254780186

254780186

glutaminase

GeneID in NCBI database:8209166Locus tag:CLIBASIA_00345
Protein GI in NCBI database:254780186Protein Accession:YP_003064599.1
Gene range:-(71726, 72661)Protein Length:311aa
Gene description:glutaminase
COG prediction:[E] Glutaminase
KEGG prediction:glsA; glutaminase (EC:3.5.1.2); K01425 glutaminase [EC:3.5.1.2]
SEED prediction:Glutaminase (EC 3.5.1.2)
Pathway involved in KEGG:Nitrogen metabolism [PATH:las00910]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Arginine and proline metabolism [PATH:las00330]
D-Glutamine and D-glutamate metabolism [PATH:las00471]
Subsystem involved in SEED:Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI
ccHHHHHHHHHHHHHHHHcccccccccHHHccccHHHcEEEEEEccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHHHHHHHHcccccHHcHHHHHHccccHccEEEEEEEccEEEEEccccccccHHHHHHHHHHHHHHHHHcHHHHHHccccccccccHHHHHHHHccccccccHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccEEccHHHHHHHHHHHHHcccccccccEEEEEccccccccccEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccEcc
MDLKKIIDGIYEEikpqigqgrvadYIPELAKVRIDHFgmslaledgtvysvgeSEFLFSIQSISKVFLLTIALRKFDEEIWKrvgrepsgssfDSIVQLEnengiprnpfvnaGAIVVSDavlgsssadDAIENFLNFMRgiagdasihidsvvanseietgyrnfALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFrgynsltnqsvisplqsrcVNAVMLTcghydhsgdfayrvgfpgksgvgggilaivpskasiavwspgldnsgnslLGAKALELLAIRtgwsifdpsvi
MDLKKIIDGIyeeikpqigqgrVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVgrepsgssfdSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAirtgwsifdpsvi
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVgfpgksgvgggILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI
*DLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPS**
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI
MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDPSVI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
315122616311 glutaminase [Candidatus Liberibacter solanacearum CLso- 1 1e-141
222086150309 glutaminase protein [Agrobacterium radiobacter K84] Len 1 1e-112
116252369309 glutaminase [Rhizobium leguminosarum bv. viciae 3841] L 1 1e-111
241204875309 glutaminase [Rhizobium leguminosarum bv. trifolii WSM13 1 1e-111
222148433308 glutaminase [Agrobacterium vitis S4] Length = 308 1 1e-111
190891997309 glutaminase protein [Rhizobium etli CIAT 652] Length = 1 1e-111
209549540309 glutaminase [Rhizobium leguminosarum bv. trifolii WSM23 1 1e-110
327190533309 glutaminase protein [Rhizobium etli CNPAF512] Length = 1 1e-110
3746520309 glutaminase A [Rhizobium etli CFN 42] Length = 309 1 1e-109
86357926309 glutaminase [Rhizobium etli CFN 42] Length = 309 1 1e-109
>gi|315122616|ref|YP_004063105.1| glutaminase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 311 Back     alignment and organism information
 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/311 (76%), Positives = 279/311 (89%)

Query: 1   MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFS 60
           MD K I++ IYE+IKP +GQG VADYIPELAKV  +HFG+SLALEDG++YS G+S+ LFS
Sbjct: 1   MDFKGIVNSIYEDIKPHLGQGHVADYIPELAKVDSNHFGISLALEDGSIYSAGDSDILFS 60

Query: 61  IQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVS 120
           +QSISKVFLLTIAL+K +E+IW RVGREPSG SFDSI+QLE+E GIPRNPFVNAGAIV+S
Sbjct: 61  VQSISKVFLLTIALQKLNEDIWTRVGREPSGFSFDSIIQLEHERGIPRNPFVNAGAIVMS 120

Query: 121 DAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIR 180
           DAVL +SS D  I+NFLNF+  ++ D+SI+ID VVANSEI+TGYRNFALANF+RS+GNIR
Sbjct: 121 DAVLENSSLDHEIKNFLNFVHVLSDDSSIYIDPVVANSEIQTGYRNFALANFIRSFGNIR 180

Query: 181 YKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCG 240
           Y I+DVLKFYF+QC+LMMNCVQLA+SGLYL  RGY+ LT + +ISP QSRC+NA+MLTCG
Sbjct: 181 YNIDDVLKFYFNQCALMMNCVQLARSGLYLTCRGYSPLTKKQIISPQQSRCINAIMLTCG 240

Query: 241 HYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIR 300
           HYD+SGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGL++ GNS LGAKALELLA+R
Sbjct: 241 HYDNSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLNSVGNSFLGAKALELLALR 300

Query: 301 TGWSIFDPSVI 311
           TGWS+FDP  I
Sbjct: 301 TGWSVFDPIAI 311


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086150|ref|YP_002544682.1| glutaminase protein [Agrobacterium radiobacter K84] Length = 309 Back     alignment and organism information
>gi|116252369|ref|YP_768207.1| glutaminase [Rhizobium leguminosarum bv. viciae 3841] Length = 309 Back     alignment and organism information
>gi|241204875|ref|YP_002975971.1| glutaminase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 309 Back     alignment and organism information
>gi|222148433|ref|YP_002549390.1| glutaminase [Agrobacterium vitis S4] Length = 308 Back     alignment and organism information
>gi|190891997|ref|YP_001978539.1| glutaminase protein [Rhizobium etli CIAT 652] Length = 309 Back     alignment and organism information
>gi|209549540|ref|YP_002281457.1| glutaminase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 309 Back     alignment and organism information
>gi|327190533|gb|EGE57627.1| glutaminase protein [Rhizobium etli CNPAF512] Length = 309 Back     alignment and organism information
>gi|3746520|gb|AAC63991.1| glutaminase A [Rhizobium etli CFN 42] Length = 309 Back     alignment and organism information
>gi|86357926|ref|YP_469818.1| glutaminase [Rhizobium etli CFN 42] Length = 309 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
PRK00971307 PRK00971, PRK00971, glutaminase; Provisional 1e-137
TIGR03814300 TIGR03814, Gln_ase, glutaminase A 1e-130
pfam04960286 pfam04960, Glutaminase, Glutaminase 1e-109
PRK12356319 PRK12356, PRK12356, glutaminase; Reviewed 4e-68
PRK12357326 PRK12357, PRK12357, glutaminase; Reviewed 7e-58
KOG0506 622 KOG0506, KOG0506, KOG0506, Glutaminase (contains ankyri 9e-57
COG2066309 COG2066, GlsA, Glutaminase [Amino acid transport and me 1e-110
>gnl|CDD|179191 PRK00971, PRK00971, glutaminase; Provisional Back     alignment and domain information
>gnl|CDD|163526 TIGR03814, Gln_ase, glutaminase A Back     alignment and domain information
>gnl|CDD|147236 pfam04960, Glutaminase, Glutaminase Back     alignment and domain information
>gnl|CDD|183468 PRK12356, PRK12356, glutaminase; Reviewed Back     alignment and domain information
>gnl|CDD|183469 PRK12357, PRK12357, glutaminase; Reviewed Back     alignment and domain information
>gnl|CDD|35726 KOG0506, KOG0506, KOG0506, Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|32249 COG2066, GlsA, Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 311 glutaminase [Candidatus Liberibacter asiaticus str. psy
PRK00971308 glutaminase; Provisional 100.0
PRK12356319 glutaminase; Reviewed 100.0
PRK12357326 glutaminase; Reviewed 100.0
pfam04960286 Glutaminase Glutaminase. This family of enzymes deamina 100.0
COG2066309 GlsA Glutaminase [Amino acid transport and metabolism] 100.0
KOG0506 622 consensus 100.0
PRK09506839 mrcB penicillin-binding protein 1b; Reviewed 95.88
pfam00905296 Transpeptidase Penicillin binding protein transpeptidas 97.41
TIGR03423592 pbp2_mrdA penicillin-binding protein 2. Members of this 96.24
COG0768599 FtsI Cell division protein FtsI/penicillin-binding prot 96.68
PRK11240 770 penicillin-binding protein 1C; Provisional 92.93
COG4953 733 PbpC Membrane carboxypeptidase/penicillin-binding prote 91.5
PRK10662377 beta-lactamase/D-alanine carboxypeptidase; Provisional 91.41
>PRK00971 glutaminase; Provisional Back     alignment and domain information
>PRK12356 glutaminase; Reviewed Back     alignment and domain information
>PRK12357 glutaminase; Reviewed Back     alignment and domain information
>pfam04960 Glutaminase Glutaminase Back     alignment and domain information
>COG2066 GlsA Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Back     alignment and domain information
>PRK09506 mrcB penicillin-binding protein 1b; Reviewed Back     alignment and domain information
>pfam00905 Transpeptidase Penicillin binding protein transpeptidase domain Back     alignment and domain information
>TIGR03423 pbp2_mrdA penicillin-binding protein 2 Back     alignment and domain information
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11240 penicillin-binding protein 1C; Provisional Back     alignment and domain information
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10662 beta-lactamase/D-alanine carboxypeptidase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
3czd_A315 Crystal Structure Of Human Glutaminase In Complex W 1e-109
2pby_A308 Probable Glutaminase From Geobacillus Kaustophilus 1e-107
1u60_A310 Mcsg Apc5046 Probable Glutaminase Ybas Length = 310 1e-100
3agf_A327 Crystal Structure Of Bacillus Glutaminase In The Pr 2e-94
3if5_A 456 Crystal Structure Analysis Of Mglu Length = 456 7e-92
2osu_A330 Probable Glutaminase From Bacillus Subtilis Complex 3e-90
1mki_A330 Crystal Structure Of Bacillus Subtilis Probable Glu 2e-89
2dfw_A396 Crystal Structure Of A Major Fragment Of The Salt-T 3e-87
>gi|313507313|pdb|3CZD|A Chain A, Crystal Structure Of Human Glutaminase In Complex With L- Glutamate Length = 315 Back     alignment and structure
 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 111/310 (35%), Positives = 164/310 (52%), Gaps = 6/310 (1%)

Query: 1   MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFS 60
           M     ID +YE  K Q G G+VADYIP+LAK   D +G+S+   DG  +S G+++  F 
Sbjct: 7   MSFTSHIDELYESAKKQSG-GKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFC 65

Query: 61  IQSISKVFLLTIALRKFD-EEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVV 119
           +QS  K     IA+     E + + VG+EPSG  F+ +   E++   P NP VNAGAIVV
Sbjct: 66  LQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDD--KPHNPMVNAGAIVV 123

Query: 120 SDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNI 179
           +  +    +  +  +  + F+  +AG+  +   +    SE E+G RNFA+  +++     
Sbjct: 124 TSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCF 183

Query: 180 RYKIEDV--LKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVML 237
               + V  L FYF  CS+ + C   +     LA  G+  +T + V+SP   R   ++M 
Sbjct: 184 PEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMH 243

Query: 238 TCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELL 297
           +CG YD SG FA+ VG P KSGV GGIL +VP+   +  WSP LD  GNS+ G      L
Sbjct: 244 SCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDL 303

