254780197

254780197

triosephosphate isomerase protein

GeneID in NCBI database:8209178Locus tag:CLIBASIA_00410
Protein GI in NCBI database:254780197Protein Accession:YP_003064610.1
Gene range:-(87823, 88617)Protein Length:264aa
Gene description:triosephosphate isomerase protein
COG prediction:[G] Triosephosphate isomerase
KEGG prediction:triosephosphate isomerase protein; K01803 triosephosphate isomerase (TIM) [EC:5.3.1.1]
SEED prediction:Triosephosphate isomerase (EC 5.3.1.1)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Fructose and mannose metabolism [PATH:las00051]
Inositol phosphate metabolism [PATH:las00562]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL
ccccccEEEEEEccccccHHHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHccccEEEEccHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEcccHHHHHcccHHHHHHHHHHHHcccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHccccccEEEEcHHHccHHHHHHHHHHHHHHHHHHHHHHccc
ccccccEEEcccccccccHHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHcccccEEEEEccccccccEcccccccHHHHHHccccEEEEccHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccHHHHcccccccEEEEcHHHHccHHHHHHHHHHHHcccccccccccc
mkvgirplvvgnwkmhGLRLSLERIQKIVEGIrrnsccidvaicppatliyessrlcktssviigaqdchiaeygpytgdisanmLADCGANFVILGhserrighredsYVVQSKVKsacnaglypivcigetdeeyrsgrtFEVLQKQldcslpsefkssvpviayepiwaigtgrvpavVDLEKIHSFVRRILldrfpeegQKMRILYggsvdvanaedfslieNIDGLLVGGASLQHELFLKIVEIVERVYVDscledtsl
mkvgirplvvgnwkmhglrLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRrilldrfpeegQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDscledtsl
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL
***GIRP*VVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLED***
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL
****IRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYV*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target264 triosephosphate isomerase protein [Candidatus Liberibac
315122624259 triosephosphate isomerase protein [Candidatus Liberibac 1 1e-109
15965191256 triosephosphate isomerase protein [Sinorhizobium melilo 1 3e-71
307321535256 triosephosphate isomerase [Sinorhizobium meliloti AK83] 1 7e-71
150396288256 triosephosphate isomerase [Sinorhizobium medicae WSM419 1 1e-69
227821840256 triosephosphate isomerase [Sinorhizobium fredii NGR234] 1 1e-68
15888933256 triosephosphate isomerase [Agrobacterium tumefaciens st 1 5e-68
325293010256 Triosephosphate isomerase [Agrobacterium sp. H13-3] Len 1 1e-67
241204753256 triosephosphate isomerase [Rhizobium leguminosarum bv. 1 1e-66
116252259256 triosephosphate isomerase [Rhizobium leguminosarum bv. 1 2e-66
209549428256 triosephosphate isomerase [Rhizobium leguminosarum bv. 1 3e-66
>gi|315122624|ref|YP_004063113.1| triosephosphate isomerase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 259 Back     alignment and organism information
 Score =  397 bits (1021), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 220/259 (84%)

Query: 1   MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTS 60
           M+ GIRP+VVGNWKMHGLR SL++I+KIVE + +N C IDVAICPPATL Y +SRLC+ S
Sbjct: 1   MRSGIRPIVVGNWKMHGLRASLDKIEKIVESVEKNHCRIDVAICPPATLTYLASRLCEKS 60

Query: 61  SVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSAC 120
           SV+IGAQDCHI EYG YTGDISANMLADCGA FVILGHSERRIGH+E S VVQ KVK A 
Sbjct: 61  SVMIGAQDCHIDEYGSYTGDISANMLADCGARFVILGHSERRIGHQESSQVVQCKVKYAY 120

Query: 121 NAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPA 180
           NAG+ PI+CIGETDEEYRSGRT EVLQKQLD SLP E   S+P++AYEPIWAIGTG VP+
Sbjct: 121 NAGISPIICIGETDEEYRSGRTLEVLQKQLDFSLPHECGDSIPIVAYEPIWAIGTGDVPS 180

Query: 181 VVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQH 240
           V++LEKIHSF+  +L+DRFP +G+K+RILYGGSV  +N +DF  IENIDGLLVGGASLQ+
Sbjct: 181 VIELEKIHSFMHHVLVDRFPAKGEKIRILYGGSVSASNVKDFLCIENIDGLLVGGASLQY 240

