378854288999421035576777565577322456887666887787655577615


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             3552444689999999999860541122213356-212103655566888776999999999999874497544412101
Q gi|254780185|r  176 TLPPQDKLHDMRSEIVSALNNIGVQITKYHNQIN-DAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPI  254 (458)
Q Consensus       176 ~~~~~~~~~~~~~ei~~~l~~~Gi~ie~~h~E~g-pGQ~Ei~~~~~~~l~aAD~~~~~k~~ik~iA~~~G~~ATFmpKP~  254 (458)
                      ++.+.+...+++++|++.|+.+||+|+++|+|+| ||||||++.|.++|+|||+++++|++||+||++||++|||||||+
T Consensus        81 ~~~~~~~~~~~~~~i~~~l~~~Gi~ve~~~~E~~~~gq~Ei~~~~~~~l~aAD~~~~~k~~ik~iA~~~Gl~atFmpKP~  160 (368)
T d1f52a2          81 PVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKPM  160 (368)
T ss_dssp             BCTTSSCCHHHHHHHHHHHHHTTCCEEEEEECSSTTTEEEEEECCEEHHHHHHHHHHHHHHHHHHHHHTTCEEECCSCSS
T ss_pred             EEECCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCC
T ss_conf             53001107889999999888622570564223456784322078786577889999999999999997436334741568


Q ss_pred             CCCCCCHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCHHCCCCCHHHHHHCCCCCCCEEEEECCCCCC
Q ss_conf             45686012011111146763122155565789999999999988641000006670014431888521201011368876
Q gi|254780185|r  255 ASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHS  334 (458)
Q Consensus       255 ~~~~GsG~Hih~Sl~~~~~n~f~~~~~~~ls~~~~~fiaGil~h~~al~a~~~PtvNSYkRl~p~~~ap~~~~WG~~NR~  334 (458)
                      .+.+|||||+|+|||++++|+|.++++.+||+.+++||||||+|++++|+|++||+||||||+|++|||++++||.+||+
T Consensus       161 ~~~~GsG~HiH~Sl~~~~~n~~~~~~~~~lS~~~~~fiaGll~~~~~~~al~~PtvNSYkRl~~~~~aP~~~~Wg~~NR~  240 (368)
T d1f52a2         161 FGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRS  240 (368)
T ss_dssp             TTSCCCCEEEEEEEEETTEETTBCSSGGGBCHHHHHHHHHHHHTHHHHHHHHSCSGGGGGTSSSCSSCCCEEEEESSCTT
T ss_pred             CCCCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEECCCCCC
T ss_conf             89877532589874159985656555556489999999999986699899977996077652477768743452367655


Q ss_pred             CEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHH----HHHCCCCCCCCHHHHHHH
Q ss_conf             4010257887654124404675321279999999999998788559998665578877----771320001798999999
Q gi|254780185|r  335 ASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLE----EQNTIPRICISLRESLEN  410 (458)
Q Consensus       335 a~iRip~~~~~~~~riE~R~~da~aNPYL~lAailaAgl~Gi~~~l~p~~~~~~~~~~----~~~~~~~LP~~L~eAl~~  410 (458)
                      ++||||..++++++|||+|++|++|||||++||+|+|||+||+++++||+++.++.++    +...+++||.||.|||++
T Consensus       241 a~iRi~~~~~~~~~riE~R~~da~aNPYL~lAa~laagl~Gi~~~l~~~~~~~~~~~~~~~~~~~~~~~lP~sl~eAl~a  320 (368)
T d1f52a2         241 ASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLPPEEAKEIPQVAGSLEEALNA  320 (368)
T ss_dssp             EEEECCCCSCGGGCCEEECCCCTTSCHHHHHHHHHHHHHHHHHTTCCCCSCCCSCCSSSCCSSTTCCCBCCSSHHHHHHH
T ss_pred             CCEEECCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHCCHHHHHCHHCCCCCHHHHHHH
T ss_conf             31464025788662478447880177789999999976542421589999777872448976762320151379999999


Q ss_pred             HHHCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCC
Q ss_conf             873989898413378899999999999999999659997899863579
Q gi|254780185|r  411 LDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI  458 (458)
Q Consensus       411 l~~d~~~~~~~~~lG~~~v~~~~~~K~~E~~~~~~~vt~wE~~~Y~~~  458 (458)
                      |++|+++....++||++|++.|+++||+||++|+++||+||+++||||
T Consensus       321 l~~d~~~~~a~~~lGe~~v~~y~~~K~~E~~~~~~~vt~wE~~~Yl~~  368 (368)
T d1f52a2         321 LDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV  368 (368)
T ss_dssp             HHHTCHHHHGGGSSCHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHTTC
T ss_pred             HHCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCC
T ss_conf             964978788765156999999999999999999679999999741689