Query: 298 AIRTGWSIFD 307
                +  +D
Sbjct: 304 VSLCNFHNYD 313


gi|149243069|pdb|2PBY|A Chain A, Probable Glutaminase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
gi|55670184|pdb|1U60|A Chain A, Mcsg Apc5046 Probable Glutaminase Ybas Length = 310 Back     alignment and structure
gi|328877145|pdb|3AGF|A Chain A, Crystal Structure Of Bacillus Glutaminase In The Presence Of 4.3m Nacl Length = 327 Back     alignment and structure
>gi|255311965|pdb|3IF5|A Chain A, Crystal Structure Analysis Of Mglu Length = 456 Back     alignment and structure
>gi|134105372|pdb|2OSU|A Chain A, Probable Glutaminase From Bacillus Subtilis Complexed With 6-Diazo-5-Oxo-L-Norleucine Length = 330 Back     alignment and structure
>gi|31615588|pdb|1MKI|A Chain A, Crystal Structure Of Bacillus Subtilis Probable Glutaminase, Apc1040 Length = 330 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
3czd_A315 Glutaminase kidney isoform; glutamine, glutamate, K-glu 1e-113
3ih8_A 456 Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcu 1e-110
2pby_A308 Glutaminase; secsg, riken, structural genomics, PSI, pr 1e-109
1u60_A310 Probable glutaminase YBAS; structural genomics, APC5046 1e-107
1mki_A330 Probable glutaminase YBGJ; structural genomics, PSI, pr 1e-105
>3czd_A Glutaminase kidney isoform; glutamine, glutamate, K-glutaminase, SGC, structural genomics consortium, alternative splicing, ANK repeat, hydrolase; HET: GLU; 2.40A {Homo sapiens} Length = 315 Back     alignment and structure
 Score =  404 bits (1040), Expect = e-113
 Identities = 110/310 (35%), Positives = 163/310 (52%), Gaps = 6/310 (1%)

Query: 1   MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFS 60
           M     ID +YE  K Q G G+VADYIP+LAK   D +G+S+   DG  +S G+++  F 
Sbjct: 7   MSFTSHIDELYESAKKQSG-GKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFC 65

Query: 61  IQSISKVFLLTIALRKF-DEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVV 119
           +QS  K     IA+     E + + VG+EPSG  F+ +   E+    P NP VNAGAIVV
Sbjct: 66  LQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNED--DKPHNPMVNAGAIVV 123

Query: 120 SDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNI 179
           +  +    +  +  +  + F+  +AG+  +   +    SE E+G RNFA+  +++     
Sbjct: 124 TSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCF 183

Query: 180 RYK--IEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVML 237
                +  +L FYF  CS+ + C   +     LA  G+  +T + V+SP   R   ++M 
Sbjct: 184 PEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMH 243

Query: 238 TCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELL 297
           +CG YD SG FA+ VG P KSGV GGIL +VP+   +  WSP LD  GNS+ G      L
Sbjct: 244 SCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDL 303

Query: 298 AIRTGWSIFD 307
                +  +D
Sbjct: 304 VSLCNFHNYD 313


>3ih8_A Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Length = 456 Back     alignment and structure
>2pby_A Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426} Length = 308 Back     alignment and structure
>1u60_A Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} SCOP: e.3.1.2 Length = 310 Back     alignment and structure
>1mki_A Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} SCOP: e.3.1.2 PDB: 2osu_A* 3brm_A* Length = 330 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
2pby_A308 Glutaminase; secsg, riken, structural genomics, PSI, pr 100.0
3ih8_A 456 Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcu 100.0
1u60_A310 Probable glutaminase YBAS; structural genomics, APC5046 100.0
1mki_A330 Probable glutaminase YBGJ; structural genomics, PSI, pr 100.0
3czd_A315 Glutaminase kidney isoform; glutamine, glutamate, K-glu 100.0
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 96.94
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 94.78
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 97.23
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 96.29
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 95.23
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 94.87
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 93.39
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 95.99
2dcf_A392 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A { 95.55
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 95.23
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 94.71
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 91.61
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 95.99
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 90.95
3i7j_A280 Beta-lactamase MB2281C; alpha-beta protein., structural 94.05
1qme_A 702 Penicillin-binding protein 2X; peptidoglycan synthesis, 92.28
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 92.24
>2pby_A Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426} Back     alignment and structure
Probab=100.00  E-value=0  Score=898.59  Aligned_cols=305  Identities=38%  Similarity=0.647  Sum_probs=299.4

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCHHHCEEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCC-H
Q ss_conf             997999999999997760799999828332059824702899808997887668786401999999999999996112-8
Q gi|254780186|r    1 MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFD-E   79 (311)
Q Consensus         1 md~~~~l~~~~~~~~~~~~~G~vA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~FsiqSisK~f~l~~al~~~G-~   79 (311)
                      +.-|+.|++|++++++..++||||||||+||+|||++|||||||+||++|++||++++||||||||||+|++||+++| |
T Consensus         3 ~~~qe~L~~~~~e~~~~~~~GkvAdYIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~FsiqSisK~f~~~~al~~~G~~   82 (308)
T 2pby_A            3 VYNQEELVRFVEEAKQYARYGKVADYIPALGKANPNELSIAIYTPDDEVVSAGDVTVKVTLQSISKIIALALVLIDRGED   82 (308)
T ss_dssp             CCCHHHHHHHHHHHHTTGGGCBCCCSSGGGGGSCTTCCEEEEEETTTEEEEEESTTCCEECTTHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHCCCCHHCEEEEEECCCCEEECCCCCCCEEHHHHHHHHHHHHHHHHHCHH
T ss_conf             66499999999999877589988760587607890784899993799789547888867689999999999999987989


