254780200

254780200

ferrochelatase

GeneID in NCBI database:8209181Locus tag:CLIBASIA_00425
Protein GI in NCBI database:254780200Protein Accession:YP_003064613.1
Gene range:+(90066, 91097)Protein Length:343aa
Gene description:ferrochelatase
COG prediction:[H] Protoheme ferro-lyase (ferrochelatase)
KEGG prediction:hemH; ferrochelatase (EC:4.99.1.1); K01772 ferrochelatase [EC:4.99.1.1]
SEED prediction:Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
Biogenesis of c-type cytochromes
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
ccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHcccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEcccHHHccHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHcccc
ccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHccccEEcccHHHHHHHHcccEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHcccccHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHcccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHcccc
mnissfaprnhpkvkfgKIGVLLVnlgtpdghdfFSLRRYLREFLLDKRvvelpswqwrpilfgyilnfrpskiKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREegcdrllifplypqysaattgtAQDKVFQELIHmrwspslrtvppyyedsdYISALAQSIREHFESIQWTPEMLLVSFHqmpvsyllkgdpygchchKTARLLKEFLswpddrfkicfqsrfgrikclepptdktvEKLAHDGIKslaiitpgfssdclETSYEIAHEAKEIFvngggekftqvpclnssnlsIDLLEKITRRELMGWI
mnissfaprnhpkvkfGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVvelpswqwrpILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKftqvpclnssnlsidllekitrrelmgwi
MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
******************IGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
*****FAPRNHP*VKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI
MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
315122627343 ferrochelatase [Candidatus Liberibacter solanacearum CL 1 1e-154
86359147344 ferrochelatase [Rhizobium etli CFN 42] Length = 344 1 1e-121
241206294350 ferrochelatase [Rhizobium leguminosarum bv. trifolii WS 1 1e-120
218674864344 ferrochelatase [Rhizobium etli GR56] Length = 344 1 1e-119
190893384344 ferrochelatase protein [Rhizobium etli CIAT 652] Length 1 1e-119
116253813344 ferrochelatase [Rhizobium leguminosarum bv. viciae 3841 1 1e-119
327189611361 ferrochelatase protein [Rhizobium etli CNPAF512] Length 1 1e-119
209550880344 ferrochelatase [Rhizobium leguminosarum bv. trifolii WS 1 1e-119
222149723344 ferrochelatase [Agrobacterium vitis S4] Length = 344 1 1e-118
159185893344 ferrochelatase [Agrobacterium tumefaciens str. C58] Len 1 1e-118
>gi|315122627|ref|YP_004063116.1| ferrochelatase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 343 Back     alignment and organism information
 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 255/343 (74%), Positives = 298/343 (86%)

Query: 1   MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRP 60
           MNISS AP +HP+VKFGKIGVL++NLGTPDG+DFFSLRRYL+EFLLDKRV+ELPSWQW P
Sbjct: 1   MNISSSAPHDHPEVKFGKIGVLILNLGTPDGYDFFSLRRYLKEFLLDKRVIELPSWQWWP 60

Query: 61  ILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRY 120
           ILFG ILN RP KIKHAYA+IWNT++NESILRTHTR+QA NLAK LE+I S++VDW+MRY
Sbjct: 61  ILFGIILNIRPQKIKHAYAQIWNTSQNESILRTHTRNQAINLAKGLENIPSVIVDWSMRY 120

Query: 121 GKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRTVPPY 180
           GKPSV E I++L ++GC R+++FPLYPQYSAAT  TAQDKVFQ+L+ MRW+PSLR VPPY
Sbjct: 121 GKPSVDETIDSLTKKGCSRIILFPLYPQYSAATIATAQDKVFQKLMKMRWTPSLRVVPPY 180

Query: 181 YEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEF 240
           Y++ DYISAL  S+  H ES+QW PE+LL SFH MP+SY LKGDPY CHCHKTARLLKE 
Sbjct: 181 YDNPDYISALTHSVNTHLESLQWEPEILLASFHGMPLSYCLKGDPYRCHCHKTARLLKES 240

Query: 241 LSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIA 300
           LS  D  FKI FQSRFG  + L+P TDKT+++LAH GIK +AIITPGFSSDCLET+YEIA
Sbjct: 241 LSRTDANFKITFQSRFGVSEWLQPYTDKTIQQLAHSGIKRIAIITPGFSSDCLETNYEIA 300

Query: 301 HEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGWI 343
           HE KE+F+  GG++FT +PCLNSSNL IDLLEKITRRELMGWI
Sbjct: 301 HEVKEMFIQHGGQEFTHIPCLNSSNLGIDLLEKITRRELMGWI 343