>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f52a1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bvca1 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 458 glutamine synthetase protein [Candidatus Liberibac
2bvc_A_115-416302 (A:115-416) Glutamine synthetase 1; ligase, transi 4e-49
1f52_A_99-399301 (A:99-399) Glutamine synthetase; ADP, MPD, ligase; 2e-46
2d3a_A_105-356252 (A:105-356) Glutamine synthetase; ligase; HET: P3S 1e-34
3fky_A_107-370264 (A:107-370) Glutamine synthetase; beta-grAsp, cata 4e-34
2ojw_A_129-384256 (A:129-384) Glutamine synthetase; amino-acid biosy 2e-32
2j9i_A_96-127_223-358168 (A:96-127,A:223-358) Glutamate-ammonia ligase doma 8e-32
2bvc_A_1-114114 (A:1-114) Glutamine synthetase 1; ligase, transiti 7e-26
1f52_A_1-9898 (A:1-98) Glutamine synthetase; ADP, MPD, ligase; H 1e-22
2j9i_A_1-9595 (A:1-95) Glutamate-ammonia ligase domain-containin 4e-22
2j9i_A_128-22295 (A:128-222) Glutamate-ammonia ligase domain-contai 9e-14
2j9i_A_359-42163 (A:359-421) Glutamate-ammonia ligase domain-contai 2e-11
>2bvc_A (A:115-416) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis}Length = 302 Back     alignment and structure
 Score =  190 bits (482), Expect = 4e-49
 Identities = 109/297 (36%), Positives = 154/297 (51%), Gaps = 13/297 (4%)

Query: 105 DPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQN--- 161
           DPR  A+KA +YL +T I DT   G   EF++FD+V        S + +++     N   
Sbjct: 1   DPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGA 60

Query: 162 -------GNNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKY-HNQINDAQH 213
                   N      H    + + P D+  D+R ++++ L N G  + K  H   +  Q 
Sbjct: 61  ATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQA 120

Query: 214 SFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEK 273
               Q  SLLHA+D++Q YKY +   A    K  TFMPKP+   NGSGM+ + S+ K   
Sbjct: 121 EINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGA 180

Query: 274 AIF-TGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHN 332
            +      +  +S    +Y+GG++ HA SL A TN + NSYKRL+   ++P  L YS  N
Sbjct: 181 PLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRN 240

Query: 333 HSASCRIP-YENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDE 388
            SA  RIP   +    K +E R PD S NPYLA +A+LMAGLDGI  KI P   +D+
Sbjct: 241 RSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDK 297


>1f52_A (A:99-399) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium}Length = 301 Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A*Length = 252 Back     alignment and structure
>3fky_A (A:107-370) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae}Length = 264 Back     alignment and structure
>2ojw_A (A:129-384) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_ALength = 256 Back     alignment and structure
>2j9i_A (A:96-127,A:223-358) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 168 Back     alignment and structure
>2bvc_A (A:1-114) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis}Length = 114 Back     alignment and structure
>1f52_A (A:1-98) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium}Length = 98 Back     alignment and structure
>2j9i_A (A:1-95) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 95 Back     alignment and structure
>2j9i_A (A:128-222) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 95 Back     alignment and structure
>2j9i_A (A:359-421) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus}Length = 63 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target458 glutamine synthetase protein [Candidatus Liberibacter a
1f52_A_99-399301 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 100.0
2bvc_A_115-416302 Glutamine synthetase 1; ligase, transition state m 100.0
3fky_A_107-370264 Glutamine synthetase; beta-grAsp, catalytic domain 100.0
2ojw_A_129-384256 Glutamine synthetase; amino-acid biosynthesis, lig 100.0
2d3a_A_105-356252 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 100.0
1r8g_A_372 Hypothetical protein YBDK; structural genomics, un 98.44
2j9i_A_96-127_223-358168 Glutamate-ammonia ligase domain-containing protein 100.0
2bvc_A_1-114114 Glutamine synthetase 1; ligase, transition state m 99.91
1f52_A_1-9898 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 99.88
2j9i_A_1-9595 Glutamate-ammonia ligase domain-containing protein 99.88
3fky_A_1-106106 Glutamine synthetase; beta-grAsp, catalytic domain 98.61
2d3a_A_1-104104 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 98.44
2ojw_A_42-12887 Glutamine synthetase; amino-acid biosynthesis, lig 98.39
2j9i_A_128-22295 Glutamate-ammonia ligase domain-containing protein 99.85
2j9i_A_359-42163 Glutamate-ammonia ligase domain-containing protein 99.24
2gwd_A_1-422422 Glutamate cysteine ligase; disulfide bridges, glut 98.29
1va6_A_19-156_243-337_461-481254 Glutamate--cysteine ligase; glutathione homeostasi 96.64
2d3a_A_105-356252 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 93.45
>1f52_A (A:99-399) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} Back     alignment and structure
Probab=100.00  E-value=0  Score=615.98  Aligned_cols=291  Identities=43%  Similarity=0.708  Sum_probs=262.1

