254780201

254780201

hypothetical protein CLIBASIA_00430

GeneID in NCBI database:8209182Locus tag:CLIBASIA_00430
Protein GI in NCBI database:254780201Protein Accession:YP_003064614.1
Gene range:-(91430, 92614)Protein Length:394aa
Gene description:hypothetical protein
COG prediction:[M] Lipopolysaccharide biosynthesis protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP4 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
ccEEEEHHHHHccHHHEEEEEEccccccEEEEEEEcccccEEEEEEEcHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEEcHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHcccccEEEEEcccccHHHHHHHHHcccccccccEEEEEccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcc
ccEEEEEEcHccHHHHHHHEEccccccccEEEEEEccccEEEEEEEccccccEccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHHHcccccccccccccEEEHcccccccccccccccccccccccEEEEEEEEcHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccHHccccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHc
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLwsfspkqritskdvhfqELSIFESFIFWLRSFLAFSkysklsfpscriffygSRKEQKAFLRLNrfmsnsrmpfdsekFLYVKELFegwndrpsspkksgltiksKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMenkgrdvrpFLYLLELGVFDRYDYLCkihgkksqregyhpiegiIWRRWLFFDLLGFSDIAIRIINTfeqnpclgmigsrryrryKRWSFFAKRSEVYRRVIDLAKragfptkrlhldffngtmfwvkpkcleplrnlhligefeeernlkdGALEHAVERFFACSvrytefsieSVDCVAEYERLLH
mykvfrlksklgkienLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEgwndrpsspkksgltikskIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIhgkksqregyhPIEGIIWRRWLFFDLLGFSDIAIRIINtfeqnpclgmigsrryrryKRWSffakrsevyRRVIDLAkragfptkrlhLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
**KVFR*KSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWND***************IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCV********
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWND*********LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target394 hypothetical protein CLIBASIA_00430 [Candidatus Liberib
254780923365 hypothetical protein CLIBASIA_04110 [Candidatus Li 8e-74
>gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] Length = 365 Back     alignment
 Score =  268 bits (686), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 212/356 (59%), Gaps = 4/356 (1%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           GY++  S        S   + ++++++  F FW  + L + +  KL +    +  YGSR 
Sbjct: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENYVVAYGSRS 67

Query: 100 EQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159
            +K F + N +M    + FD ++  +  +L  GW + P+  K   + IK+KIAIVVH YY
Sbjct: 68  GKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYY 126

Query: 160 QDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYL 219
            D WIEI+++L  L+  FDL VT+V  +   + ++LK FP+A++++MEN GRDV PFL L
Sbjct: 127 IDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLIL 186

Query: 220 LELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPC 279
           LE      YDY+CKIHGKKS+R+GY   EG +WRRWLF+DLLG   +  +II TF+ +  
Sbjct: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRD 246

Query: 280 LGMIGSRRYRRYKRWSFFAKRSEVYRRVI-DLAKRAGFPTKRLHLDFFNGTMFWVKPKCL 338
           +GMIGSR YR   ++  +       R +I  LA R G   +   LDFF GTMFWV+ + L
Sbjct: 247 IGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEAL 306

Query: 339 EPLRNLHLIGEFEEE-RNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLL 393
           +P++NL L   FE +     DG +EHAVER F+ SV+   F I  VDC+  Y + L
Sbjct: 307 DPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSL 362

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target394 hypothetical protein CLIBASIA_00430 [Candidatus Liberib
315122628399 hypothetical protein CKC_04400 [Candidatus Liberibacter 1 1e-171
315122651405 hypothetical protein CKC_04515 [Candidatus Liberibacter 1 3e-78
254780923365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib 1 8e-70
13474020386 hypothetical protein mll4799 [Mesorhizobium loti MAFF30 1 5e-43
299133415408 Rhamnan synthesis F [Afipia sp. 1NLS2] Length = 408 1 5e-36
218455307568 WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 1 6e-27
218455296568 glycosyltransferase [Xanthomonas oryzae pv. oryzicola] 1 6e-27
166713474568 hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv 1 6e-27
218455303568 WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 1 6e-27
218455305568 WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 1 9e-27
>gi|315122628|ref|YP_004063117.1| hypothetical protein CKC_04400 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 399 Back     alignment and organism information
 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/390 (73%), Positives = 335/390 (85%)