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359147|ref|YP_471039.1| ferrochelatase [Rhizobium etli CFN 42] Length = 344 Back     alignment and organism information
>gi|241206294|ref|YP_002977390.1| ferrochelatase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 350 Back     alignment and organism information
>gi|218674864|ref|ZP_03524533.1| ferrochelatase [Rhizobium etli GR56] Length = 344 Back     alignment and organism information
>gi|190893384|ref|YP_001979926.1| ferrochelatase protein [Rhizobium etli CIAT 652] Length = 344 Back     alignment and organism information
>gi|116253813|ref|YP_769651.1| ferrochelatase [Rhizobium leguminosarum bv. viciae 3841] Length = 344 Back     alignment and organism information
>gi|327189611|gb|EGE56761.1| ferrochelatase protein [Rhizobium etli CNPAF512] Length = 361 Back     alignment and organism information
>gi|209550880|ref|YP_002282797.1| ferrochelatase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 344 Back     alignment and organism information
>gi|222149723|ref|YP_002550680.1| ferrochelatase [Agrobacterium vitis S4] Length = 344 Back     alignment and organism information
>gi|159185893|ref|NP_356851.2| ferrochelatase [Agrobacterium tumefaciens str. C58] Length = 344 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
PRK00035333 PRK00035, hemH, ferrochelatase; Reviewed 1e-114
COG0276320 COG0276, HemH, Protoheme ferro-lyase (ferrochelatase) [ 8e-95
PLN02449485 PLN02449, PLN02449, ferrochelatase 7e-81
TIGR00109322 TIGR00109, hemH, ferrochelatase 1e-67
KOG1321395 KOG1321, KOG1321, KOG1321, Protoheme ferro-lyase (ferro 1e-36
pfam00762312 pfam00762, Ferrochelatase, Ferrochelatase 1e-105
cd03411159 cd03411, Ferrochelatase_N, Ferrochelatase, N-terminal d 2e-43
cd00419135 cd00419, Ferrochelatase_C, Ferrochelatase, C-terminal d 3e-40
PRK12435311 PRK12435, PRK12435, ferrochelatase; Provisional 3e-05
>gnl|CDD|178811 PRK00035, hemH, ferrochelatase; Reviewed Back     alignment and domain information
>gnl|CDD|30624 COG0276, HemH, Protoheme ferro-lyase (ferrochelatase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178068 PLN02449, PLN02449, ferrochelatase Back     alignment and domain information
>gnl|CDD|161712 TIGR00109, hemH, ferrochelatase Back     alignment and domain information
>gnl|CDD|36535 KOG1321, KOG1321, KOG1321, Protoheme ferro-lyase (ferrochelatase) [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|144384 pfam00762, Ferrochelatase, Ferrochelatase Back     alignment and domain information
>gnl|CDD|48638 cd03411, Ferrochelatase_N, Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway Back     alignment and domain information
>gnl|CDD|73203 cd00419, Ferrochelatase_C, Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway Back     alignment and domain information
>gnl|CDD|183526 PRK12435, PRK12435, ferrochelatase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 343 ferrochelatase [Candidatus Liberibacter asiaticus str.
PRK00035325 hemH ferrochelatase; Reviewed 100.0
COG0276320 HemH Protoheme ferro-lyase (ferrochelatase) [Coenzyme m 100.0
pfam00762312 Ferrochelatase Ferrochelatase. 100.0
TIGR00109339 hemH ferrochelatase; InterPro: IPR001015 Synonym(s): Pr 100.0
PRK12435316 ferrochelatase; Provisional 100.0
KOG1321395 consensus 100.0
cd03411159 Ferrochelatase_N Ferrochelatase, N-terminal domain: Fer 100.0
cd00419135 Ferrochelatase_C Ferrochelatase, C-terminal domain: Fer 100.0
cd03409101 Chelatase_Class_II Class II Chelatase: a family of ATP- 99.28
cd03414117 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) an 98.17
PRK00923130 sirohydrochlorin cobaltochelatase; Reviewed 98.11
cd03415125 CbiX_CbiC Archaeal sirohydrochlorin cobalt chelatase (C 97.48
pfam06180256 CbiK Cobalt chelatase (CbiK). This family consists of s 99.06
PRK02395284 hypothetical protein; Provisional 98.2
COG4822265 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatas 97.85
COG2138245 Sirohydrochlorin ferrochelatase [Inorganic ion transpor 98.61
PRK00923130 sirohydrochlorin cobaltochelatase; Reviewed 98.46
PRK00035325 hemH ferrochelatase; Reviewed 97.94
cd03414117 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) an 97.86
pfam01903106 CbiX CbiX. The function of CbiX is uncertain, however i 97.41
cd03415125 CbiX_CbiC Archaeal sirohydrochlorin cobalt chelatase (C 97.07
PRK05782332 precorrin-8X methylmutase; Validated 96.91
KOG1321395 consensus 96.39
COG0276 320 HemH Protoheme ferro-lyase (ferrochelatase) [Coenzyme m 98.29
TIGR00109 339 hemH ferrochelatase; InterPro: IPR001015 Synonym(s): Pr 97.13
PRK12435316 ferrochelatase; Provisional 98.09
cd03409101 Chelatase_Class_II Class II Chelatase: a family of ATP- 98.08
cd03416101 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) an 96.21
cd03413103 CbiK_C Anaerobic cobalamin biosynthetic cobalt chelatas 94.93
pfam00762 312 Ferrochelatase Ferrochelatase. 97.9
pfam01903106 CbiX CbiX. The function of CbiX is uncertain, however i 97.47
cd03411159 Ferrochelatase_N Ferrochelatase, N-terminal domain: Fer 95.88
cd03412127 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatas 94.11
PRK05782332 precorrin-8X methylmutase; Validated 96.84
cd03416101 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) an 96.76
pfam06180256 CbiK Cobalt chelatase (CbiK). This family consists of s 96.81
COG2138245 Sirohydrochlorin ferrochelatase [Inorganic ion transpor 96.06
cd03412127 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatas 94.44
>PRK00035 hemH ferrochelatase; Reviewed Back     alignment and domain information
>COG0276 HemH Protoheme ferro-lyase (ferrochelatase) [Coenzyme metabolism] Back     alignment and domain information
>pfam00762 Ferrochelatase Ferrochelatase Back     alignment and domain information
>TIGR00109 hemH ferrochelatase; InterPro: IPR001015 Synonym(s): Protoheme ferro-lyase, Iron chelatase, etc Back     alignment and domain information
>PRK12435 ferrochelatase; Provisional Back     alignment and domain information
>KOG1321 consensus Back     alignment and domain information
>cd03411 Ferrochelatase_N Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway Back     alignment and domain information
>cd00419 Ferrochelatase_C Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway Back     alignment and domain information
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings Back     alignment and domain information
>cd03414 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), C-terminal domain Back     alignment and domain information
>PRK00923 sirohydrochlorin cobaltochelatase; Reviewed Back     alignment and domain information
>cd03415 CbiX_CbiC Archaeal sirohydrochlorin cobalt chelatase (CbiX) single domain Back     alignment and domain information
>pfam06180 CbiK Cobalt chelatase (CbiK) Back     alignment and domain information
>PRK02395 hypothetical protein; Provisional Back     alignment and domain information
>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism] Back     alignment and domain information
>COG2138 Sirohydrochlorin ferrochelatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00923 sirohydrochlorin cobaltochelatase; Reviewed Back     alignment and domain information
>PRK00035 hemH ferrochelatase; Reviewed Back     alignment and domain information
>cd03414 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), C-terminal domain Back     alignment and domain information
>pfam01903 CbiX CbiX Back     alignment and domain information
>cd03415 CbiX_CbiC Archaeal sirohydrochlorin cobalt chelatase (CbiX) single domain Back     alignment and domain information
>PRK05782 precorrin-8X methylmutase; Validated Back     alignment and domain information
>KOG1321 consensus Back     alignment and domain information
>COG0276 HemH Protoheme ferro-lyase (ferrochelatase) [Coenzyme metabolism] Back     alignment and domain information
>TIGR00109 hemH ferrochelatase; InterPro: IPR001015 Synonym(s): Protoheme ferro-lyase, Iron chelatase, etc Back     alignment and domain information
>PRK12435 ferrochelatase; Provisional Back     alignment and domain information
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings Back     alignment and domain information
>cd03416 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), N-terminal domain Back     alignment and domain information
>cd03413 CbiK_C Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), C-terminal domain Back     alignment and domain information
>pfam00762 Ferrochelatase Ferrochelatase Back     alignment and domain information
>pfam01903 CbiX CbiX Back     alignment and domain information
>cd03411 Ferrochelatase_N Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway Back     alignment and domain information
>cd03412 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), N-terminal domain Back     alignment and domain information
>PRK05782 precorrin-8X methylmutase; Validated Back     alignment and domain information
>cd03416 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), N-terminal domain Back     alignment and domain information
>pfam06180 CbiK Cobalt chelatase (CbiK) Back     alignment and domain information
>COG2138 Sirohydrochlorin ferrochelatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03412 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
2po7_A359 Crystal Structure Of Human Ferrochelatase Mutant Wi 1e-66
2qd3_A359 Wild Type Human Ferrochelatase Crystallized With Am 1e-60
2qd2_A359 F110a Variant Of Human Ferrochelatase With Protohem 4e-60
1hrk_A359 Crystal Structure Of Human Ferrochelatase Length = 2e-59
2hre_A359 Structure Of Human Ferrochelatase Variant E343k Wit 2e-59
2po5_A359 Crystal Structure Of Human Ferrochelatase Mutant Wi 7e-59
2pnj_A359 Crystal Structure Of Human Ferrochelatase Mutant Wi 1e-57
1l8x_A362 Crystal Structure Of Ferrochelatase From The Yeast, 7e-57
2c8j_A311 Crystal Structure Of Ferrochelatase Hemh-1 From Bac 1e-34
3goq_A310 Crystal Structure Of The Tyr13met Variant Of Bacill 2e-34
1doz_A309 Crystal Structure Of Ferrochelatase Length = 309 3e-34
1c1h_A310 Crystal Structure Of Bacillus Subtilis Ferrochelata 3e-34
2h1v_A310 Crystal Structure Of The Lys87ala Mutant Variant Of 4e-34
2ac2_A309 Crystal Structure Of The Tyr13phe Mutant Variant Of 4e-34
1c9e_A306 Structure Of Ferrochelatase With Copper(Ii) N- Meth 6e-34
2q3j_A309 Crystal Structure Of The His183ala Variant Of Bacil 6e-34
2h1w_A310 Crystal Structure Of The His183ala Mutant Variant O 7e-34
2ac4_A309 Crystal Structure Of The His183cys Mutant Variant O 1e-33
>gi|158429464|pdb|2PO7|A Chain A, Crystal Structure Of Human Ferrochelatase Mutant With His 341 Replaced By Cys Length = 359 Back     alignment and structure
 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 75/332 (22%), Positives = 150/332 (45%), Gaps = 12/332 (3%)

