254780196

254780196

hypothetical protein CLIBASIA_00405

GeneID in NCBI database:8209177Locus tag:CLIBASIA_00405
Protein GI in NCBI database:254780196Protein Accession:YP_003064609.1
Gene range:-(87397, 87774)Protein Length:125aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein; K03075 preprotein translocase subunit SecG
SEED prediction:hypothetical protein
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRTK
cHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHcccccccccccccccccccccccccccccccccccccccccccccccc
MQIFLMVVHLIVVVGLVCVILIQssdssafgsssnftsvRSTAHSLGRFTAILAFFFFATSIALGMISRYtstrykdnmHRSLVDSIkdqgndnfgdgsspkldsvsakssssvvagkrsssrtk
MQIFLMVVHLIVVVGLVCVILIQSSdssafgsssNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGdgsspkldsvsakssssvvagkrsssrtk
MQiflmvvhlivvvglvcviliQssdssafgsssnftsVRSTAHSLGRftailaffffatsialGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGsspkldsvsakssssvvagkrsssRTK
MQIFLMVVHLIVVVGLVCVILIQS*******************HSLGRFTAILAFFFFATSIALGMI**********************************************************
MQIFLMVVHLIVVVGLVCVILIQSSDS*************STAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS**************************
MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYK*NMHRSLV*****************************************
iiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRTK
MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRTK
MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRTK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
315122623126 hypothetical protein CKC_04375 [Candidatus Liberibacter 1 1e-29
325293009157 Protein-export membrane protein secG [Agrobacterium sp. 1 2e-12
86357801162 preprotein translocase subunit SecG [Rhizobium etli CFN 1 1e-11
116252258173 preprotein translocase subunit SecG [Rhizobium legumino 1 2e-11
190891863174 probable protein-export translocase protein [Rhizobium 1 2e-11
218662639176 preprotein translocase subunit SecG [Rhizobium etli IE4 1 3e-11
218462580171 preprotein translocase subunit SecG [Rhizobium etli Kim 1 3e-11
241204752177 preprotein translocase subunit SecG [Rhizobium legumino 1 3e-11
209549427179 preprotein translocase subunit SecG [Rhizobium legumino 1 3e-11
159184841157 preprotein translocase subunit SecG [Agrobacterium tume 1 7e-11
>gi|315122623|ref|YP_004063112.1| hypothetical protein CKC_04375 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 126 Back     alignment and organism information
 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 85/105 (80%), Gaps = 1/105 (0%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLM  HLI+V+GLVC ILIQSSDSSAFG+SS+FTSVRS A+SL RFT+ILAF FF+T
Sbjct: 1   MQIFLMTAHLIIVIGLVCTILIQSSDSSAFGTSSSFTSVRSIAYSLARFTSILAFLFFST 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           SIALG+ SRY S + K+++ +SL  +  ++ N N G+ S+P +DS
Sbjct: 61  SIALGITSRYHSIKTKEDLRQSLASATNNKINYNSGN-SNPNIDS 104