Query: 241 ELFLKIVEIVERVYVDSCL 259
           E FL I+E  E+ YVDS L
Sbjct: 241 ESFLTIIETFEQSYVDSFL 259


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965191|ref|NP_385544.1| triosephosphate isomerase protein [Sinorhizobium meliloti 1021] Length = 256 Back     alignment and organism information
>gi|307321535|ref|ZP_07600930.1| triosephosphate isomerase [Sinorhizobium meliloti AK83] Length = 256 Back     alignment and organism information
>gi|150396288|ref|YP_001326755.1| triosephosphate isomerase [Sinorhizobium medicae WSM419] Length = 256 Back     alignment and organism information
>gi|227821840|ref|YP_002825810.1| triosephosphate isomerase [Sinorhizobium fredii NGR234] Length = 256 Back     alignment and organism information
>gi|15888933|ref|NP_354614.1| triosephosphate isomerase [Agrobacterium tumefaciens str. C58] Length = 256 Back     alignment and organism information
>gi|325293010|ref|YP_004278874.1| Triosephosphate isomerase [Agrobacterium sp. H13-3] Length = 256 Back     alignment and organism information
>gi|241204753|ref|YP_002975849.1| triosephosphate isomerase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 256 Back     alignment and organism information
>gi|116252259|ref|YP_768097.1| triosephosphate isomerase [Rhizobium leguminosarum bv. viciae 3841] Length = 256 Back     alignment and organism information
>gi|209549428|ref|YP_002281345.1| triosephosphate isomerase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 256 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 triosephosphate isomerase protein [Candidatus Liberibac
PRK00042250 PRK00042, tpiA, triosephosphate isomerase; Provisional 5e-86
cd00311242 cd00311, TIM, Triosephosphate isomerase (TIM) is a glyc 1e-74
COG0149251 COG0149, TpiA, Triosephosphate isomerase [Carbohydrate 8e-69
PTZ00333255 PTZ00333, PTZ00333, triosephosphate isomerase; Provisio 2e-59
PRK13962645 PRK13962, PRK13962, bifunctional phosphoglycerate kinas 5e-59
PRK14566260 PRK14566, PRK14566, triosephosphate isomerase; Provisio 8e-56
KOG1643247 KOG1643, KOG1643, KOG1643, Triosephosphate isomerase [C 4e-54
PRK14565237 PRK14565, PRK14565, triosephosphate isomerase; Provisio 2e-51
PLN02561253 PLN02561, PLN02561, triosephosphate isomerase 2e-39
PRK14567253 PRK14567, PRK14567, triosephosphate isomerase; Provisio 2e-38
PRK15492260 PRK15492, PRK15492, triosephosphate isomerase; Provisio 2e-32
TIGR00419205 TIGR00419, tim, triosephosphate isomerase 1e-25
pfam00121243 pfam00121, TIM, Triosephosphate isomerase 4e-76
PLN02429315 PLN02429, PLN02429, triosephosphate isomerase 1e-34
PRK14905355 PRK14905, PRK14905, triosephosphate isomerase/PTS syste 3e-30
PRK04302223 PRK04302, PRK04302, triosephosphate isomerase; Provisio 2e-10
>gnl|CDD|178816 PRK00042, tpiA, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|73362 cd00311, TIM, Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>gnl|CDD|30498 COG0149, TpiA, Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185560 PTZ00333, PTZ00333, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|184422 PRK13962, PRK13962, bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|184749 PRK14566, PRK14566, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|36856 KOG1643, KOG1643, KOG1643, Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184748 PRK14565, PRK14565, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|178175 PLN02561, PLN02561, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|173031 PRK14567, PRK14567, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|185389 PRK15492, PRK15492, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|129513 TIGR00419, tim, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|143895 pfam00121, TIM, Triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|166070 PLN02429, PLN02429, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|184898 PRK14905, PRK14905, triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>gnl|CDD|179815 PRK04302, PRK04302, triosephosphate isomerase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 264 triosephosphate isomerase protein [Candidatus Liberibac
PRK13962653 bifunctional phosphoglycerate kinase/triosephosphate is 100.0
PTZ00333252 triosephosphate isomerase; Provisional 100.0
PRK00042251 tpiA triosephosphate isomerase; Provisional 100.0
pfam00121243 TIM Triosephosphate isomerase. 100.0
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolytic enz 100.0
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate transport 100.0
KOG1643247 consensus 100.0
PRK04302223 triosephosphate isomerase; Provisional 100.0
) (TIM) is the glycolytic enzyme that catalyzes the reversible interconversion of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. TIM plays an important role in several metabolic pathways and is essential for efficient energy production. It is a dimer of identical subunits, each of which is made up of about 250 amino-acid residues. A glutamic acid residue is involved in the catalytic mechanism . The sequence around the active site residue is perfectly conserved in all known TIM's. Deficiencies in TIM are associated with haemolytic anaemia coupled with a progressive, severe neurological disorder .; GO: 0004807 triose-phosphate isomerase activity, 0008152 metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00419">TIGR00419244 tim triosephosphate isomerase; InterPro: IPR000652 Trio 100.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.88
PRK05581220 ribulose-phosphate 3-epimerase; Validated 94.41
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 93.84
PRK13124257 consensus 93.13
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 92.94
pfam00834201 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. T 92.29
PRK13136253 consensus 91.93
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 90.62
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 90.13
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 95.85