Query: 15  KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKI 74
           +  K G+L++N+G P+      +  +L    LD+ ++ LP    +  L  +I      KI
Sbjct: 1   RKPKTGILMLNMGGPETL--GDVHDFLLRLFLDQDLMTLP---IQNKLAPFIAKRLTPKI 55

Query: 75  KHAYAKIWNTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLRE 134
           +  Y +I   +  +             L +   + +        RY  P  +E I  +  
Sbjct: 56  QEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMER 115

Query: 135 EGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWSPSLRT--VPPYYEDSDYISALAQ 192
           +G +R + F  YPQYS +TTG++ + +++    +   P+++   +  +      I   A 
Sbjct: 116 DGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFAD 175

Query: 193 SIREHFESI---QWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRFK 249
            I +  +     + +  ++L S H +P+S + +GDPY      T + + E L +  + ++
Sbjct: 176 HILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEY-CNPYR 234

Query: 250 ICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKE-IFV 308
           + +QS+ G +  L P TD++++ L   G K++ ++   F+SDC+ET YE+  E  + +  
Sbjct: 235 LVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDCIETLYELDIEYSQVLAK 294

Query: 309 NGGGEKFTQVPCLNSSNLSIDLLEKITRRELM 340
             G E   +   LN + L    L  +    + 
Sbjct: 295 ECGVENIRRAESLNGNPLFSKALADLVHSHIQ 326


>gi|159795206|pdb|2QD3|A Chain A, Wild Type Human Ferrochelatase Crystallized With Ammonium Sulfate Length = 359 Back     alignment and structure
>gi|159795204|pdb|2QD2|A Chain A, F110a Variant Of Human Ferrochelatase With Protoheme Bound Length = 359 Back     alignment and structure
>gi|14719598|pdb|1HRK|A Chain A, Crystal Structure Of Human Ferrochelatase Length = 359 Back     alignment and structure
>gi|145579543|pdb|2HRE|A Chain A, Structure Of Human Ferrochelatase Variant E343k With Protoporphyrin Ix Bound Length = 359 Back     alignment and structure
>gi|158429462|pdb|2PO5|A Chain A, Crystal Structure Of Human Ferrochelatase Mutant With His 263 Replaced By Cys Length = 359 Back     alignment and structure
>gi|158429459|pdb|2PNJ|A Chain A, Crystal Structure Of Human Ferrochelatase Mutant With Phe 337 Replaced By Ala Length = 359 Back     alignment and structure
>gi|27065358|pdb|1L8X|A Chain A, Crystal Structure Of Ferrochelatase From The Yeast, Saccharomyces Cerevisiae, With Cobalt(Ii) As The Substrate Ion Length = 362 Back     alignment and structure
gi|146386403|pdb|2C8J|A Chain A, Crystal Structure Of Ferrochelatase Hemh-1 From Bacillus Anthracis, Str. Ames Length = 311 Back     alignment and structure
>gi|292659590|pdb|3GOQ|A Chain A, Crystal Structure Of The Tyr13met Variant Of Bacillus Subtilis Ferrochelatase Length = 310 Back     alignment and structure
>gi|6980657|pdb|1DOZ|A Chain A, Crystal Structure Of Ferrochelatase Length = 309 Back     alignment and structure
gi|7546509|pdb|1C1H|A Chain A, Crystal Structure Of Bacillus Subtilis Ferrochelatase In Complex With N-Methyl Mesoporphyrin Length = 310 Back     alignment and structure
>gi|126030591|pdb|2H1V|A Chain A, Crystal Structure Of The Lys87ala Mutant Variant Of Bacillus Subtilis Ferrochelatase Length = 310 Back     alignment and structure
>gi|78101292|pdb|2AC2|A Chain A, Crystal Structure Of The Tyr13phe Mutant Variant Of Bacillus Subtilis Ferrochelatase With Zn(2+) Bound At The Active Site Length = 309 Back     alignment and structure
>gi|7546417|pdb|1C9E|A Chain A, Structure Of Ferrochelatase With Copper(Ii) N- Methylmesoporphyrin Complex Bound At The Active Site Length = 306 Back     alignment and structure
>gi|185177562|pdb|2Q3J|A Chain A, Crystal Structure Of The His183ala Variant Of Bacillus Subtilis Ferrochelatase In Complex With N-Methyl Mesoporphyrin Length = 309 Back     alignment and structure
>gi|126030592|pdb|2H1W|A Chain A, Crystal Structure Of The His183ala Mutant Variant Of Bacillus Subtilis Ferrochelatase Length = 310 Back     alignment and structure
>gi|78101294|pdb|2AC4|A Chain A, Crystal Structure Of The His183cys Mutant Variant Of Bacillus Subtilis Ferrochelatase Length = 309 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
1lbq_A362 Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A { 6e-79
3hcn_A359 Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2 3e-65
2h1v_A310 Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {B 6e-57
2jh3_A 474 Ribosomal protein S2-related protein; CBIX, SAD phasing 9e-16
1qgo_A264 CBIK protein, anaerobic cobalamine biosynthetic cobalt 3e-11
>1lbq_A Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} SCOP: c.92.1.1 PDB: 1l8x_A Length = 362 Back     alignment and structure
 Score =  289 bits (741), Expect = 6e-79
 Identities = 75/337 (22%), Positives = 147/337 (43%), Gaps = 20/337 (5%)