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293009|ref|YP_004278873.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3] Length = 157 Back     alignment and organism information
>gi|86357801|ref|YP_469693.1| preprotein translocase subunit SecG [Rhizobium etli CFN 42] Length = 162 Back     alignment and organism information
>gi|116252258|ref|YP_768096.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv. viciae 3841] Length = 173 Back     alignment and organism information
>gi|190891863|ref|YP_001978405.1| probable protein-export translocase protein [Rhizobium etli CIAT 652] Length = 174 Back     alignment and organism information
>gi|218662639|ref|ZP_03518569.1| preprotein translocase subunit SecG [Rhizobium etli IE4771] Length = 176 Back     alignment and organism information
>gi|218462580|ref|ZP_03502671.1| preprotein translocase subunit SecG [Rhizobium etli Kim 5] Length = 171 Back     alignment and organism information
>gi|241204752|ref|YP_002975848.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 177 Back     alignment and organism information
>gi|209549427|ref|YP_002281344.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 179 Back     alignment and organism information
>gi|159184841|ref|NP_354613.2| preprotein translocase subunit SecG [Agrobacterium tumefaciens str. C58] Length = 157 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
PRK0687076 PRK06870, secG, preprotein translocase subunit SecG; Re 2e-09
COG131486 COG1314, SecG, Preprotein translocase subunit SecG [Int 7e-08
TIGR0081073 TIGR00810, secG, protein translocase, SecG subunit 9e-08
pfam0384074 pfam03840, SecG, Preprotein translocase SecG subunit 1e-09
>gnl|CDD|180737 PRK06870, secG, preprotein translocase subunit SecG; Reviewed Back     alignment and domain information
>gnl|CDD|31505 COG1314, SecG, Preprotein translocase subunit SecG [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162050 TIGR00810, secG, protein translocase, SecG subunit Back     alignment and domain information
>gnl|CDD|146462 pfam03840, SecG, Preprotein translocase SecG subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
TIGR0081077 secG preprotein translocase, SecG subunit; InterPro: IP 99.88
PRK0687074 secG preprotein translocase subunit SecG; Reviewed 99.86
COG131486 SecG Preprotein translocase subunit SecG [Intracellular 99.85
pfam0384074 SecG Preprotein translocase SecG subunit. 99.84
PRK09510 402 tolA cell envelope integrity inner membrane protein Tol 92.51
>TIGR00810 secG preprotein translocase, SecG subunit; InterPro: IPR004692 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>PRK06870 secG preprotein translocase subunit SecG; Reviewed Back     alignment and domain information
>COG1314 SecG Preprotein translocase subunit SecG [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam03840 SecG Preprotein translocase SecG subunit Back     alignment and domain information
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
2akh_X77 Normal Mode-Based Flexible Fitted Coordinates Of A 2e-09
3din_E76 Crystal Structure Of The Protein-Translocation Comp 5e-06
3dl8_E107 Structure Of The Complex Of Aquifex Aeolicus Secyeg 2e-04
>gi|83754004|pdb|2AKH|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli Length = 77 Back     alignment and structure
 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55 FFFFATSIALGMISRYT 71
            FF  S+ LG I+   
Sbjct: 61 TLFFIISLVLGNINSNK 77


gi|209156624|pdb|3DIN|E Chain E, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase Length = 76 Back     alignment and structure
>gi|215794648|pdb|3DL8|E Chain E, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca Length = 107 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
3dl8_E107 Protein-export membrane protein SECG; RECA-type ATPase 3e-12
2akh_X77 Protein-export membrane protein SECG; protein transport 9e-11
3din_E76 Preprotein translocase subunit SECG; protein translocat 2e-10
>3dl8_E Protein-export membrane protein SECG; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Length = 107 Back     alignment and structure
 Score = 65.5 bits (160), Expect = 3e-12
 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 5/78 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDS---SAF--GSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ + +I+ V L+   L+Q       +AF  G   +   V      L + T  L  
Sbjct: 1  MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGA 60

Query: 56 FFFATSIALGMISRYTST 73
           F   ++ L +I +   +
Sbjct: 61 LFLVLALLLSVIPKEKGS 78


>2akh_X Protein-export membrane protein SECG; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_X Length = 77 Back     alignment and structure
>3din_E Preprotein translocase subunit SECG; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga SP} Length = 76 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
3dl8_E107 Protein-export membrane protein SECG; RECA-type ATPase 99.93
2akh_X77 Protein-export membrane protein SECG; protein transport 99.92
3din_E76 Preprotein translocase subunit SECG; protein translocat 99.9
>3dl8_E Protein-export membrane protein SECG; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
Probab=99.93  E-value=8.6e-28  Score=153.17  Aligned_cols=73  Identities=21%  Similarity=0.287  Sum_probs=65.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             93599899999999999999714776442-----22223333466566689999999999999999999997266777
Q gi|254780196|r    1 MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTST   73 (125)
Q Consensus         1 M~~~llvi~vi~~~~Li~~VLlQ~~kg~g-----~G~~~~~~~~~g~~~~L~k~T~~la~~F~~~sl~l~~~s~~~~~   73 (125)
                      ||++++++|+|+|++||++||+|++||++     +|+++++|++||++|||+|+|||+|++||++|+.|+|++++++.
T Consensus         1 M~~~llii~vivsi~LI~~VLlQ~~Kg~~~~~~ggg~s~~~fg~r~~~~~L~K~T~~la~~F~v~sl~L~~~~~~~~s   78 (107)
T 3dl8_E            1 MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGALFLVLALLLSVIPKEKGS   78 (107)
T ss_dssp             -------CHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCCCCCSSCCCCCTTHHHHHHHHHHHHHHHHHHCC------
T ss_pred             CHHHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             942899999999999999705026886602254566555566775342599999999999999999999999657886