pfam03437254 BtpA BtpA family. The BtpA protein is tightly associate 95.75
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function pred 95.39
TIGR00734230 hisAF_rel hisA/hisF family protein; InterPro: IPR004650 91.92
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosomal st 90.46
>PRK13962 bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>pfam00121 TIM Triosephosphate isomerase Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1643 consensus Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13124 consensus Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>PRK13136 consensus Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>pfam00977 His_biosynth Histidine biosynthesis protein Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>pfam03437 BtpA BtpA family Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein; InterPro: IPR004650 This family of proteins has so far been found in three archaeal species: Methanobacterium thermoautotrophicum, Methanococcus jannaschii, and Archaeoglobus fulgidus Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target264 triosephosphate isomerase protein [Candidatus Liberibac
1mo0_A275 Structural Genomics Of Caenorhabditis Elegans: Trio 3e-50
2i9e_A259 Structure Of Triosephosphate Isomerase Of Tenebrio 2e-49
2vfd_A248 Crystal Structure Of The F96s Mutant Of Plasmodium 1e-48
2vom_A250 Structural Basis Of Human Triosephosphate Isomerase 2e-48
1wyi_A250 Human Triosephosphate Isomerase Of New Crystal Form 2e-48
1hti_A248 Crystal Structure Of Recombinant Human Triosephosph 2e-48
2vfh_A248 Crystal Structure Of The F96w Mutant Of Plasmodium 2e-48
1r2r_A248 Crystal Structure Of Rabbit Muscle Triosephosphate 3e-48
1ydv_A248 Triosephosphate Isomerase (Tim) Length = 248 3e-48
3kxq_A275 Crystal Structure Of Triosephosphate Isomerase From 4e-48
1vga_A248 Structures Of Unligated And Inhibitor Complexes Of 4e-48
2vff_A248 Crystal Structure Of The F96h Mutant Of Plasmodium 5e-48
1su5_A247 Understanding Protein Lids: Structural Analysis Of 2e-47
1tpb_1247 Offset Of A Catalytic Lesion By A Bound Water Solub 2e-47
1tph_1247 1.8 Angstroms Crystal Structure Of Wild Type Chicke 2e-47
3pvf_A248 Structure Of C126s Mutant Of Plasmodium Falciparum 2e-47
1spq_A247 Understanding Protein Lids: Structural Analysis Of 2e-47
3pwa_A248 Structure Of C126a Mutant Of Plasmodium Falciparum 2e-47
1ssd_A247 Understanding Protein Lids: Structural Analysis Of 2e-47
1sw3_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 3e-47
1tpc_1247 Offset Of A Catalytic Lesion By A Bound Water Solub 3e-47
1tpw_A247 Triosephosphate Isomerase Drinks Water To Keep Heal 3e-47
1sw7_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 4e-47
1sq7_A247 Understanding Protein Lids: Structural Analysis Of 8e-47
1tpu_A247 S96p Change Is A Second-Site Suppressor For H95n Sl 1e-46
2btm_A252 Does The His12-Lys13 Pair Play A Role In The Adapta 1e-46
1sw0_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 1e-46
1ypi_A247 Structure Of Yeast Triosephosphate Isomerase At 1.9 2e-46
1tpv_A247 S96p Change Is A Second-Site Suppressor For H95n Sl 3e-46
1i45_A248 Yeast Triosephosphate Isomerase (Mutant) Length = 2 3e-46
1tim_A247 Structure Of Triose Phosphate Isomerase From Chicke 8e-46
3ypi_A247 Electrophilic Catalysis In Triosephosphase Isomeras 1e-45
3m9y_A254 Crystal Structure Of Triosephosphate Isomerase From 2e-45
1b9b_A255 Triosephosphate Isomerase Of Thermotoga Maritima Le 2e-45
1nf0_A247 Triosephosphate Isomerase In Complex With Dhap Leng 4e-45
1btm_A252 Triosephosphate Isomerase (Tim) Complexed With 2- P 4e-45
1ney_A247 Triosephosphate Isomerase In Complex With Dhap Leng 6e-45
1tre_A255 The Structure Of Triosephosphate Isomerase From Esc 6e-44
3krs_A271 Structure Of Triosephosphate Isomerase From Cryptos 2e-43
1tmh_A254 Modular Mutagenesis Of A Tim-Barrel Enzyme: The Cry 2e-43
1qds_A251 Superstable E65q Mutant Of Leishmania Mexicana Trio 5e-43
3gvg_A283 Crystal Structure Of Triosephosphate Isomerase From 5e-43
1amk_A251 Leishmania Mexicana Triose Phosphate Isomerase Leng 6e-43
1m6j_A261 Crystal Structure Of Triosephosphate Isomerase From 1e-42
1yya_A250 Crystal Structure Of Tt0473, Putative Triosephospha 4e-42
2dp3_A257 Crystal Structure Of A Double Mutant (C202aA198V) O 2e-41
1aw1_A256 Triosephosphate Isomerase Of Vibrio Marinus Complex 2e-40
2v0t_A250 The A178l Mutation In The C-Terminal Hinge Of The F 8e-39
4tim_A250 Crystallographic And Molecular Modeling Studies On 8e-39
1ci1_A251 Crystal Structure Of Triosephosphate Isomerase From 1e-38
1kv5_A250 Structure Of Trypanosoma Brucei Brucei Tim With The 1e-38
2j24_A250 The Functional Role Of The Conserved Active Site Pr 2e-38
2wsq_A242 Monotim Mutant Rmm0-1, Dimeric Form. Length = 242 3e-38
3tim_A250 The Crystal Structure Of The "open" And The "closed 4e-38
1tcd_A249 Trypanosoma Cruzi Triosephosphate Isomerase Length 4e-38
2oma_A250 Crystallographic Analysis Of A Chemically Modified 6e-38
2wsr_A242 Monotim Mutant Rmm0-1, Monomeric Form Length = 242 7e-37
1tri_A243 The Crystal Structure Of An Engineered Monomeric Tr 1e-36
1tti_A243 Three New Crystal Structures Of Point Mutation Vari 2e-36
2v5b_A244 The Monomerization Of Triosephosphate Isomerase Fro 2e-36
1mss_A243 Large Scale Structural Rearrangements Of The Front 8e-36
1ml1_A243 Protein Engineering With Monomeric Triosephosphate 2e-34
2v2d_A242 The A178l Mutation In The C-Terminal Hinge Of The F 2e-33
1dkw_A238 Crystal Structure Of Triose-Phosphate Isomerase Wit 9e-30
2vei_A238 Structure-Based Enzyme Engineering Efforts With An 1e-29
2vek_A238 Structure-Based Enzyme Engineering Efforts With An 1e-28
2jgq_A233 Kinetics And Structural Properties Of Triosephospha 7e-24
>gi|24159115|pdb|1MO0|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase Length = 275 Back     alignment and structure
 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 91/256 (35%), Positives = 137/256 (53%), Gaps = 4/256 (1%)