Query: 3   KVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQE 62
           K+FRLK K   +E L+ RLDVE KG++  +YIPA++SGYY+LWS S +Q+ITS+DV F+E
Sbjct: 8   KIFRLKIKSETLEKLVFRLDVENKGSVNTLYIPANISGYYMLWSLSKEQKITSEDVFFEE 67

Query: 63  LSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEK 122
           ++ F++ +FWLRSFL FSKYS+LSFPSCRIFFYGSRK++KAF RLNRFMSNSRMPFD +K
Sbjct: 68  VTTFKACLFWLRSFLTFSKYSQLSFPSCRIFFYGSRKDKKAFFRLNRFMSNSRMPFDGKK 127

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT 182
           FLY+KELFEGW +  S   K  + I SKIAIVVHCYYQDTW EISH+LLRLNFDFDLF+T
Sbjct: 128 FLYIKELFEGWKNLSSLDNKGKIKINSKIAIVVHCYYQDTWDEISHLLLRLNFDFDLFIT 187

Query: 183 VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
            V+ NKDFEQDVLK FPSA+LYVMENKGRDV PFL LLELGVF  YDYLCKIHGKKS R 
Sbjct: 188 TVKKNKDFEQDVLKNFPSARLYVMENKGRDVLPFLCLLELGVFYDYDYLCKIHGKKSARR 247

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
            YHP EGI+WRRW+FFDLLGFSDIA+RIIN FEQNP +GMIGS R+RRYK++SFF KRS+
Sbjct: 248 NYHPFEGILWRRWIFFDLLGFSDIALRIINKFEQNPSIGMIGSGRFRRYKKYSFFKKRSK 307

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALE 362
           VY+RV+DLA+R  FP + L LDFFNGTMFWV+PKCLEPLRN+HL GEFEEE NL+DGALE
Sbjct: 308 VYKRVVDLARRIDFPVEELDLDFFNGTMFWVRPKCLEPLRNIHLTGEFEEECNLEDGALE 367

Query: 363 HAVERFFACSVRYTEFSIESVDCVAEYERL 392
           HAVERFF  SV+   FS+ESVDCVAEY++L
Sbjct: 368 HAVERFFPLSVQRAGFSLESVDCVAEYDQL 397


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122651|ref|YP_004063140.1| hypothetical protein CKC_04515 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 405 Back     alignment and organism information
>gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] Length = 365 Back     alignment and organism information
>gi|13474020|ref|NP_105588.1| hypothetical protein mll4799 [Mesorhizobium loti MAFF303099] Length = 386 Back     alignment and organism information
>gi|299133415|ref|ZP_07026610.1| Rhamnan synthesis F [Afipia sp. 1NLS2] Length = 408 Back     alignment and organism information
>gi|218455307|gb|AAX19610.2| WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information
>gi|218455296|gb|AAV67426.2| glycosyltransferase [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information
>gi|166713474|ref|ZP_02244681.1| hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 568 Back     alignment and organism information
>gi|218455303|gb|AAX19606.2| WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information
>gi|218455305|gb|AAX19608.2| WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target394 hypothetical protein CLIBASIA_00430 [Candidatus Liberib
pfam05045498 pfam05045, RgpF, Rhamnan synthesis protein F 2e-23
COG3754595 COG3754, RgpF, Lipopolysaccharide biosynthesis protein 2e-30
>gnl|CDD|113802 pfam05045, RgpF, Rhamnan synthesis protein F Back     alignment and domain information
>gnl|CDD|33549 COG3754, RgpF, Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 394 hypothetical protein CLIBASIA_00430 [Candidatus Liberib
pfam05045498 RgpF Rhamnan synthesis protein F. This family consists 100.0
COG3754595 RgpF Lipopolysaccharide biosynthesis protein [Cell enve 100.0
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the elong 97.15
cd06435236 CESA_NdvC_like NdvC_like proteins in this family are pu 96.14
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerization of 95.77
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongatio 93.91
cd02520196 Glucosylceramide_synthase Glucosylceramide synthase cat 91.52
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the biosynthe 91.24
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 90.36
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulose sy 90.2
COG3754595 RgpF Lipopolysaccharide biosynthesis protein [Cell enve 99.29
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-forming) 94.23
cd06423180 CESA_like CESA_like is the cellulose synthase superfami 93.13
>pfam05045 RgpF Rhamnan synthesis protein F Back     alignment and domain information
>COG3754 RgpF Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>COG3754 RgpF Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target394 hypothetical protein CLIBASIA_00430 [Candidatus Liberib
2z86_A_59-353295 Chondroitin synthase; GT-A, glycosyltransferase A, 91.85
>2z86_A (A:59-353) Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
Probab=91.85  E-value=0.88  Score=24.32  Aligned_cols=123  Identities=11%  Similarity=0.111  Sum_probs=84.1