Query: 15  KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKI 74
           K    G++L+N+G P   +      +L +   D  ++ + +  ++  +  YI  FR  KI
Sbjct: 4   KRSPTGIVLMNMGGPSKVE--ETYDFLYQLFADNDLIPISAK-YQKTIAKYIAKFRTPKI 60

Query: 75  KHAYAKIWNTAKNESILRTHTRDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIIN 130
           +  Y +I       S +R  +  QAT + K L+      +      A RY KP   E   
Sbjct: 61  EKQYREIGG----GSPIRKWSEYQATEVCKILDKTCPETAPHKPYVAFRYAKPLTAETYK 116

Query: 131 NLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQEL--IHMRWSPSLRTVPPYYEDSDYIS 188
            + ++G  + + F  YP +S +TTG++ +++++++  +    S S   +  +  +   I 
Sbjct: 117 QMLKDGVKKAVAFSQYPHFSYSTTGSSINELWRQIKALDSERSISWSVIDRWPTNEGLIK 176

Query: 189 ALAQSIREHFESI---QWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPD 245
           A +++I +  +          +LL S H +P+  +  GD Y      T   + + L +  
Sbjct: 177 AFSENITKKLQEFPQPVRDKVVLLFSAHSLPMDVVNTGDAYPAEVAATVYNIMQKLKFK- 235

Query: 246 DRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKE 305
           + +++ +QS+ G    L   T +  E L    +  L  I   F+SD +ET +EI      
Sbjct: 236 NPYRLVWQSQVGPKPWLGAQTAEIAEFLG-PKVDGLMFIPIAFTSDHIETLHEIDLGV-- 292

Query: 306 IFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGW 342
           I  +   +KF +   LN +   I+ +  + +  L   
Sbjct: 293 IGESEYKDKFKRCESLNGNQTFIEGMADLVKSHLQSN 329


>3hcn_A Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Length = 359 Back     alignment and structure
>2h1v_A Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A Length = 310 Back     alignment and structure
>2jh3_A Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans} Length = 474 Back     alignment and structure
>1qgo_A CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} SCOP: c.92.1.2 Length = 264 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
1lbq_A362 Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A { 100.0
3hcn_A359 Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2 100.0
2h1v_A310 Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {B 100.0
1qgo_A264 CBIK protein, anaerobic cobalamine biosynthetic cobalt 99.79
2jh3_A 474 Ribosomal protein S2-related protein; CBIX, SAD phasing 98.56
2prs_A284 High-affinity zinc uptake system protein ZNUA; protein 91.81
3lyh_A126 Cobalamin (vitamin B12) biosynthesis CBIX protein; stru 98.79
2h1v_A 310 Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {B 97.64
1tjn_A156 Sirohydrochlorin cobaltochelatase; AF0721, APC5049, mid 96.92
3lyh_A126 Cobalamin (vitamin B12) biosynthesis CBIX protein; stru 98.3
3hcn_A359 Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2 97.73
1qgo_A264 CBIK protein, anaerobic cobalamine biosynthetic cobalt 97.66
2jh3_A474 Ribosomal protein S2-related protein; CBIX, SAD phasing 95.5
1tjn_A156 Sirohydrochlorin cobaltochelatase; AF0721, APC5049, mid 93.91
1lbq_A 362 Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A { 97.91
>1lbq_A Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} SCOP: c.92.1.1 PDB: 1l8x_A Back     alignment and structure
Probab=100.00  E-value=0  Score=709.66  Aligned_cols=317  Identities=23%  Similarity=0.379  Sum_probs=293.5

Q ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             77867999971788899998899999998748954411786888998766651257478899999870778874045777
Q gi|254780200|r   15 KFGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTH   94 (343)
Q Consensus        15 ~~~K~gvLL~n~G~P~~~~~~~V~~yL~~fl~D~~Vi~~p~~~~~~il~~~I~~~R~~~~~~~Y~~Iw~~~gg~SPL~~~   94 (343)
                      .++||||||||||||++++  ||++||++||+|++||++|.++|++ |+++|+++|+++++++|++||    |+|||+.+
T Consensus         4 ~~~~tgvLL~nlGtP~~~~--~V~~yL~~~l~D~~Vi~~p~~~~~~-l~~~I~~~R~~k~~~~Y~~ig----ggSPL~~~   76 (362)
T 1lbq_A            4 KRSPTGIVLMNMGGPSKVE--ETYDFLYQLFADNDLIPISAKYQKT-IAKYIAKFRTPKIEKQYREIG----GGSPIRKW   76 (362)
T ss_dssp             -CCCEEEEEEECCCCSSGG--GHHHHHHHHTTCCSSSCCCSSSHHH-HHHHHHHHHHHHHHHHHHHTT----SSCSHHHH
T ss_pred             CCCCEEEEEEECCCCCCHH--HHHHHHHHHCCCCCCCCCCHHHHHH-HHHHCCCCCCHHHHHHHHHCC----CCCCCHHH
T ss_conf             7797699998789989878--9999999974798634687899999-864217568799999999818----98812999