Query: 4   GIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVI 63
             +  V GNWKM+G   S++ I   +     ++  +DV + PPA  +  +    K + V+
Sbjct: 22  TRKFFVGGNWKMNGDYASVDGIVTFLNA-SADNSSVDVVVAPPAPYLAYAKSKLK-AGVL 79

Query: 64  IGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAG 123
           + AQ+C+    G +TG+IS  M+ D G  +VILGHSERR    E   ++  K   A  AG
Sbjct: 80  VAAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAG 139

Query: 124 LYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVD 183
           +  + CIGE  EE  +G T +V  +QL   +         VIAYEP+WAIGTG+  +   
Sbjct: 140 IKVVFCIGEKLEEREAGHTKDVNFRQLQAIVDKGVSWENIVIAYEPVWAIGTGKTASGEQ 199

Query: 184 LEKIHSFVRRILLDRF-PEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHEL 242
            +++H ++R  L ++  P      RI+YGGSV   NA +     +IDG LVGGASL+ + 
Sbjct: 200 AQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGGASLKPD- 258

Query: 243 FLKIVEIVERVYVDSC 258
           F+KI+         +C
Sbjct: 259 FVKIINARSTALSCTC 274


>gi|116668059|pdb|2I9E|A Chain A, Structure Of Triosephosphate Isomerase Of Tenebrio Molitor Length = 259 Back     alignment and structure
>gi|217035241|pdb|2VFD|A Chain A, Crystal Structure Of The F96s Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>gi|190613420|pdb|2VOM|A Chain A, Structural Basis Of Human Triosephosphate Isomerase Deficiency. Mutation E104d And Correlation To Solvent Perturbation. Length = 250 Back     alignment and structure
>gi|66360365|pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form Length = 250 Back     alignment and structure
>gi|999892|pdb|1HTI|A Chain A, Crystal Structure Of Recombinant Human Triosephosphate Isomerase At 2.8 Angstroms Resolution. Triosephosphate Isomerase Related Human Genetic Disorders And Comparison With The Trypanosomal Enzyme Length = 248 Back     alignment and structure
>gi|217035251|pdb|2VFH|A Chain A, Crystal Structure Of The F96w Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Complexed With 3- Phosphoglycerate Length = 248 Back     alignment and structure
gi|40889552|pdb|1R2R|A Chain A, Crystal Structure Of Rabbit Muscle Triosephosphate Isomerase Length = 248 Back     alignment and structure
>gi|2624735|pdb|1YDV|A Chain A, Triosephosphate Isomerase (Tim) Length = 248 Back     alignment and structure
>gi|281501002|pdb|3KXQ|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Bartonella Henselae At 1.6a Resolution Length = 275 Back     alignment and structure
>gi|56554276|pdb|1VGA|A Chain A, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum Length = 248 Back     alignment and structure
>gi|217035245|pdb|2VFF|A Chain A, Crystal Structure Of The F96h Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>gi|52695572|pdb|1SU5|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>gi|999971|pdb|1TPB|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>gi|515257|pdb|1TPH|1 Chain 1, 1.8 Angstroms Crystal Structure Of Wild Type Chicken Triosephosphate Isomerase-Phosphoglycolohydroxamate Complex Length = 247 Back     alignment and structure
>gi|330689527|pdb|3PVF|A Chain A, Structure Of C126s Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Complexed With Pga Length = 248 Back     alignment and structure
>gi|52695546|pdb|1SPQ|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>gi|330689528|pdb|3PWA|A Chain A, Structure Of C126a Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>gi|52695558|pdb|1SSD|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>gi|52695585|pdb|1SW3|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant T175v Length = 248 Back     alignment and structure
>gi|999976|pdb|1TPC|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>gi|1064977|pdb|1TPW|A Chain A, Triosephosphate Isomerase Drinks Water To Keep Healthy Length = 247 Back     alignment and structure
>gi|52695587|pdb|1SW7|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant K174n, T175s, A176s Length = 248 Back     alignment and structure
>gi|52695550|pdb|1SQ7|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>gi|1064969|pdb|1TPU|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>gi|4389127|pdb|2BTM|A Chain A, Does The His12-Lys13 Pair Play A Role In The Adaptation Of Thermophilic Tims To High Temperatures? Length = 252 Back     alignment and structure
>gi|52695583|pdb|1SW0|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Hinge Mutant K174l, T175w Length = 248 Back     alignment and structure