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHH
Q ss_conf             99999465765677204442011489847631113799999864488888999999999999872899862478999985
Q gi|254780186|r   80 EIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSE  159 (311)
Q Consensus        80 ~V~~~VG~ePSg~~FNSi~~Le~~~g~P~NPmiNAGAI~~~sli~~~~~~~~~~~~i~~~~~~lag~~~i~~d~~v~~SE  159 (311)
                      +||+|||+||||+||||+.+||.++|+|||||||||||++||||++ .+.++||+++++|+++++|++++.+|++||+||
T Consensus        83 ~V~~~VG~ePSg~~FNsl~~le~~~g~P~NPmINaGAI~~~sll~~-~~~~~r~~~il~~~~~lag~~~~~~d~~v~~SE  161 (308)
T 2pby_A           83 EVFHKVGMEPTDYPFHSIAKLEEKPAKPLNPMINAGALVVTSMIQG-GSVSERLERLLAFVRRLAGNERISYSDEVARSE  161 (308)
T ss_dssp             HHHHHBCSCC----------------CCBCTTSHHHHHHHHTTSCS-SSHHHHHHHHHHHHHHHHTCTTCCBCHHHHHHH
T ss_pred             HHHHHHCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHHHHHCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             9999857687879971455410238997896442018898660036-883789999999999984899764369999876


Q ss_pred             HCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHHHC
Q ss_conf             11241279999999827888899899999999873000079999999999825970777887551899997755445411
Q gi|254780186|r  160 IETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTC  239 (311)
Q Consensus       160 ~~t~~rN~ala~~Lk~~g~~~~dv~~~Ld~Yf~~Csi~~t~~dLA~~~a~LAn~G~~P~t~~~vi~~~~~~~v~s~M~Tc  239 (311)
                      ++|++|||||||+||++|+|++||+++||+||||||+++||+|||+||+||||+|+||+|++||++++++|+++++|+||
T Consensus       162 ~~t~~rN~Ala~~Lk~~g~i~~d~~~~Ld~Yf~~Csi~~t~~dLA~~aatLAn~G~~P~tg~~vi~~~~~r~v~s~M~tc  241 (308)
T 2pby_A          162 FETAFLNRSLCYFLKQHRIIDEDVEELMELYTKQCAIEMTCIDLARIGLVLALDGRDPHSSEPLMPLDVARICKTFMVTC  241 (308)
T ss_dssp             HHHCHHHHHHHHHHHHTTSCCSCHHHHHHHHHHHHTBEECHHHHHHHHHHHHTTTBCTTTCCBSSCHHHHHHHHHHHHHS
T ss_pred             HHCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHHHC
T ss_conf             30639999999999857997889999999999983852249999999999967894888777336889999999999755


Q ss_pred             CCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             3312566789870787156522110334378517998753207789848999999999999486564
Q gi|254780186|r  240 GHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIF  306 (311)
Q Consensus       240 GmYd~SG~fa~~VGlPaKSGVgGgilavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~l~l~iF  306 (311)
                      ||||+||+|||+||||||||||||||+||||++|||||||+||++|||+||+++||.|+++|+||+|
T Consensus       242 GmYd~SG~fa~~VGlPaKSGVgGgIlavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~~~l~iF  308 (308)
T 2pby_A          242 GMYNSSGEFAIKVGIPAKSGVSGGILAAVPGRCGIGVFGPALDDKGNSLTGVKLLERLSKTYSLSIF  308 (308)
T ss_dssp             SSTTCHHHHHHHTCSCEEECTTSEEEEEETTTEEEEEECCCBCTTSSBHHHHHHHHHHHHHHTCCCC
T ss_pred             CCCCCCHHHHHHCCCCCCCCCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             8842302379980862112577438999579608999898868888869999999999998487769