>2akh_X Protein-export membrane protein SECG; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_X Back     alignment and structure
>3din_E Preprotein translocase subunit SECG; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga SP} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 125 hypothetical protein CLIBASIA_00405 [Candidatus Li
3din_E_76 (E:) Preprotein translocase subunit SECG; protein 2e-12
3dl8_E_107 (E:) Protein-export membrane protein SECG; RECA-ty 2e-12
2akh_X_77 (X:) Protein-export membrane protein SECG; protein 5e-12
>3din_E (E:) Preprotein translocase subunit SECG; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga SP}Length = 76 Back     alignment and structure
 Score = 66.1 bits (162), Expect = 2e-12
 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILA 54
          M+ F ++VH I+ V L+ ++ +Q S  S        G        R    + G+ T +L+
Sbjct: 1  MKTFFLIVHTIISVALIYMVQVQMSKFSELGGAFGSGGLHTVFGRRKGLDTGGKITLVLS 60

Query: 55 FFFFATSIALGMIS 68
            FF + +    + 
Sbjct: 61 VLFFVSCVVTAFVL 74


>3dl8_E (E:) Protein-export membrane protein SECG; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus}Length = 107 Back     alignment and structure
>2akh_X (X:) Protein-export membrane protein SECG; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_XLength = 77 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target125 hypothetical protein CLIBASIA_00405 [Candidatus Liberib
3dl8_E_107 Protein-export membrane protein SECG; RECA-type AT 99.93
2akh_X_77 Protein-export membrane protein SECG; protein tran 99.89
3din_E_76 Preprotein translocase subunit SECG; protein trans 99.86
>3dl8_E (E:) Protein-export membrane protein SECG; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
Probab=99.93  E-value=1.7e-27  Score=152.45  Aligned_cols=77  Identities=19%  Similarity=0.267  Sum_probs=68.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCC-----CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             935998999999999999997147764422-----222333346656668999999999999999999999726677765
Q gi|254780196|r    1 MQIFLMVVHLIVVVGLVCVILIQSSDSSAF-----GSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRY   75 (125)
Q Consensus         1 M~~~llvi~vi~~~~Li~~VLlQ~~kg~g~-----G~~~~~~~~~g~~~~L~k~T~~la~~F~~~sl~l~~~s~~~~~~~   75 (125)
                      ||++++++|+++|++||++||+|++|++|+     |+++++|+.||++|||+|+||++|++||++|+.|+|++++++++.
T Consensus         1 M~t~l~vi~ii~~v~LI~~VLlQ~~K~~gl~~~~gg~~~~~fg~r~~~~~L~k~T~~la~~F~v~sl~l~~~~~~~~~~~   80 (107)
T 3dl8_E            1 MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGALFLVLALLLSVIPKEKGSVV   80 (107)
T ss_dssp             -------CHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCCCCCSSCCCCCTTHHHHHHHHHHHHHHHHHHCC--------
T ss_pred             CHHHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             95389999999999999981402688660225456665666676533248999999999999999999999965887632


Q ss_pred             CC
Q ss_conf             31
Q gi|254780196|r   76 KD   77 (125)
Q Consensus        76 ~~   77 (125)
                      ..
T Consensus        81 ~~   82 (107)
T 3dl8_E           81 EK   82 (107)
T ss_dssp             --
T ss_pred             CC
T ss_conf             33



>2akh_X (X:) Protein-export membrane protein SECG; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_X Back     alignment and structure
>3din_E (E:) Preprotein translocase subunit SECG; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga SP} Back     alignment and structure