>gi|230405|pdb|1YPI|A Chain A, Structure Of Yeast Triosephosphate Isomerase At 1.9- Angstroms Resolution Length = 247 Back     alignment and structure
>gi|1064974|pdb|1TPV|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>gi|14719493|pdb|1I45|A Chain A, Yeast Triosephosphate Isomerase (Mutant) Length = 248 Back     alignment and structure
>gi|230359|pdb|1TIM|A Chain A, Structure Of Triose Phosphate Isomerase From Chicken Muscle Length = 247 Back     alignment and structure
>gi|349951|pdb|3YPI|A Chain A, Electrophilic Catalysis In Triosephosphase Isomerase: The Role Of Histidine-95 Length = 247 Back     alignment and structure
>gi|327533573|pdb|3M9Y|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Methicillin Resistant Staphylococcus Aureus At 1.9 Angstrom Resolution Length = 254 Back     alignment and structure
>gi|6730109|pdb|1B9B|A Chain A, Triosephosphate Isomerase Of Thermotoga Maritima Length = 255 Back     alignment and structure
>gi|28374002|pdb|1NF0|A Chain A, Triosephosphate Isomerase In Complex With Dhap Length = 247 Back     alignment and structure
>gi|1431731|pdb|1BTM|A Chain A, Triosephosphate Isomerase (Tim) Complexed With 2- Phosphoglycolic Acid Length = 252 Back     alignment and structure
>gi|28374000|pdb|1NEY|A Chain A, Triosephosphate Isomerase In Complex With Dhap Length = 247 Back     alignment and structure
>gi|443293|pdb|1TRE|A Chain A, The Structure Of Triosephosphate Isomerase From Escherichia Coli Determined At 2.6 Angstrom Resolution Length = 255 Back     alignment and structure
>gi|270047867|pdb|3KRS|A Chain A, Structure Of Triosephosphate Isomerase From Cryptosporidium Parvum At 1.55a Resolution Length = 271 Back     alignment and structure
>gi|576304|pdb|1TMH|A Chain A, Modular Mutagenesis Of A Tim-Barrel Enzyme: The Crystal Structure Of A Chimeric E. Coli Tim Having The Eighth (Beta-Alpha)-Unit Replaced By The Equivalent Unit Of Chicken Tim Length = 254 Back     alignment and structure
>gi|12084529|pdb|1QDS|A Chain A, Superstable E65q Mutant Of Leishmania Mexicana Triosephosphate Isomerase (Tim) Length = 251 Back     alignment and structure
>gi|226887952|pdb|3GVG|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Mycobacterium Tuberculosis Length = 283 Back     alignment and structure
gi|157829966|pdb|1AMK|A Chain A, Leishmania Mexicana Triose Phosphate Isomerase Length = 251 Back     alignment and structure
gi|24987717|pdb|1M6J|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Entamoeba Histolytica Length = 261 Back     alignment and structure
gi|62738834|pdb|1YYA|A Chain A, Crystal Structure Of Tt0473, Putative Triosephosphate Isomerase From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>gi|122919948|pdb|2DP3|A Chain A, Crystal Structure Of A Double Mutant (C202aA198V) OF Triosephosphate Isomerase From Giardia Lamblia Length = 257 Back     alignment and structure
gi|2914362|pdb|1AW1|A Chain A, Triosephosphate Isomerase Of Vibrio Marinus Complexed With 2-Phosphoglycolate Length = 256 Back     alignment and structure
>gi|168177112|pdb|2V0T|A Chain A, The A178l Mutation In The C-Terminal Hinge Of The Flexible Loop-6 Of Triosephosphate Isomerase (Tim) Induces A More Closed Conformation Of This Hinge Region In Dimeric And Monomeric Tim Length = 250 Back     alignment and structure
gi|231086|pdb|4TIM|A Chain A, Crystallographic And Molecular Modeling Studies On Trypanosomal Triosephosphate Isomerase: A Critical Assessment Of The Predicted And Observed Structures Of The Complex With 2-Phosphoglycerate Length = 250 Back     alignment and structure
gi|6137635|pdb|1CI1|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Trypanosoma Cruzi In Hexane Length = 251 Back     alignment and structure
>gi|20151079|pdb|1KV5|A Chain A, Structure Of Trypanosoma Brucei Brucei Tim With The Salt- Bridge-Forming Residue Arg191 Mutated To Ser Length = 250 Back     alignment and structure
>gi|126030922|pdb|2J24|A Chain A, The Functional Role Of The Conserved Active Site Proline Of Triosephosphate Isomerase Length = 250 Back     alignment and structure
>gi|258588214|pdb|2WSQ|A Chain A, Monotim Mutant Rmm0-1, Dimeric Form. Length = 242 Back     alignment and structure
gi|230929|pdb|3TIM|A Chain A, The Crystal Structure Of The "open" And The "closed" Conformation Of The Flexible Loop Of Trypanosomal Triosephosphate Isomerase Length = 250 Back     alignment and structure
>gi|4389144|pdb|1TCD|A Chain A, Trypanosoma Cruzi Triosephosphate Isomerase Length = 249 Back     alignment and structure