Q ss_pred             HHHHHHHHHHHHHCC----CCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             599999999865224----7843001121045424789999987099658996317111001468999999999987179
Q gi|254780200|r   95 TRDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRW  170 (343)
Q Consensus        95 t~~qa~~L~~~L~~~----~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~  170 (343)
                      |+.|+++|++.|++.    .++.|++|||||+|+|++++++|+++|+++|+++|||||||++||||+++++.+++++...
T Consensus        77 T~~qa~~l~~~L~~~~~~~~~~~V~~amry~~P~i~~~l~~l~~~G~~~ii~lPlyPqyS~sTt~s~~~~~~~~l~~~~~  156 (362)
T 1lbq_A           77 SEYQATEVCKILDKTCPETAPHKPYVAFRYAKPLTAETYKQMLKDGVKKAVAFSQYPHFSYSTTGSSINELWRQIKALDS  156 (362)
T ss_dssp             HHHHHHHHHHHHHHHCGGGCCEEEEEEESSSSSCHHHHHHHHHTTTCCEEEEEESCSSCCTTTHHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHCCCHHHHHHHHHHHHHHHHCC
T ss_conf             99999999987510124576752588733799737789999986598548998676032205223799999999987502


Q ss_pred             C--CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC---CCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9--86421334557800689999999999973389---986699983367502676279988899999999999726675
Q gi|254780200|r  171 S--PSLRTVPPYYEDSDYISALAQSIREHFESIQW---TPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPD  245 (343)
Q Consensus       171 ~--~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~---~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~  245 (343)
                      .  +++++|++||+||.||++++++|++++++.+.   ++++|||||||||++++++||||..||.+|+++|+++|+++ 
T Consensus       157 ~~~~~~~~I~~~~~~p~yI~a~a~~i~~~l~~~~~~~~~~~~llFS~HglP~~~~~~GdpY~~q~~~t~~~i~~~l~~~-  235 (362)
T 1lbq_A          157 ERSISWSVIDRWPTNEGLIKAFSENITKKLQEFPQPVRDKVVLLFSAHSLPMDVVNTGDAYPAEVAATVYNIMQKLKFK-  235 (362)
T ss_dssp             TCCSEEEEECCCTTCHHHHHHHHHHHHHHHHTSCSTTGGGCEEEEEEECCBHHHHTTTCSHHHHHHHHHHHHHHHTTTC-
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHCCCC-
T ss_conf             5663036734644437899999999999999766544677579997057740001378977899999999999972898-


Q ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             67047862257776544302689999899769983999744054221255888758999999975997589816898798
Q gi|254780200|r  246 DRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSN  325 (343)
Q Consensus       246 ~~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~  325 (343)
                      ++|.++||||+||++||+|+|+++++.|+ +|+|+|+|+||||++||+|||||||+|+++.  +.||++|.||||||+||
T Consensus       236 ~~~~l~fQSr~g~~~WL~P~t~~~le~l~-~g~k~v~vvp~gFvsD~lETL~Eidie~~~~--~~~g~~f~~vp~lN~~p  312 (362)
T 1lbq_A          236 NPYRLVWQSQVGPKPWLGAQTAEIAEFLG-PKVDGLMFIPIAFTSDHIETLHEIDLGVIGE--SEYKDKFKRCESLNGNQ  312 (362)
T ss_dssp             SCEEEEEECCCSSSCBCSCBHHHHHHHHG-GGCSCEEEECTTCSSCCHHHHTCCCCCCCTT--CTTGGGEEECCCCTTCH
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHH-CCCCEEEEECCCCCCCCHHHHHHHHHHHHHH--HHCCCEEEECCCCCCCH
T ss_conf             76258996478999999970799999986-3997499988876432443299887679999--80897399878998999


Q ss_pred             HHHHHHHHHHHHHHCCC
Q ss_conf             99999999999984288
Q gi|254780200|r  326 LSIDLLEKITRRELMGW  342 (343)
Q Consensus       326 ~fi~~La~lv~~~l~gw  342 (343)
                      .||++|+++|+++|+.+
T Consensus       313 ~fi~~La~lv~~~l~~~  329 (362)
T 1lbq_A          313 TFIEGMADLVKSHLQSN  329 (362)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             99999999999987357



>3hcn_A Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Back     alignment and structure
>2h1v_A Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 3goq_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A Back     alignment and structure
>1qgo_A CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} SCOP: c.92.1.2 Back     alignment and structure
>2jh3_A Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans} Back     alignment and structure
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure
>3lyh_A Cobalamin (vitamin B12) biosynthesis CBIX protein; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Marinobacter aquaeolei} Back     alignment and structure
>2h1v_A Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 3goq_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A Back     alignment and structure
>1tjn_A Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus} SCOP: c.92.1.3 PDB: 2dj5_A Back     alignment and structure
>3lyh_A Cobalamin (vitamin B12) biosynthesis CBIX protein; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Marinobacter aquaeolei} Back     alignment and structure
>3hcn_A Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Back     alignment and structure
>1qgo_A CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} SCOP: c.92.1.2 Back     alignment and structure
>2jh3_A Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans} Back     alignment and structure
>1tjn_A Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus} SCOP: c.92.1.3 PDB: 2dj5_A Back     alignment and structure
>1lbq_A Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} SCOP: c.92.1.1 PDB: 1l8x_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 343 ferrochelatase [Candidatus Liberibacter asiaticus str.
d2hrca1359 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens 4e-65
d1lbqa_356 c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomy 2e-63
d2hk6a1309 c.92.1.1 (A:2-310) Ferrochelatase {Bacillus subtilis [T 3e-56
d1qgoa_257 c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimu 2e-13
>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Chelatase-like
superfamily: Chelatase
family: Ferrochelatase
domain: Ferrochelatase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  242 bits (617), Expect = 4e-65
 Identities = 79/335 (23%), Positives = 150/335 (44%), Gaps = 20/335 (5%)

Query: 18  KIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHA 77
           K G+L++N+G P+      +  +L    LD+ ++ LP    +  L  +I      KI+  
Sbjct: 4   KTGILMLNMGGPETLG--DVHDFLLRLFLDRDLMTLP---IQNKLAPFIAKRLTPKIQEQ 58

Query: 78  YAKIWNTAKNESILRTHTRDQATNLAKRLESISS----IVVDWAMRYGKPSVKEIINNLR 133
           Y +I       S ++  T  Q   + K L+ +S            RY  P  +E I  + 
Sbjct: 59  YRRIG----GGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEME 114