>3ih8_A Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Back     alignment and structure
>1u60_A Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} SCOP: e.3.1.2 Back     alignment and structure
>1mki_A Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} SCOP: e.3.1.2 PDB: 2osu_A* 3brm_A* Back     alignment and structure
>3czd_A Glutaminase kidney isoform; glutamine, glutamate, K-glutaminase, SGC, structural genomics consortium, alternative splicing, ANK repeat, hydrolase; HET: GLU; 2.40A {Homo sapiens} Back     alignment and structure
>3oc2_A Penicillin-binding protein 3; structu genomics, oxford protein production facility, OPPF, transpe cell WALL biosynthesis; 1.97A {Pseudomonas aeruginosa} PDB: 3ocl_A* 3ocn_A* Back     alignment and structure
>1m40_A TEM-1, beta-lactamase TEM; acylation mechanism, ultra- high resolution, hydrolase; HET: CB4; 0.85A {Escherichia coli} SCOP: e.3.1.1 PDB: 1jwp_A* 1nxy_A* 1ny0_A* 1nym_A* 1nyy_A* 1pzo_A* 1erm_A* 1ero_A* 1erq_A* 1s0w_A 1xpb_A 1li0_A 1htz_A 1jtd_A 1esu_A 1jwz_A* 1li9_A 1jwv_A* 1jtg_A 1axb_A* ... Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Back     alignment and structure
>3m6b_A Beta-lactamase, penicillinase; alpha-beta structure, antibiotic resistance, cell membrane, hydrolase, lipoprotein, membrane; HET: 1RG; 1.30A {Mycobacterium tuberculosis} PDB: 3dwz_A* 3iqa_A* 3cg5_A* 3m6h_A* 2gdn_A Back     alignment and structure
>3equ_A PBP-2, penicillin-binding protein 2; class B transpeptidase, cell division, cell inner membrane, cell membrane, cell shape; HET: SEP; 2.40A {Neisseria gonorrhoeae} PDB: 3eqv_A* Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} Back     alignment and structure
>3g4p_A Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A* Back     alignment and structure
>2dcf_A 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A {Flavobacterium SP} SCOP: e.3.1.1 PDB: 3a65_A* 1wyc_A 2zm7_A* 2e8i_A* 2zma_A* 3a66_A* 2zm0_A* 1wyb_A 2zm8_A* 2zly_A* 2zm9_A* 2zm2_A* Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Back     alignment and structure
>1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwr_A 1mws_A* 1mwt_A* 1mwu_A* Back     alignment and structure
>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A* Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Back     alignment and structure
>2bg1_A PBP1B, penicillin-binding protein 1B; peptidoglycan, peptidoglycan synthesis multifunctional enzyme, cell WALL; 1.9A {Streptococcus pneumoniae} SCOP: e.3.1.1 PDB: 2xd5_A* 2uwy_A* 2xd1_A* 2uwx_A* 2fff_B Back     alignment and structure
>3i7j_A Beta-lactamase MB2281C; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 2.20A {Mycobacterium bovis} Back     alignment and structure
>1qme_A Penicillin-binding protein 2X; peptidoglycan synthesis, resistance, cell WALL, transmembrane; 2.4A {Streptococcus pneumoniae} SCOP: d.11.1.1 d.11.1.1 d.175.1.1 e.3.1.1 PDB: 1qmf_A* 1pyy_A* 1rp5_A 1pmd_A 1k25_A 2zc3_B* 2z2l_B* 2z2m_B* 2zc4_B* 2zc3_A* 2z2l_A* 2z2m_A* 2zc4_A* 2zc3_C* 2z2l_C* 2z2m_C* 2zc4_C* Back     alignment and structure
>1nrf_A Regulatory protein BLAR1; penicillin-receptor, beta-lactamase induction, penicillin-binding protein, membrane protein; 2.50A {Bacillus licheniformis} SCOP: e.3.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 311 glutaminase [Candidatus Liberibacter asiaticus str. psy
d1u60a_309 e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia col 1e-109
d1mkia_328 e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtil 1e-104
>d1u60a_ e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]} Length = 309 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: Glutaminase
domain: Probable glutaminase YbaS
species: Escherichia coli [TaxId: 562]
 Score =  386 bits (994), Expect = e-109
 Identities = 111/307 (36%), Positives = 174/307 (56%), Gaps = 4/307 (1%)

Query: 2   DLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSI 61
            L++ +D  Y +    +  G+ ADYIP LA V      +++   DG VYS G+S++ F++
Sbjct: 5   KLQQAVDQAYTQFHS-LNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFAL 63

Query: 62  QSISKVFLLTIALRKF-DEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVS 120
           +SISKV  L +AL     + +  ++G +P+G  F+S++ LE   G P +P VNAGAI  +
Sbjct: 64  ESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATT 123

Query: 121 DAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYGNIR 180
             ++ + + +   +  L+  + +AG+  + +   V  SE  T + N A+A  + S G + 
Sbjct: 124 S-LINAENVEQRWQRILHIQQQLAGE-QVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLY 181

Query: 181 YKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCG 240
               +    Y  QCS ++N ++LA  G  LA  G N LT++ V+       + A M+  G
Sbjct: 182 CDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEG 241

Query: 241 HYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIR 300
            Y  SGD+AYRVG PGKSGVGGGILA+VP    IA +SP LD  GNS+ G K +  +A +
Sbjct: 242 LYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQ 301

Query: 301 TGWSIFD 307
            G+++F 
Sbjct: 302 LGYNVFK 308


>d1mkia_ e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 1423]} Length = 328 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
d1u60a_309 Probable glutaminase YbaS {Escherichia coli [TaxId: 562 100.0
d1mkia_328 Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 14 100.0
d2olua2400 Penicillin-binding protein 2, PBP2 {Staphylococcus aure 97.33
d2bg1a1453 Penicillin-binding protein 1b, transpeptidase domain {S 96.77
d2c5wb1385 Penicillin-binding protein 1a, transpeptidase domain {S 96.54
d2dcfa1388 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium s 96.12
d1vqqa3341 Penicillin binding protein 2a (PBP2A), C-terminal domai 95.4
d1pyya4368 Penicillin-binding protein 2x (pbp-2x), transpeptidase 94.01
d1k38a_241 Class D beta-lactamase {Salmonella typhimurium, OXA-2 [ 91.42
d1djaa_258 beta-Lactamase, class A {Staphylococcus aureus [TaxId: 96.0
d1m40a_263 beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId 95.76
d1nrfa_246 Penicillin receptor BlaR, C-terminal domain {Bacillus l 92.82
>d1u60a_ e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: Glutaminase
domain: Probable glutaminase YbaS
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=897.04  Aligned_cols=304  Identities=37%  Similarity=0.617  Sum_probs=296.3

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCHHHCEEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCC-HH
Q ss_conf             97999999999997760799999828332059824702899808997887668786401999999999999996112-89
Q gi|254780186|r    2 DLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFD-EE   80 (311)
Q Consensus         2 d~~~~l~~~~~~~~~~~~~G~vA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~FsiqSisK~f~l~~al~~~G-~~   80 (311)
                      +++++|+++++++|+. .+||||||||+||+|||++|||||||+||++|++||++++||||||||||+|++||+++| |+
T Consensus         5 ~l~~~l~~~~~~~~~~-~~GkvA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~F~iqSisK~f~~~lal~~~G~~~   83 (309)
T d1u60a_           5 KLQQAVDQAYTQFHSL-NGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQA   83 (309)
T ss_dssp             HHHHHHHHHHHHHTTC-CCCBCCCSSHHHHTSCTTCCEEEEEETTSCEEEEESTTCCEECGGGHHHHHHHHHHHHHCHHH
T ss_pred             HHHHHHHHHHHHHCCC-CCCCCCCCCHHHCCCCHHHEEEEEEECCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCHHH
T ss_conf             9999999999981548-999788726775088827839999957991895588288660899999999999997679899