>gi|160877706|pdb|2OMA|A Chain A, Crystallographic Analysis Of A Chemically Modified Triosephosphate Isomerase From Trypanosoma Cruzi With Dithiobenzylamine (Dtba) Length = 250 Back     alignment and structure
>gi|258588218|pdb|2WSR|A Chain A, Monotim Mutant Rmm0-1, Monomeric Form Length = 242 Back     alignment and structure
>gi|157834010|pdb|1TRI|A Chain A, The Crystal Structure Of An Engineered Monomeric Triosephosphate Isomerase, Monotim: The Correct Modelling Of An Eight-Residue Loop Length = 243 Back     alignment and structure
>gi|157834028|pdb|1TTI|A Chain A, Three New Crystal Structures Of Point Mutation Variants Of Monotim: Conformational Flexibility Of Loop-1,Loop-4 And Loop-8 Length = 243 Back     alignment and structure
>gi|212374868|pdb|2V5B|A Chain A, The Monomerization Of Triosephosphate Isomerase From Trypanosoma Cruzi Length = 244 Back     alignment and structure
>gi|640311|pdb|1MSS|A Chain A, Large Scale Structural Rearrangements Of The Front Loops In Monomerised Triosephosphate Isomerase, As Deduced From The Comparison Of The Structural Properties Of Monotim And Its Point Mutation Variant Monoss Length = 243 Back     alignment and structure
>gi|157879294|pdb|1ML1|A Chain A, Protein Engineering With Monomeric Triosephosphate Isomerase: The Modelling And Structure Verification Of A Seven Residue Loop Length = 243 Back     alignment and structure
>gi|168177121|pdb|2V2D|A Chain A, The A178l Mutation In The C-Terminal Hinge Of The Flexible Loop-6 Of Triosephosphate Isomerase (Tim) Induces A More Closed Conformation Of This Hinge Region In Dimeric And Monomeric Tim Length = 242 Back     alignment and structure
>gi|11514048|pdb|1DKW|A Chain A, Crystal Structure Of Triose-Phosphate Isomerase With Modified Substrate Binding Site Length = 238 Back     alignment and structure
>gi|168177126|pdb|2VEI|A Chain A, Structure-Based Enzyme Engineering Efforts With An Inactive Monomeric Tim Variant: The Importance Of A Single Point Mutation For Generating An Active Site With Suitable Binding Properties Length = 238 Back     alignment and structure
>gi|168177129|pdb|2VEK|A Chain A, Structure-Based Enzyme Engineering Efforts With An Inactive Monomeric Tim Variant: The Importance Of A Single Point Mutation For Generating An Active Site With Suitable Binding Properties Length = 238 Back     alignment and structure
>gi|168988629|pdb|2JGQ|A Chain A, Kinetics And Structural Properties Of Triosephosphate Isomerase From Helicobacter Pylori Length = 233 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 triosephosphate isomerase protein [Candidatus Liberibac
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW 1e-76
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerate, ME 6e-66
1r2r_A248 TIM, triosephosphate isomerase; closed loop conformatio 2e-65
1mo0_A275 TIM, triosephosphate isomerase; structural genomics, PS 9e-65
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis, tra 8e-64
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, monomer 6e-62
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihydroxya 3e-61
1hg3_A225 Triosephosphate isomerase; thermostability, tetrameric; 1e-48
1b9b_A255 TIM, protein (triosephosphate isomerase); thermophilic; 6e-46
3gvg_A283 Triosephosphate isomerase; cytoplasm, gluconeogenesis, 1e-44
1aw2_A256 Triosephosphate isomerase; psychrophilic; 2.65A {Vibrio 2e-44
1yya_A250 Triosephosphate isomerase; riken structural genomics/pr 3e-44
2dp3_A257 Triosephosphate isomerase; enzyme, alpha/beta barrel; 2 5e-44
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald biostr 2e-43
1tre_A255 Triosephosphate isomerase; intramolecular oxidoreductas 5e-43
2btm_A252 TIM, protein (triosephosphate isomerase); thermophilic 7e-43
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor} Len 7e-42
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shunt, g 8e-39
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, 5e-38
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotctim, g 8e-37
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, gluconeogen 1e-31
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30A {Me 6e-31
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, cytoplasm, gluconeogenesis, glycolysis, pentose shunt, structural genomics; 1.60A {Bartonella henselae} Length = 275 Back     alignment and structure
 Score =  281 bits (720), Expect = 1e-76
 Identities = 106/254 (41%), Positives = 163/254 (64%), Gaps = 1/254 (0%)