Query: 134 EEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMR--WSPSLRTVPPYYEDSDYISALA 191
            +G +R + F  YPQYS +TTG++ + +++    +    +    T+  +      I   A
Sbjct: 115 RDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFA 174

Query: 192 QSIREHFESIQW---TPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDDRF 248
             I +  +       +  ++L S H +P+S + +GDPY      T + + E L +  + +
Sbjct: 175 DHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEY-CNPY 233

Query: 249 KICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFV 308
           ++ +QS+ G +  L P TD++++ L   G K++ ++   F+SD +ET YE+  E  ++  
Sbjct: 234 RLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLA 293

Query: 309 -NGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGW 342
              G E   +   LN + L    L  +    +   
Sbjct: 294 KECGVENIRRAESLNGNPLFSKALADLVHSHIQSN 328


>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 356 Back     information, alignment and structure
>d2hk6a1 c.92.1.1 (A:2-310) Ferrochelatase {Bacillus subtilis [TaxId: 1423]} Length = 309 Back     information, alignment and structure
>d1qgoa_ c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 90371]} Length = 257 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
d1lbqa_356 Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae 100.0
d2hrca1359 Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2hk6a1309 Ferrochelatase {Bacillus subtilis [TaxId: 1423]} 100.0
d1qgoa_257 Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 9 99.79
d2hk6a1 309 Ferrochelatase {Bacillus subtilis [TaxId: 1423]} 97.95
d1tjna_125 Sirohydrochlorin cobaltochelatase CbiX {Archaeon Archae 96.67
d2hrca1359 Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1qgoa_257 Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 9 97.62
d1tjna_125 Sirohydrochlorin cobaltochelatase CbiX {Archaeon Archae 93.99
d1lbqa_ 356 Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae 97.82
>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Chelatase-like
superfamily: Chelatase
family: Ferrochelatase
domain: Ferrochelatase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=0  Score=715.40  Aligned_cols=316  Identities=23%  Similarity=0.376  Sum_probs=293.1

Q ss_pred             CCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHH
Q ss_conf             78679999717888999988999999987489544117868889987666512574788999998707788740457775
Q gi|254780200|r   16 FGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHT   95 (343)
Q Consensus        16 ~~K~gvLL~n~G~P~~~~~~~V~~yL~~fl~D~~Vi~~p~~~~~~il~~~I~~~R~~~~~~~Y~~Iw~~~gg~SPL~~~t   95 (343)
                      ++||||||+|||||++++  ||++||++||+|++||++|+++|+ +|+++|+++|+++++++|++||    |||||+.+|
T Consensus         1 k~~tgVLL~nlGtP~s~~--~V~~yL~~fl~D~~vi~~p~~~~~-~l~~~I~~~R~~k~a~~Y~~Ig----ggSPL~~~t   73 (356)
T d1lbqa_           1 RSPTGIVLMNMGGPSKVE--ETYDFLYQLFADNDLIPISAKYQK-TIAKYIAKFRTPKIEKQYREIG----GGSPIRKWS   73 (356)
T ss_dssp             CCCEEEEEEECCCCSSGG--GHHHHHHHHTTCCSSSCCCSSSHH-HHHHHHHHHHHHHHHHHHHHTT----SSCSHHHHH
T ss_pred             CCCEEEEEEECCCCCCHH--HHHHHHHHHCCCCCCCCCCHHHHH-HHHHHCCCCCCHHHHHHHHHCC----CCCHHHHHH
T ss_conf             996599998788999868--999999997589864468788999-9865647568799999999818----988108999


Q ss_pred             HHHHHHHHHHHHCC----CCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999865224----78430011210454247899999870996589963171110014689999999999871799
Q gi|254780200|r   96 RDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWS  171 (343)
Q Consensus        96 ~~qa~~L~~~L~~~----~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~  171 (343)
                      +.|+++|++.|++.    .++.|++|||||+|+|++++++|+++||++|+++|||||||++||||+++++.+++++.++.
T Consensus        74 ~~qa~~l~~~L~~~~~~~~~~~V~~amry~~P~i~~~l~~l~~~G~~~ilvlPlyPqyS~sTt~s~~~~v~~~l~~~~~~  153 (356)
T d1lbqa_          74 EYQATEVCKILDKTCPETAPHKPYVAFRYAKPLTAETYKQMLKDGVKKAVAFSQYPHFSYSTTGSSINELWRQIKALDSE  153 (356)
T ss_dssp             HHHHHHHHHHHHHHCGGGCCEEEEEEESSSSSCHHHHHHHHHTTTCCEEEEEESCSSCCTTTHHHHHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99899999885023343577216887314632088899999857986437884423442788889999999998875010


Q ss_pred             --CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC---CCCEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             --86421334557800689999999999973389---9866999833675026762799888999999999997266756
Q gi|254780200|r  172 --PSLRTVPPYYEDSDYISALAQSIREHFESIQW---TPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKEFLSWPDD  246 (343)
Q Consensus       172 --~~~~~I~~~~~~p~yI~a~~~~I~~~l~~~~~---~~~~llfSaHglP~~~~~~gDpY~~q~~~t~~~i~~~l~~~~~  246 (343)
                        +.+++|++||+||.||++++++|+++++..+.   +.++|||||||||++++++||||..||.+|+++++++|++. +
T Consensus       154 ~~~~~~~I~~~~~~p~yI~a~a~~i~~~l~~~~~~~~~~~~LlfS~HgiP~~~~~~gdpY~~q~~~t~~~v~~~l~~~-~  232 (356)
T d1lbqa_         154 RSISWSVIDRWPTNEGLIKAFSENITKKLQEFPQPVRDKVVLLFSAHSLPMDVVNTGDAYPAEVAATVYNIMQKLKFK-N  232 (356)
T ss_dssp             CCSEEEEECCCTTCHHHHHHHHHHHHHHHHTSCSTTGGGCEEEEEEECCBHHHHTTTCSHHHHHHHHHHHHHHHTTTC-S
T ss_pred             CCCCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCHHHCCCCCHHHHHHHHHHHHHHCCCC-C
T ss_conf             256642644644312279999999999999767544567379995477653333327874689999999876430566-6