Q ss_pred             HHHHHCCCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             99994657656772044420114898476311137999998644888889999999999998728998624789999851
Q gi|254780186|r   81 IWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEI  160 (311)
Q Consensus        81 V~~~VG~ePSg~~FNSi~~Le~~~g~P~NPmiNAGAI~~~sli~~~~~~~~~~~~i~~~~~~lag~~~i~~d~~v~~SE~  160 (311)
                      ||+|||+||||++|||+++||.++|+|||||||||||++||||.++ ..++||+++++|+++++| +++.+|++||+||+
T Consensus        84 v~~~VG~EPSg~~FNsl~~le~~~g~P~NPmINAGAI~~~sli~~~-~~~~r~~~i~~~~~~~~g-~~l~~d~~v~~SE~  161 (309)
T d1u60a_          84 VQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAE-NVEQRWQRILHIQQQLAG-EQVALSDEVNQSEQ  161 (309)
T ss_dssp             HHHHTCSCCCSSCTTCHHHHHHTTTCCCCTTSHHHHHHHHHHSCCS-SHHHHHHHHHHHHHHHHC-TTCEECHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCCHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHCC-CCCCCCHHHHHHHH
T ss_conf             9998576877788631665203699978952111088987754168-837999999999999649-98745889999987


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHHHCC
Q ss_conf             12412799999998278888998999999998730000799999999998259707778875518999977554454113
Q gi|254780186|r  161 ETGYRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVMLTCG  240 (311)
Q Consensus       161 ~t~~rN~ala~~Lk~~g~~~~dv~~~Ld~Yf~~Csi~~t~~dLA~~~a~LAn~G~~P~t~~~vi~~~~~~~v~s~M~TcG  240 (311)
                      +|++||||||||||++|+|++||+++||+||||||+++||+|||+||+||||+|+||+|++|+++++++|+++++|+|||
T Consensus       162 ~t~~rN~Ala~~lk~~g~~~~d~~~~Ld~Yf~~CSi~vt~~dlA~~aatLAN~Gv~P~tg~~v~~~~~~r~vls~M~tcG  241 (309)
T d1u60a_         162 TTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEG  241 (309)
T ss_dssp             TTCHHHHHHHHHHHHHTCCCSCHHHHHHHHHHHTTEEECHHHHHHHHHHHHTTSEETTTTEECSCGGGHHHHHHHHHHHT
T ss_pred             HCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHHHCC
T ss_conf             42559999999999769988899999999999855560299999999999759938888872437899999999887547


Q ss_pred             CCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             31256678987078715652211033437851799875320778984899999999999948656486
Q gi|254780186|r  241 HYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDP  308 (311)
Q Consensus       241 mYd~SG~fa~~VGlPaKSGVgGgilavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~l~l~iF~~  308 (311)
                      |||+||+|+|+||||||||||||||+||||+||||||||+||++||||||+++||.|+++|+||+|+.
T Consensus       242 mYd~SG~fa~~VGlPaKSGVgGgIlavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~~~l~iF~g  309 (309)
T d1u60a_         242 LYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG  309 (309)
T ss_dssp             TGGGHHHHHHHTCSCEEECTTSEEEEEETTTEEEEEECSCBCTTSCBHHHHHHHHHHHHHHTCCTTCC
T ss_pred             CCCCCCCHHHEECCEEECCCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             75340013650574031277860799947960799988877888887999999999999838232489



>d1mkia_ e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bg1a1 e.3.1.1 (A:337-789) Penicillin-binding protein 1b, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]} Back     information, alignment and structure
>d1vqqa3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1k38a_ e.3.1.1 (A:) Class D beta-lactamase {Salmonella typhimurium, OXA-2 [TaxId: 90371]} Back     information, alignment and structure
>d1djaa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m40a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]} Back     information, alignment and structure
>d1nrfa_ e.3.1.1 (A:) Penicillin receptor BlaR, C-terminal domain {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 311 glutaminase [Candidatus Liberibacter asiaticus str
1u60_A_60-201142 (A:60-201) Probable glutaminase YBAS; structural g 1e-46
2pby_A_66-197132 (A:66-197) Glutaminase; secsg, riken, structural g 2e-42
3ih8_A_66-195130 (A:66-195) Salt-tolerant glutaminase; hydrolase; 2 1e-39
1mki_A_78-209132 (A:78-209) Probable glutaminase YBGJ; structural g 4e-38
3czd_A_308 (A:) Glutaminase kidney isoform; glutamine, glutam 7e-43
2pby_A_1-65_198-308176 (A:1-65,A:198-308) Glutaminase; secsg, riken, stru 3e-18
1mki_A_1-77_210-330198 (A:1-77,A:210-330) Probable glutaminase YBGJ; stru 2e-17
1u60_A_1-59_202-310168 (A:1-59,A:202-310) Probable glutaminase YBAS; stru 8e-13
3ih8_A_1-65_196-309179 (A:1-65,A:196-309) Salt-tolerant glutaminase; hydr 3e-16
2pby_A_1-65_198-308176 (A:1-65,A:198-308) Glutaminase; secsg, riken, stru 6e-16
1mki_A_1-77_210-330198 (A:1-77,A:210-330) Probable glutaminase YBGJ; stru 1e-11
1u60_A_1-59_202-310168 (A:1-59,A:202-310) Probable glutaminase YBAS; stru 4e-17
3ih8_A_1-65_196-309179 (A:1-65,A:196-309) Salt-tolerant glutaminase; hydr 1e-16
>1u60_A (A:60-201) Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli}Length = 142 Back     alignment and structure
 Score =  181 bits (461), Expect = 1e-46
 Identities = 42/142 (29%), Positives = 74/142 (52%), Gaps = 3/142 (2%)