Query: 1   MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSC-CIDVAICPPATLIYESSRLCKT 59
           M   IRP + GNWKM+G   SL  ++ I  GI  +     +  IC PATL+  +  +   
Sbjct: 22  MSPNIRPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALICVPATLLSRAFDILGG 81

Query: 60  SSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSA 119
            ++++G Q+CH  +YGPYTGDISA ML + GA+ VI+GHSERR  ++E   +V++KV++A
Sbjct: 82  ENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAA 141

Query: 120 CNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVP 179
             AGL  ++C+GET EE +S +  +VL +QL+ SLP    +   +IAYEP+WA+GTG   
Sbjct: 142 WRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWAVGTGNTA 201

Query: 180 AVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQ 239
              D+ ++H+F+   +  RF +EG K+R+LYGGSV  +NA +     +++G L+GGASL+
Sbjct: 202 TSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLK 261

Query: 240 HELFLKIVEIVERV 253
              FL I ++  ++
Sbjct: 262 AIDFLTICDVYRKL 275


>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 2vfd_A 2vfe_A* Length = 248 Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Length = 248 Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Length = 275 Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, PGH; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Length = 251 Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Length = 261 Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Length = 247 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Length = 225 Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Length = 255 Back     alignment and structure
>3gvg_A Triosephosphate isomerase; cytoplasm, gluconeogenesis, glycolysis, pentose shunt, structural genomics; 1.55A {Mycobacterium tuberculosis} Length = 283 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic; 2.65A {Vibrio marinus} SCOP: c.1.1.1 PDB: 1aw1_A Length = 256 Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus HB8} Length = 250 Back     alignment and structure
>2dp3_A Triosephosphate isomerase; enzyme, alpha/beta barrel; 2.10A {Giardia intestinalis} Length = 257 Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washington, NIH, niaid, structural genomics; 1.55A {Cryptosporidium parvum iowa II} Length = 271 Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Length = 255 Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Length = 252 Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Length = 259 Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Length = 233 Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 1ml1_A 2wsr_A 2v2h_A 2v2d_A 1dkw_A 2vei_A 2vek_A* 2vel_A ... Length = 250 Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Length = 244 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Length = 226 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii DSM2661} Length = 219 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target264 triosephosphate isomerase protein [Candidatus Liberibac
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW 100.0
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald biostr 100.0
3gvg_A283 Triosephosphate isomerase; cytoplasm, gluconeogenesis, 100.0
1tre_A255 Triosephosphate isomerase; intramolecular oxidoreductas 100.0
2dp3_A257 Triosephosphate isomerase; enzyme, alpha/beta barrel; 2 100.0
1yya_A250 Triosephosphate isomerase; riken structural genomics/pr 100.0
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerate, ME 100.0
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis, tra 100.0
1b9b_A255 TIM, protein (triosephosphate isomerase); thermophilic; 100.0
1mo0_A275 TIM, triosephosphate isomerase; structural genomics, PS 100.0
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio marinu 100.0
2btm_A252 TIM, protein (triosephosphate isomerase); thermophilic 100.0
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihydroxya 100.0
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor} 100.0
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, 100.0
1r2r_A248 TIM, triosephosphate isomerase; closed loop conformatio 100.0
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, monomer 100.0
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotctim, g 100.0
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shunt, g 100.0
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30A {Me 100.0
1hg3_A225 Triosephosphate isomerase; thermostability, tetrameric; 100.0
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, gluconeogen 100.0
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, 94.92
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel epime 94.76
1ka9_F252 Imidazole glycerol phosphtate synthase; riken structura 91.75
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis, try 91.23
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydroxami 94.31
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxygen l 90.17
1vhn_A318 Putative flavin oxidoreducatase; structural genomics, u 91.54
1viz_A240 PCRB protein homolog; structural genomics, unknown func 90.39
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structural ge 90.23
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrolase, 90.07
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, cytoplasm, gluconeogenesis, glycolysis, pentose shunt, structural genomics; 1.60A {Bartonella henselae} Back     alignment and structure
Probab=100.00  E-value=0  Score=657.73  Aligned_cols=253  Identities=42%  Similarity=0.778  Sum_probs=240.0

Q ss_pred             CCCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCC-CCCCEEEEECCHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCCCC
Q ss_conf             99888506998646568999999999999522234-57711999689655999999732576310222012223334332
Q gi|254780197|r    1 MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRN-SCCIDVAICPPATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTG   79 (264)
Q Consensus         1 m~~~mK~iIigNWKMN~~~~~~~~~~~~~~~~~~~-~~~veivi~Pp~~~L~~~~~~~~~s~I~igAQnv~~~~~GA~TG   79 (264)
                      |..+||||||||||||++.+++..+.+.+.....+ ..++++++|||++||..+.+.+++++|.+|||||++.+.|||||
T Consensus        22 m~~~mK~iI~gNWKMN~~~~~~~~~~~~~~~~~~~~~~~~evvi~Pp~~~l~~~~~~~~~~~i~lgAQn~~~~~~GA~TG  101 (275)
T 3kxq_A           22 MSPNIRPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALICVPATLLSRAFDILGGENILLGGQNCHFDDYGPYTG  101 (275)
T ss_dssp             ----CCCEEEEECCBCCCGGGHHHHHHHHHHHC----CCSEEEEECCTTTHHHHHHHHTTSSSEEEESCCCSSSSBSCTT
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCC
T ss_conf             68888828999414589999999999999851001057871999899899999999846997178403343446776656


Q ss_pred             CCCHHHHHHHCCCCEEECCHHCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             12067775407310010420002213579999999999998334747998165520333498000111002221000000
Q gi|254780197|r   80 DISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFK  159 (264)
Q Consensus        80 eiSa~mL~d~g~~~viiGHSERR~~~~E~d~~I~~K~~~al~~~l~pIlCiGE~~~e~~~~~~~~~l~~Ql~~~l~~~~~  159 (264)
                      |||+.||+|+||+||||||||||.+|+|||++|++|+++|+++||+||+||||++++|+.+++.+++.+|+..++.+...
T Consensus       102 eISa~mLkd~g~~yvIIGHSERR~~~~Etd~~i~~Kv~~al~~gl~pIlCIGEt~e~r~~~~t~~~l~~Ql~~~l~~~~~  181 (275)
T 3kxq_A          102 DISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGAT  181 (275)
T ss_dssp             CCCHHHHHHHTCSEEEESCHHHHHHTCCCHHHHHHHHHHHHHTTCEEEEEECCCHHHHHTTCHHHHHHHHHHHHSCTTCC
T ss_pred             CCCHHHHHHCCCCEEEECCHHHHCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHCCCHHHHHHHHHHHHHCCCCC
T ss_conf             45899998769987886345653037987399999999999879917999545067540687499999999987136643