Q ss_pred             CCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             70478622577765443026899998997699839997440542212558887589999999759975898168987989
Q gi|254780200|r  247 RFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNL  326 (343)
Q Consensus       247 ~~~l~fQSr~Gp~~WL~P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~lN~~~~  326 (343)
                      +|.++||||+||++||+|+|+++++.++ +|+++|+|+||||++||+|||||||+|+++.  ++||++|.|+|||||||.
T Consensus       233 ~~~~~fQSr~g~~~WL~P~t~~~le~l~-~g~k~v~v~p~gFvsD~lETL~Eidie~~~~--~~gg~~f~~vp~lN~~p~  309 (356)
T d1lbqa_         233 PYRLVWQSQVGPKPWLGAQTAEIAEFLG-PKVDGLMFIPIAFTSDHIETLHEIDLGVIGE--SEYKDKFKRCESLNGNQT  309 (356)
T ss_dssp             CEEEEEECCCSSSCBCSCBHHHHHHHHG-GGCSCEEEECTTCSSCCHHHHTCCCCCCCTT--CTTGGGEEECCCCTTCHH
T ss_pred             CEEEEEECCCCCCCCCCCCHHHHHHHHC-CCCCEEEEECCCCCCCCHHHHHHHHHHHHHH--HHCCCEEEECCCCCCCHH
T ss_conf             4577764045677777875599999840-4897489988852422344498877779999--718874998689989989


Q ss_pred             HHHHHHHHHHHHHCCC
Q ss_conf             9999999999984288
Q gi|254780200|r  327 SIDLLEKITRRELMGW  342 (343)
Q Consensus       327 fi~~La~lv~~~l~gw  342 (343)
                      ||++|+++|+++|++|
T Consensus       310 fi~~La~lV~~~l~~~  325 (356)
T d1lbqa_         310 FIEGMADLVKSHLQSN  325 (356)
T ss_dssp             HHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHCCC
T ss_conf             9999999999986568



>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hk6a1 c.92.1.1 (A:2-310) Ferrochelatase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qgoa_ c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hk6a1 c.92.1.1 (A:2-310) Ferrochelatase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tjna_ c.92.1.3 (A:) Sirohydrochlorin cobaltochelatase CbiX {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgoa_ c.92.1.2 (A:) Cobalt chelatase CbiK {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tjna_ c.92.1.3 (A:) Sirohydrochlorin cobaltochelatase CbiX {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 343 ferrochelatase [Candidatus Liberibacter asiaticus
1lbq_A_170-331162 (A:170-331) Ferrochelatase; rossmann fold, PI-heli 2e-40
3hcn_A_165-307143 (A:165-307) Ferrochelatase, mitochondrial; metal s 2e-39
2h1v_A_149-290142 (A:149-290) Ferrochelatase; rossman fold, PI-helix 7e-36
1lbq_A_170-331162 (A:170-331) Ferrochelatase; rossmann fold, PI-heli 1e-04
3hcn_A_1-164_308-359216 (A:1-164,A:308-359) Ferrochelatase, mitochondrial; 4e-39
1lbq_A_1-169169 (A:1-169) Ferrochelatase; rossmann fold, PI-helix, 5e-39
2h1v_A_1-148_291-310168 (A:1-148,A:291-310) Ferrochelatase; rossman fold, 4e-34
>1lbq_A (A:170-331) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae}Length = 162 Back     alignment and structure
 Score =  160 bits (407), Expect = 2e-40
 Identities = 35/163 (21%), Positives = 66/163 (40%), Gaps = 7/163 (4%)

Query: 183 DSDYISALAQSIREHFESI---QWTPEMLLVSFHQMPVSYLLKGDPYGCHCHKTARLLKE 239
           +   I A +++I +  +          +LL S H +P+  +  GD Y      T   + +
Sbjct: 2   NEGLIKAFSENITKKLQEFPQPVRDKVVLLFSAHSLPMDVVNTGDAYPAEVAATVYNIMQ 61

Query: 240 FLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEI 299
            L + +  +++ +QS+ G    L   T +  E L    +  L  I   F+SD +ET +EI
Sbjct: 62  KLKFKNP-YRLVWQSQVGPKPWLGAQTAEIAEFLGP-KVDGLMFIPIAFTSDHIETLHEI 119

Query: 300 AHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELMGW 342
                        +KF +   LN +   I+ +  + +  L   
Sbjct: 120 DLGVIGES--EYKDKFKRCESLNGNQTFIEGMADLVKSHLQSN 160


>3hcn_A (A:165-307) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A*Length = 143 Back     alignment and structure
>2h1v_A (A:149-290) Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_ALength = 142 Back     alignment and structure
>1lbq_A (A:170-331) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae}Length = 162 Back     alignment and structure
>3hcn_A (A:1-164,A:308-359) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A*Length = 216 Back     alignment and structure
>1lbq_A (A:1-169) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae}Length = 169 Back     alignment and structure
>2h1v_A (A:1-148,A:291-310) Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_ALength = 168 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 ferrochelatase [Candidatus Liberibacter asiaticus str.
3hcn_A_1-164_308-359216 Ferrochelatase, mitochondrial; metal selectivity, 100.0
1lbq_A_1-169169 Ferrochelatase; rossmann fold, PI-helix, lyase; 2. 100.0
2h1v_A_1-148_291-310168 Ferrochelatase; rossman fold, PI-helix, lyase; 1.2 100.0
1lbq_A_170-331162 Ferrochelatase; rossmann fold, PI-helix, lyase; 2. 100.0
3hcn_A_165-307143 Ferrochelatase, mitochondrial; metal selectivity, 100.0
2h1v_A_149-290142 Ferrochelatase; rossman fold, PI-helix, lyase; 1.2 100.0
2jh3_A_118-249132 Ribosomal protein S2-related protein; CBIX, SAD ph 98.4
1lbq_A_1-169169 Ferrochelatase; rossmann fold, PI-helix, lyase; 2. 95.8
3hcn_A_1-164_308-359216 Ferrochelatase, mitochondrial; metal selectivity, 98.6
2h1v_A_1-148_291-310168 Ferrochelatase; rossman fold, PI-helix, lyase; 1.2 97.92
1qgo_A_1-132_239-264158 CBIK protein, anaerobic cobalamine biosynthetic co 94.6
1lbq_A_170-331162 Ferrochelatase; rossmann fold, PI-helix, lyase; 2. 97.68
3hcn_A_165-307143 Ferrochelatase, mitochondrial; metal selectivity, 94.78
1qgo_A_133-238106 CBIK protein, anaerobic cobalamine biosynthetic co 97.02
1tjn_A_1-130130 Sirohydrochlorin cobaltochelatase; AF0721, APC5049 96.23
2jh3_A_118-249132 Ribosomal protein S2-related protein; CBIX, SAD ph 93.65
1qgo_A_1-132_239-264158 CBIK protein, anaerobic cobalamine biosynthetic co 94.98
1qgo_A_133-238106 CBIK protein, anaerobic cobalamine biosynthetic co 94.59
1tjn_A_1-130130 Sirohydrochlorin cobaltochelatase; AF0721, APC5049 93.66
>3hcn_A (A:1-164,A:308-359) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=348.93  Aligned_cols=178  Identities=26%  Similarity=0.484  Sum_probs=165.7