Query: 59  FSIQSISKVFLLTIALRKF-DEEIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAI 117
           F+++SISKV  L +AL     + +  ++G +P+G  F+S++ LE   G P +P VNAGAI
Sbjct: 3   FALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAI 62

Query: 118 VVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETGYRNFALANFVRSYG 177
             +  +   +  +   +  L+  + +AG+  + +   V  SE  T + N A+A  + S G
Sbjct: 63  ATTSLINAENV-EQRWQRILHIQQQLAGE-QVALSDEVNQSEQTTNFHNRAIAWLLYSAG 120

Query: 178 NIRYKIEDVLKFYFHQCSLMMN 199
            +     +    Y  QCS ++N
Sbjct: 121 YLYCDAMEACDVYTRQCSTLLN 142


>2pby_A (A:66-197) Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426}Length = 132 Back     alignment and structure
>3ih8_A (A:66-195) Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_ALength = 130 Back     alignment and structure
>1mki_A (A:78-209) Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis}Length = 132 Back     alignment and structure
>2pby_A (A:1-65,A:198-308) Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426}Length = 176 Back     alignment and structure
>1mki_A (A:1-77,A:210-330) Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis}Length = 198 Back     alignment and structure
>1u60_A (A:1-59,A:202-310) Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli}Length = 168 Back     alignment and structure
>3ih8_A (A:1-65,A:196-309) Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_ALength = 179 Back     alignment and structure
>2pby_A (A:1-65,A:198-308) Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426}Length = 176 Back     alignment and structure
>1mki_A (A:1-77,A:210-330) Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis}Length = 198 Back     alignment and structure
>1u60_A (A:1-59,A:202-310) Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli}Length = 168 Back     alignment and structure
>3ih8_A (A:1-65,A:196-309) Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_ALength = 179 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target311 glutaminase [Candidatus Liberibacter asiaticus str. psy
3czd_A_315 Glutaminase kidney isoform; glutamine, glutamate, 100.0
2pby_A_1-65_198-308176 Glutaminase; secsg, riken, structural genomics, PS 100.0
3ih8_A_1-65_196-309179 Salt-tolerant glutaminase; hydrolase; 2.30A {Micro 100.0
1mki_A_1-77_210-330198 Probable glutaminase YBGJ; structural genomics, PS 100.0
1u60_A_1-59_202-310168 Probable glutaminase YBAS; structural genomics, AP 100.0
3g4p_A_244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzy 96.11
1u60_A_60-201142 Probable glutaminase YBAS; structural genomics, AP 100.0
2pby_A_66-197132 Glutaminase; secsg, riken, structural genomics, PS 100.0
1mki_A_78-209132 Probable glutaminase YBGJ; structural genomics, PS 100.0
3ih8_A_66-195130 Salt-tolerant glutaminase; hydrolase; 2.30A {Micro 100.0
1vqq_A_370-564195 Saupbp2A, penicillin-binding protein MECA, low-aff 96.53
3equ_A_259-445187 PBP-2, penicillin-binding protein 2; class B trans 94.25
3fwm_A_46-56_146-155_343-702381 Penicillin-binding protein 1B; bacterial cell WALL 95.96
3hbr_A_265 OXA-48; class D beta-lactamase, antibiotic, dimer, 95.28
1k55_A_246 Beta lactamase OXA-10; antibiotic resistance, carb 95.17
1k38_A_254 Penicillinase, beta-lactamase OXA-2; serine beta-l 93.8
3isg_A_251 Penicillinase, beta-lactamase OXA-1; hydrolase, ly 93.26
2v2f_F_390 Penicillin binding protein 1A; transpeptidase acti 95.12
1w5d_A_1-68_290-462241 Penicillin-binding protein; D-Ala-D-Ala-carboxypep 90.79
>3czd_A (A:) Glutaminase kidney isoform; glutamine, glutamate, K-glutaminase, SGC, structural genomics consortium, alternative splicing, ANK repeat, hydrolase; HET: GLU; 2.40A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=879.40  Aligned_cols=305  Identities=36%  Similarity=0.621  Sum_probs=295.7

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCHHHCEEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCC-H
Q ss_conf             997999999999997760799999828332059824702899808997887668786401999999999999996112-8
Q gi|254780186|r    1 MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFD-E   79 (311)
Q Consensus         1 md~~~~l~~~~~~~~~~~~~G~vA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~FsiqSisK~f~l~~al~~~G-~   79 (311)
                      |++++.|+++++++|+. .+||||||||+||+|||++|||||||+||++|++||++++||||||||||+|++||+++| |
T Consensus         7 ~~~~~~l~~~~~~~~~~-~~G~va~YIP~La~vdp~~~giai~t~dG~~~~~GD~~~~FsiqSisK~f~l~~al~~~G~~   85 (315)
T 3czd_A            7 MSFTSHIDELYESAKKQ-SGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTE   85 (315)
T ss_dssp             HHHHHHHHHHHHHHHTC-CCCEECCSSHHHHTSCTTCCEEEEEETTSCEEEEESTTSCEECGGGGHHHHHHHHHHHHCHH
T ss_pred             HHHHHHHHHHHHHHHHC-CCCCCCCCCHHHHCCCHHHCEEEEECCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCHH
T ss_conf             99999999999995014-79977871577627793680899992799889527989966259899999999999987989


