254780199

254780199

outer membrane lipoprotein

GeneID in NCBI database:8209180Locus tag:CLIBASIA_00420
Protein GI in NCBI database:254780199Protein Accession:YP_003064612.1
Gene range:+(89418, 89900)Protein Length:160aa
Gene description:outer membrane lipoprotein
COG prediction:none
KEGG prediction:outer membrane lipoprotein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK
cccEEEEEHHHHHHHHHHHHHHcccEEEEEEEcHHcccccccccEEEEEcccEEEEEEcccEEEEEEccccccEEccEEEEEEccEEEEEEEEEEEcccccEEEEEEEcccEEEEEcccccEEEEEEEEEEccccccccHHHHHccccccccccEEEEEc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEHHHHcccccccccEEEccccEEEEEEcccEEEEEEccccHHHHHcccEEEEcccEEEEEEEEEEEccccEEEEEEEccccEEEEcccccEEEEEEccccccccccccccccEccccccccccEEEEEc
mqarcflslsFLFPLVAAIAVVSCSALSVvvdssellpepmditgyweddngILSYFqkdgkfktistdgsssvlatgsyhvkiNQDVEIKLTSLIRntsgkiqcqfldsnklnclakDQKQFYLRrthltelpsskpqddvaeipedpttpstsiifyk
MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRThltelpsskpqddvaeipedpttpstsiifyk
MQARCFLSLSFLFPLvaaiavvscsalsvvvdssELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK
******L*LSFLFPLVAAIAVV*******************DITGYWEDDNGILSYFQKDGKFKTISTD*SSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRT************************S***IFYK
MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK
*QARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK
MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK
MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target160 outer membrane lipoprotein [Candidatus Liberibacter asi
315122626157 outer membrane lipoprotein [Candidatus Liberibacter sol 1 1e-40
222149721130 outer membrane lipoprotein [Agrobacterium vitis S4] Len 1 3e-13
325063187124 Outer membrane lipoprotein omp10 [Agrobacterium sp. H13 1 8e-12
241206291122 outer membrane lipoprotein [Rhizobium leguminosarum bv. 1 6e-11
116253811122 hypothetical protein RL4074 [Rhizobium leguminosarum bv 1 6e-11
209550877122 outer membrane lipoprotein [Rhizobium leguminosarum bv. 1 6e-11
86359145122 outer membrane lipoprotein [Rhizobium etli CFN 42] Leng 1 2e-10
153011580126 lipoprotein Omp10 [Ochrobactrum anthropi ATCC 49188] Le 1 4e-10
15891181124 outer membrane lipoprotein [Agrobacterium tumefaciens s 1 5e-10
239834496139 Hypothetical protein, conserved [Ochrobactrum intermedi 1 5e-10
>gi|315122626|ref|YP_004063115.1| outer membrane lipoprotein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 157 Back     alignment and organism information
 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/145 (60%), Positives = 110/145 (75%), Gaps = 10/145 (6%)

Query: 21  VVSCSALSVVVDSSELLPEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSY 80
           + SC  + +V D+  LLP    I GYWEDDNGILS FQKDG FKTISTDGSSS+LATG Y
Sbjct: 18  IGSCGVIPMV-DNQILLPS---IVGYWEDDNGILSQFQKDGTFKTISTDGSSSILATGFY 73

Query: 81  HVKINQDVEIKLTSLIRNTSGKIQCQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQD 140
             K NQ ++IKLTSLIR+TS KIQC+F++ +KL C+ +++KQFYLRRTHLTE+P +KPQ+
Sbjct: 74  SEKANQGIDIKLTSLIRSTSEKIQCKFVEYSKLTCITQNKKQFYLRRTHLTEVPVTKPQN 133

Query: 141 D-----VAEIPEDPTTPSTSIIFYK 160
           D      AE P +P  PS S+I+YK
Sbjct: 134 DNVVVTSAEDPNNP-NPSPSMIYYK 157


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149721|ref|YP_002550678.1| outer membrane lipoprotein [Agrobacterium vitis S4] Length = 130 Back     alignment and organism information
>gi|325063187|gb|ADY66877.1| Outer membrane lipoprotein omp10 [Agrobacterium sp. H13-3] Length = 124 Back     alignment and organism information
>gi|241206291|ref|YP_002977387.1| outer membrane lipoprotein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 122 Back     alignment and organism information
>gi|116253811|ref|YP_769649.1| hypothetical protein RL4074 [Rhizobium leguminosarum bv. viciae 3841] Length = 122 Back     alignment and organism information
>gi|209550877|ref|YP_002282794.1| outer membrane lipoprotein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 122 Back     alignment and organism information
>gi|86359145|ref|YP_471037.1| outer membrane lipoprotein [Rhizobium etli CFN 42] Length = 122 Back     alignment and organism information
>gi|153011580|ref|YP_001372794.1| lipoprotein Omp10 [Ochrobactrum anthropi ATCC 49188] Length = 126 Back     alignment and organism information
>gi|15891181|ref|NP_356853.1| outer membrane lipoprotein [Agrobacterium tumefaciens str. C58] Length = 124 Back     alignment and organism information
>gi|239834496|ref|ZP_04682824.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 139 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 160 outer membrane lipoprotein [Candidatus Liberibacter asi
TIGR03066111 Gem_osc_para_1 Gemmata obscuriglobus paralogous family 91.98
>TIGR03066 Gem_osc_para_1 Gemmata obscuriglobus paralogous family TIGR03066 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00