Q ss_pred             CHHHHHHCCCCEEEEEEEC-CHHHHHHHHHHHHHCC--CCEEEEEECC--C-CHHHHHHHHHHCCCCCEEEEECCCCHHH
Q ss_conf             0110000014738999941-6778999999997089--9814999717--6-5289999997117873899945666047
Q gi|254780201|r  140 PKKSGLTIKSKIAIVVHCY-YQDTWIEISHILLRLN--FDFDLFVTVV--E-ANKDFEQDVLKYFPSAQLYVMENKGRDV  213 (394)
Q Consensus       140 ~~~~~~~~k~kIAVvlHly-Y~DLl~E~~~~L~~ip--~~~DL~ITt~--~-~~~~~~~~~~~~~~~a~V~vv~NRGRDI  213 (394)
                      .........++|+|++=.| -++.+.++++.+.+-.  ..+.++|--+  + ...++..+.....+...+...++.+.=-
T Consensus        26 ~~~~~~~~~p~isViIp~yN~~~~l~~~l~sl~~q~~~~~~eiivvDd~S~D~t~~~~~~~~~~~~~~~~~~~~~~~g~~  105 (295)
T 2z86_A           26 DYPRKQLIIDGLSIVIPTYNRAKILAITLACLCNQKTIYDYEVIVADDGSKENIEEIVREFESLLNIKYVRQKDYGYQLC  105 (295)
T ss_dssp             ------CCCCCEEEEEEESSCHHHHHHHHHHHHTCCCSSCEEEEEEEESCSSCHHHHHHTTTTTSCEEEEEECCCSCCHH
T ss_pred             CCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHCCCCCEEEEEECCCCCCHH
T ss_conf             58766686899899996379989999999999716999985999998989821899999751369969999689985789


Q ss_pred             HHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             99998622100278678999736877677776444078999999874799899999999976099768981687
Q gi|254780201|r  214 RPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR  287 (394)
Q Consensus       214 ~PfL~~~~~~~l~~YD~v~klHtKKS~~~~~~~~~G~~Wr~~Ll~~LLGs~~~v~~Il~~F~~~p~lGlv~p~~  287 (394)
                      ...-.++.   ..+.|+|+.+.+=-..                      .++.+..++..|..+|..+++++..
T Consensus       106 ~~~~~~~~---~a~~d~i~~lD~D~~~----------------------~~~~l~~~~~~~~~~~~~~~~~~~~  154 (295)
T 2z86_A          106 AVRNLGLR---AAKYNYVAILDCDMAP----------------------NPLWVQSYMELLAVDDNVALIGPRK  154 (295)
T ss_dssp             HHHHHHHH---HCCSSEEEEECTTEEE----------------------CTTHHHHHHHHHHHCTTEEEECCEE
T ss_pred             HHHHHHHH---HCCCCEEEEECCCCCC----------------------CHHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             99999999---7599989998897244----------------------8139999999998499859998777