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHH
Q ss_conf             99999465765677204442011489847631113799999864488888999999999999872899862478999985
Q gi|254780186|r   80 EIWKRVGREPSGSSFDSIVQLENENGIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSE  159 (311)
Q Consensus        80 ~V~~~VG~ePSg~~FNSi~~Le~~~g~P~NPmiNAGAI~~~sli~~~~~~~~~~~~i~~~~~~lag~~~i~~d~~v~~SE  159 (311)
                      +||+|||+||||+||||+.++|  +|+|||||||||||++||||++..+.++||+++++|+++++|++.+.+|++||+||
T Consensus        86 ~V~~~VG~EPSg~~FNsl~~~e--~~~P~NPmINaGAI~~~sli~~~~~~~~r~~~il~~~~~l~g~~~i~~d~~v~~SE  163 (315)
T 3czd_A           86 YVHRYVGKEPSGLRFNKLFLNE--DDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSE  163 (315)
T ss_dssp             HHHTTSCSSCCSCC---CCCCT--TSSCSCTTSHHHHHHHHHHTTTTSCHHHHHHHHHHHHHHHTTTCCCEECHHHHHHH
T ss_pred             HHHHHHCCCCCCCCCCCCCCCC--CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             9998718898999876630035--79999940206899999986149986999999999999983899875379999997


Q ss_pred             HCCCHHHHHHHHHHHHCCCCCC--CHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             1124127999999982788889--98999999998730000799999999998259707778875518999977554454
Q gi|254780186|r  160 IETGYRNFALANFVRSYGNIRY--KIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQSVISPLQSRCVNAVML  237 (311)
Q Consensus       160 ~~t~~rN~ala~~Lk~~g~~~~--dv~~~Ld~Yf~~Csi~~t~~dLA~~~a~LAn~G~~P~t~~~vi~~~~~~~v~s~M~  237 (311)
                      ++|++|||||||+||++|+|++  |++++||+||||||+++||+|||+||+||||+|+||+||+|+++++++|+++++|+
T Consensus       164 ~~t~~rN~AlA~~Lk~~g~i~~~~d~~~~Ld~Y~~~Csi~~t~~dLA~~~a~LAn~G~~P~tg~~vl~~~~~r~v~s~M~  243 (315)
T 3czd_A          164 RESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMH  243 (315)
T ss_dssp             HHHCHHHHHHHHHHHHTTCSCTTCCHHHHHHHHHHHHTEEECHHHHHHHHHHHHTTTBCTTTCCBCSCHHHHHHHHHHHH
T ss_pred             HHCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCHHHHHHHHHHHH
T ss_conf             50118999999999977997999988999999999847730099999999999758958998885268999999999997


Q ss_pred             HCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             11331256678987078715652211033437851799875320778984899999999999948656486
Q gi|254780186|r  238 TCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGLDNSGNSLLGAKALELLAIRTGWSIFDP  308 (311)
Q Consensus       238 TcGmYd~SG~fa~~VGlPaKSGVgGgilavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~l~l~iF~~  308 (311)
                      ||||||+||+|||+||||||||||||||+||||++|||||||+||++||||||+++||.|+++|+||+||.
T Consensus       244 tcGmYd~SG~fa~~VGlPaKSGVgGgIlavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~~~l~~fd~  314 (315)
T 3czd_A          244 SCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDN  314 (315)
T ss_dssp             HHTTGGGHHHHHHHTCSCEEECTTSEEEEEETTTEEEEEECSEECTTSSBHHHHHHHHHHHHHHCCCTTCC
T ss_pred             HCCCCCHHHHHHHHCCCCCCCCCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             73998218889999198412566662799937960899989886888885999999999999709532467



>2pby_A (A:1-65,A:198-308) Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3ih8_A (A:1-65,A:196-309) Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Back     alignment and structure
>1mki_A (A:1-77,A:210-330) Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} Back     alignment and structure
>1u60_A (A:1-59,A:202-310) Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} Back     alignment and structure
>3g4p_A (A:) Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A* Back     alignment and structure
>1u60_A (A:60-201) Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} Back     alignment and structure
>2pby_A (A:66-197) Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative; 2.07A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1mki_A (A:78-209) Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} Back     alignment and structure
>3ih8_A (A:66-195) Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Back     alignment and structure
>1vqq_A (A:370-564) Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3equ_A (A:259-445) PBP-2, penicillin-binding protein 2; class B transpeptidase, cell division, cell inner membrane, cell membrane, cell shape; HET: SEP; 2.40A {Neisseria gonorrhoeae} PDB: 3eqv_A* Back     alignment and structure
>3fwm_A (A:46-56,A:146-155,A:343-702) Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Back     alignment and structure
>3hbr_A (A:) OXA-48; class D beta-lactamase, antibiotic, dimer, hydrolase; HET: KCX; 1.90A {Klebsiella pneumoniae} Back     alignment and structure
>1k55_A (A:) Beta lactamase OXA-10; antibiotic resistance, carbamylation, hydrolase; HET: KCX SO4; 1.39A {Pseudomonas aeruginosa} Back     alignment and structure
>1k38_A (A:) Penicillinase, beta-lactamase OXA-2; serine beta-lactamase, hydrolase, antibiotic resistance, carbamylated lysine; HET: KCX; 1.50A {Salmonella typhimurium} Back     alignment and structure
>3isg_A (A:) Penicillinase, beta-lactamase OXA-1; hydrolase, lysine carboxylation, antibiotic resistance, plasmid, transposable element; HET: KCX DRW; 1.40A {Escherichia coli} PDB: 1m6k_A* Back     alignment and structure
>2v2f_F (F:) Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Back     alignment and structure
>1w5d_A (A:1-68,A:290-462) Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidase, peptidoglycan, beta-lactam, hydrolase, peptidoglycan synthesis; 2.1A {Bacillus subtilis} Back     alignment and structure