Q ss_pred             CCCCEEEECHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCEEEECCCCCHHHHHHHHCCCCCCEEEECHHHCC
Q ss_conf             13411320513530455764311245544679999996332241643088627789878999966898968897434358
Q gi|254780197|r  160 SSVPVIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQ  239 (264)
Q Consensus       160 ~~~~iIAYEPvWAIGtG~~a~~~~i~~~~~~Ir~~l~~~~~~~~~~i~ilYGGSV~~~N~~~l~~~~~iDG~LVG~ASl~  239 (264)
                      .++++||||||||||||++|++++|+++|++||+++.+.|+..+.++|||||||||++|+++|+++++|||+||||||||
T Consensus       182 ~~~iiIAYEPvWAIGTG~~as~~~i~~~~~~Ir~~l~~~~~~~~~~v~ILYGGSV~~~N~~~i~~~~~vDG~LVGgASL~  261 (275)
T 3kxq_A          182 AENIIIAYEPVWAVGTGNTATSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLK  261 (275)
T ss_dssp             TTTEEEEECCCC--------CHHHHHHHHHHHHHHHHHHHHHHHTTSCEEECSCCCTTTHHHHHTSTTCCEEEESGGGSS
T ss_pred             CCCEEEEECCEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHCCCCCCEEEECHHHCC
T ss_conf             35349987774224789999809999999999999998713224781099707899879999956889897993256579


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             89999999999999
Q gi|254780197|r  240 HELFLKIVEIVERV  253 (264)
Q Consensus       240 ~~~F~~Ii~~~~~~  253 (264)
                      +++|++|++.++|+
T Consensus       262 ~e~F~~Ii~~~~k~  275 (275)
T 3kxq_A          262 AIDFLTICDVYRKL  275 (275)
T ss_dssp             HHHHHHHHGGGGC-
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             89999999999649



>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washington, NIH, niaid, structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3gvg_A Triosephosphate isomerase; cytoplasm, gluconeogenesis, glycolysis, pentose shunt, structural genomics; 1.55A {Mycobacterium tuberculosis} Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>2dp3_A Triosephosphate isomerase; enzyme, alpha/beta barrel; 2.10A {Giardia intestinalis} Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus HB8} Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 2vfd_A 2vfe_A* Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, PGH; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 1ml1_A 2wsr_A 2v2h_A 2v2d_A 1dkw_A 2vei_A 2vek_A* 2vel_A ... Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, structural genomics, center for structural genomics of infectious diseases; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol- phosphate, lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA; 2.00A {Aquifex aeolicus VF5} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti MAFF303099} SCOP: c.1.12.9 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 264 triosephosphate isomerase protein [Candidatus Liberibac
d1b9ba_252 c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga mari 4e-46
d1r2ra_246 c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctol 2e-45
d1trea_255 c.1.1.1 (A:) Triosephosphate isomerase {Escherichia col 4e-45
d1aw1a_255 c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus 1e-44
d2btma_251 c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearo 4e-44
d1mo0a_257 c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caeno 3e-42
d1n55a_249 c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexi 1e-41
d1neya_247 c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast ( 2e-41
d1o5xa_246 c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falc 3e-41
d1m6ja_260 c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histo 3e-41
d1kv5a_249 c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma bru 3e-38
d1w0ma_226 c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus t 3e-29
d1hg3a_224 c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyroco 2e-24
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Length = 252 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Thermotoga maritima [TaxId: 2336]
 Score =  178 bits (452), Expect = 4e-46
 Identities = 91/251 (36%), Positives = 146/251 (58%), Gaps = 4/251 (1%)

Query: 6   RPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTSSVIIG 65
           + ++ GNWKMH      ++   ++     +    ++ +CPP T + E   +    ++ +G
Sbjct: 3   KLILAGNWKMHKTISEAKKFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLG 62

Query: 66  AQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSACNAGLY 125
           AQ+    + G +TG+IS  ML + G  +VI+GHSERR   +ED   +  KVK+    G+ 
Sbjct: 63  AQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMT 122

Query: 126 PIVCIGETDEEYRSGRTFEVLQKQLD--CSLPSEFKSSVPVIAYEPIWAIGTGRVPAVVD 183
           PI+C+GET EE   G TF V++KQ+        + ++   VIAYEP+WAIGTGRV     
Sbjct: 123 PILCVGETLEEREKGLTFCVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQ 182

Query: 184 LEKIHSFVRRILLDRFPEE-GQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQHEL 242
            +++H+F+R++L + + EE    +RILYGGS+   N     + ++IDG LVGGASL+   
Sbjct: 183 AQEVHAFIRKLLSEMYDEETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKES- 241

Query: 243 FLKIVEIVERV 253
           F+++  I+  V
Sbjct: 242 FIELARIMRGV 252


>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 246 Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Length = 255 Back     information, alignment and structure