254780198

254780198

hypothetical protein CLIBASIA_00415

GeneID in NCBI database:8209179Locus tag:CLIBASIA_00415
Protein GI in NCBI database:254780198Protein Accession:YP_003064611.1
Gene range:+(89046, 89255)Protein Length:69aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------7
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK
cccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccEEEEc
cccHHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccHHHEcc
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHIsghvnfllfpplsmiflk
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK
*IQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK
ooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLFPPLSMIFLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target69 hypothetical protein CLIBASIA_00415 [Candidatus Liberib
31512262568 hypothetical protein CKC_04385 [Candidatus Liberibacter 1 4e-18
>gi|315122625|ref|YP_004063114.1| hypothetical protein CKC_04385 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 68 Back     alignment and organism information
 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%)

Query: 1  MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMIVHITHISGHVNFLLF 60
          MI++FWIAVDV VI++TIITCFFMNKQ +WW+RV +P LLIS+M+VHI +ISG +NF LF
Sbjct: 1  MIKNFWIAVDVLVIISTIITCFFMNKQFSWWIRVLVPSLLISVMVVHIAYISGQINFFLF 60

Query: 61 PPL 63
          P +
Sbjct: 61 PAI 63


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00