Q ss_pred             CCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHH
Q ss_conf             78679999717888999988999999987489544117868889987666512574788999998707788740457775
Q gi|254780200|r   16 FGKIGVLLVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHT   95 (343)
Q Consensus        16 ~~K~gvLL~n~G~P~~~~~~~V~~yL~~fl~D~~Vi~~p~~~~~~il~~~I~~~R~~~~~~~Y~~Iw~~~gg~SPL~~~t   95 (343)
                      ++|+||||+|||||++++  ||++||.+||+|++||++|   |+++|+++|+++|+++++++|++|    ||+|||+.+|
T Consensus         2 k~k~aVLLlN~GgP~t~e--dV~~fL~~lf~D~~ii~~p---~q~~L~~~Ia~~R~~k~~~~Y~~I----GG~SPL~~~T   72 (216)
T 3hcn_A            2 KPKTGILMLNMGGPETLG--DVHDFLLRLFLDRDLMTLP---IQNKLAPFIAKRRTPKIQEQYRRI----GGGSPIKIWT   72 (216)
T ss_dssp             CCCEEEEEEECCCCSSGG--GHHHHHHHHHTCTTTCCCT---THHHHHHHHHHHHHHHHHHHHHHT----TSSCCHHHHH
T ss_pred             CCCEEEEEEECCCCCCHH--HHHHHHHHHCCCCCCCCCC---HHHHHHHHHCCCCHHHHHHHHHHC----CCCCHHHHHH
T ss_conf             986699998479999878--9999999982799722043---788776660365609999999973----8998269999


Q ss_pred             HHHHHHHHHHHHCC----CCCCCHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999865224----78430011210454247899999870996589963171110014689999999999871799
Q gi|254780200|r   96 RDQATNLAKRLESI----SSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQELIHMRWS  171 (343)
Q Consensus        96 ~~qa~~L~~~L~~~----~~~~V~~amry~~P~i~~~l~~l~~~g~~~ii~lPLyPqyS~sTtgS~~~~~~~~l~~~~~~  171 (343)
                      +.|+++|++.|++.    .++.|++|||||+|+++|++++|+++|++++|++|||||||++||||+++.+++++.+.+..
T Consensus        73 ~~Q~~~L~~~L~~~~~e~~~~~v~~amRY~~P~iee~i~ql~~dg~~~iI~lplyPqyS~sTtgSs~~~l~~~~~~~~~~  152 (216)
T 3hcn_A           73 SKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRK  152 (216)
T ss_dssp             HHHHHHHHHHHHHHCGGGCSEEEEEEESSSSSBHHHHHHHHHHTTCSEEEEEESCSSCCTTTHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHCHHHHHHHHHHHHHCCC
T ss_conf             99999999898652477765489985253652169999999865985421124654123423221578999999985100


Q ss_pred             CC--CCCCCCC-CCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             86--4213345-5780068999999999997338
Q gi|254780200|r  172 PS--LRTVPPY-YEDSDYISALAQSIREHFESIQ  202 (343)
Q Consensus       172 ~~--~~~I~~~-~~~p~yI~a~~~~I~~~l~~~~  202 (343)
                      +.  +.+|++| .+||.||+|+++.+.+||+...
T Consensus       153 ~~~~~~~I~~~yn~~~~f~~~l~d~~~~~l~~~~  186 (216)
T 3hcn_A          153 PTMKWSTIDRWPNGNPLFSKALADLVHSHIQSNE  186 (216)
T ss_dssp             CSSEEEEECCCTTTCHHHHHHHHHHHHHHHHHTC
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             0356643356679998999999999999964798



>1lbq_A (A:1-169) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2h1v_A (A:1-148,A:291-310) Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A Back     alignment and structure
>1lbq_A (A:170-331) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hcn_A (A:165-307) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Back     alignment and structure
>2h1v_A (A:149-290) Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A Back     alignment and structure
>2jh3_A (A:118-249) Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans} Back     alignment and structure
>1lbq_A (A:1-169) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hcn_A (A:1-164,A:308-359) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Back     alignment and structure
>2h1v_A (A:1-148,A:291-310) Ferrochelatase; rossman fold, PI-helix, lyase; 1.20A {Bacillus subtilis} PDB: 2hk6_A 1c1h_A* 1ld3_A 1n0i_A 1ak1_A 1doz_A 2q2n_A* 2h1w_A 2ac2_A 2q3j_A* 2ac4_A 2q2o_A* 1c9e_A* 2c8j_A Back     alignment and structure
>1qgo_A (A:1-132,A:239-264) CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} Back     alignment and structure
>1lbq_A (A:170-331) Ferrochelatase; rossmann fold, PI-helix, lyase; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hcn_A (A:165-307) Ferrochelatase, mitochondrial; metal selectivity, 2Fe-2S, disease mutation, heme biosynthesis, iron, iron-sulfur, lyase, membrane, metal-binding; HET: CHD HEM GOL; 1.60A {Homo sapiens} PDB: 2qd3_A* 2qd5_A* 2qd4_A* 3hco_A* 3hcr_A* 2qd1_A* 2hre_A* 3hcp_A* 2qd2_A* 2hrc_A* 1hrk_A* 2pnj_A* 2po5_A* 2po7_A* Back     alignment and structure
>1qgo_A (A:133-238) CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} Back     alignment and structure
>1tjn_A (A:1-130) Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus} Back     alignment and structure
>2jh3_A (A:118-249) Ribosomal protein S2-related protein; CBIX, SAD phasing, structural genomics, chelatase super-family fold, 4Fe-4S iron-sulphur cluster; 1.9A {Deinococcus radiodurans} Back     alignment and structure
>1qgo_A (A:1-132,A:239-264) CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} Back     alignment and structure
>1qgo_A (A:133-238) CBIK protein, anaerobic cobalamine biosynthetic cobalt chelatase; vitamin B12, metal ION chelation, cobalt precorrin; 2.40A {Salmonella typhimurium LT2} Back     alignment and structure
>1tjn_A (A:1-130) Sirohydrochlorin cobaltochelatase; AF0721, APC5049, midwest consortium for structural genomics, protein structure initiative, A. fulgidus; 2.01A {Archaeoglobus fulgidus} Back     alignment and structure