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCC------C-CCCCCEECCCCCCC
Q ss_conf             3025553235567998730345225773133089970677777865477666765457------7-77775003655455
Q gi|254780185|r  102 YNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFL------Q-NGNNKGYDSHAKSS  174 (458)
Q Consensus       102 ~~~~PR~~Lk~~~~~l~~~~~G~~~~~g~E~EF~Lf~~~~~~~~p~~~~~~~~~~~~~------~-~~~~~g~~~~~~~~  174 (458)
                      |+.|||++|||+++++++.++++++++|+|+|||||++......+.....+.......      . .....+......++
T Consensus         2 ~~~~pR~vLkr~~~~l~~~G~~~~~~~g~E~EF~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (301)
T 1f52_A            2 YDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGY   81 (301)
T ss_dssp             CTTCHHHHHHHHHHHHHHHTSCSEEEEEEEEEEEEESEEEEEEETTEEEEEEECTTCGGGGGCCCTTCCCCCCCCTTCCS
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             88896999999999999819963134345347999744434556666633446411135678766678878765766530


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             635524446899999999998605411222-1335621210365556688877699999999999987449754441210
Q gi|254780185|r  175 YTLPPQDKLHDMRSEIVSALNNIGVQITKY-HNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKP  253 (458)
Q Consensus       175 y~~~~~~~~~~~~~ei~~~l~~~Gi~ie~~-h~E~gpGQ~Ei~~~~~~~l~aAD~~~~~k~~ik~iA~~~G~~ATFmpKP  253 (458)
                      |++.+.+...++++++++.|+++||+|+++ |+|+||||+||++.|+++|++||+++++|++||+||.+||+.|||||||
T Consensus        82 ~~~~~~~~~~~~~~~i~~~l~~~Gi~v~~~~h~E~~~gQ~Ei~~~~~~~l~aAD~~~~~r~~ik~vA~~~G~~atFmpKP  161 (301)
T 1f52_A           82 FPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKP  161 (301)
T ss_dssp             SBCTTSSCCHHHHHHHHHHHHHTTCCEEEEEECSSTTTEEEEEECCEEHHHHHHHHHHHHHHHHHHHHHTTCEEECCSCS
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEECCCC
T ss_conf             26774200789999999999976997177550223678779950678788889999999999999999849878971666


Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCHHCCCCCHHHHHHCCCCCCCEEEEECCCCC
Q ss_conf             14568601201111114676312215556578999999999998864100000667001443188852120101136887
Q gi|254780185|r  254 IASHNGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNH  333 (458)
Q Consensus       254 ~~~~~GsG~Hih~Sl~~~~~n~f~~~~~~~ls~~~~~fiaGil~h~~al~a~~~PtvNSYkRl~p~~~ap~~~~WG~~NR  333 (458)
                      +.+.+|||||+|+|||++++|+|.++++.+||..+++||||||+|++++++|++||+||||||+|++|||++++||.+||
T Consensus       162 ~~~~~Gsg~H~h~Sl~~~~~n~~~~~~~~~lS~~~~~fiaGil~h~~~l~a~~~pt~nSY~Rl~~~~~ap~~~~wG~~NR  241 (301)
T 1f52_A          162 MFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR  241 (301)
T ss_dssp             STTSCCCCEEEEEEEEETTEETTBCSSGGGBCHHHHHHHHHHHHTHHHHHHHHSCSGGGGGTSSSCSSCCCEEEEESSCT
T ss_pred             CCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCCCCCEECCCCC
T ss_conf             79999661479972456998667777765522999999999999999977643799863321579865777531236677


Q ss_pred             CCEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHH
Q ss_conf             64010257887654124404675321279999999999998788559998665578877
Q gi|254780185|r  334 SASCRIPYENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLE  392 (458)
Q Consensus       334 ~a~iRip~~~~~~~~riE~R~~da~aNPYL~lAailaAgl~Gi~~~l~p~~~~~~~~~~  392 (458)
                      +++||||..+.++++|||+|++|++|||||++||+|+||+|||+++++||+|++++.+|
T Consensus       242 ~a~iRvp~~~~~~~~r~E~R~~da~aNPYl~lAail~agl~Gi~~~l~~~~~~~~~~~e  300 (301)
T 1f52_A          242 SASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYD  300 (301)
T ss_dssp             TEEEECCCCSCGGGCCEEECCCCTTSCHHHHHHHHHHHHHHHHHTTCCCCSCCCSCCSS
T ss_pred             CCEEEECCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             53088303689877667863788887899999999999999998479999888786244



>2bvc_A (A:115-416) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} Back     alignment and structure
>3fky_A (A:107-370) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojw_A (A:129-384) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>1r8g_A (A:) Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} Back     alignment and structure
>2j9i_A (A:96-127,A:223-358) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>2bvc_A (A:1-114) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} Back     alignment and structure
>1f52_A (A:1-98) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} Back     alignment and structure
>2j9i_A (A:1-95) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>3fky_A (A:1-106) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2d3a_A (A:1-104) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>2ojw_A (A:42-128) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2j9i_A (A:128-222) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>2j9i_A (A:359-421) Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>2gwd_A (A:1-422) Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Back     alignment and structure
>1va6_A (A:19-156,A:243-337,A:461-481) Glutamate--cysteine ligase; glutathione homeostasis, beta barrel, peptide synthesis, transition state analogue; HET: P2S ADP P6G; 2.10A {Escherichia coli} Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure