254780202

254780202

hypothetical protein CLIBASIA_00435

GeneID in NCBI database:8209183Locus tag:CLIBASIA_00435
Protein GI in NCBI database:254780202Protein Accession:YP_003064615.1
Gene range:-(92663, 93298)Protein Length:211aa
Gene description:hypothetical protein
COG prediction:[O] Organic radical activating enzymes
KEGG prediction:hypothetical protein
SEED prediction:Queuosine Biosynthesis QueE Radical SAM
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Queuosine-Archaeosine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
cccccEEEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHcccEEEEEccccccccccccEEEEcccccccHHHHccccHHHHHccccccHHHHccccccEEEEccccccccHHHHHHHHHHHHHccccEEEEEEHHccccc
cccccHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHcccEEEEEEcccccccccccEEEEccccccccEEcccccEEEEcccccccHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccccEEEEHHHHEEccc
MKLYSIKEIFLTlqgegghaGRVAVFCRFsgcnlwsgreqdrlsaqcrfcdtdfvgiqgtkggrynVDQLADLIEEQWitgekegrycvltggepllqvdVPLIQALNKRGFEIAvetngtieppqgidwicvspkagcdlkikggqelklvfpqvnvspenyigfdferfslqpmdgpfleenTNLAISYcfqnpkwrlsvqthkfigir
MKLYSIKEIFLTlqgegghaGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDfvgiqgtkggryNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETngtieppqgiDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
*KLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR
MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
315122629211 hypothetical protein CKC_04405 [Candidatus Liberibacter 1 1e-99
92118709210 hypothetical protein Nham_3243 [Nitrobacter hamburgensi 1 1e-81
75676803210 hypothetical protein Nwi_2619 [Nitrobacter winogradskyi 1 2e-81
192289792210 hypothetical protein Rpal_1382 [Rhodopseudomonas palust 1 2e-80
85714274210 hypothetical protein NB311A_15022 [Nitrobacter sp. Nb-3 1 4e-80
39934265210 hypothetical protein RPA1190 [Rhodopseudomonas palustri 1 4e-80
91975780210 hypothetical protein RPD_1300 [Rhodopseudomonas palustr 1 4e-80
316932735210 Radical SAM domain-containing protein [Rhodopseudomonas 1 9e-80
86748323210 hypothetical protein RPB_1198 [Rhodopseudomonas palustr 1 2e-79
27377594210 hypothetical protein bll2483 [Bradyrhizobium japonicum 1 2e-78
>gi|315122629|ref|YP_004063118.1| hypothetical protein CKC_04405 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 211 Back     alignment and organism information
 Score =  366 bits (939), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/211 (81%), Positives = 188/211 (89%)

Query: 1   MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGT 60
           MKLYS+KEIFLTLQGEG   GRVAVFCRFSGCNLWSGRE+DRL AQCRFCDTDFVG +GT
Sbjct: 1   MKLYSVKEIFLTLQGEGAQVGRVAVFCRFSGCNLWSGREKDRLFAQCRFCDTDFVGTKGT 60

Query: 61  KGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLIQALNKRGFEIAVETNG 120
            GGRY+ +QLADLI   WI  EKE RYCVLTGGEPLLQVD  LI+ALNKR F I+VETNG
Sbjct: 61  MGGRYSAEQLADLIASAWIPEEKEERYCVLTGGEPLLQVDSALIKALNKRNFTISVETNG 120

Query: 121 TIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFERFSLQPMDGPF 180
           TI+PP+GIDWICVSPKAGCDLK+K GQELKLVFPQV+  PENYI FDF+ FSLQPMDG F
Sbjct: 121 TIKPPEGIDWICVSPKAGCDLKVKNGQELKLVFPQVDAPPENYIDFDFDIFSLQPMDGSF 180

Query: 181 LEENTNLAISYCFQNPKWRLSVQTHKFIGIR 211
           L+ENTNLAISYCF+NPKWR+S+QTHKFIGIR
Sbjct: 181 LKENTNLAISYCFKNPKWRVSLQTHKFIGIR 211


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|92118709|ref|YP_578438.1| hypothetical protein Nham_3243 [Nitrobacter hamburgensis X14] Length = 210 Back     alignment and organism information
>gi|75676803|ref|YP_319224.1| hypothetical protein Nwi_2619 [Nitrobacter winogradskyi Nb-255] Length = 210 Back     alignment and organism information
>gi|192289792|ref|YP_001990397.1| hypothetical protein Rpal_1382 [Rhodopseudomonas palustris TIE-1] Length = 210 Back     alignment and organism information
>gi|85714274|ref|ZP_01045262.1| hypothetical protein NB311A_15022 [Nitrobacter sp. Nb-311A] Length = 210 Back     alignment and organism information
>gi|39934265|ref|NP_946541.1| hypothetical protein RPA1190 [Rhodopseudomonas palustris CGA009] Length = 210 Back     alignment and organism information
>gi|91975780|ref|YP_568439.1| hypothetical protein RPD_1300 [Rhodopseudomonas palustris BisB5] Length = 210 Back     alignment and organism information
>gi|316932735|ref|YP_004107717.1| Radical SAM domain-containing protein [Rhodopseudomonas palustris DX-1] Length = 210 Back     alignment and organism information
>gi|86748323|ref|YP_484819.1| hypothetical protein RPB_1198 [Rhodopseudomonas palustris HaA2] Length = 210 Back     alignment and organism information
>gi|27377594|ref|NP_769123.1| hypothetical protein bll2483 [Bradyrhizobium japonicum USDA 110] Length = 210 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
TIGR03365238 TIGR03365, Bsubt_queE, 7-cyano-7-deazaguanosine (preQ0) 1e-08
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 1e-06
TIGR02495191 TIGR02495, NrdG2, anaerobic ribonucleoside-triphosphate 4e-05
COG1180260 COG1180, PflA, Pyruvate-formate lyase-activating enzyme 2e-04
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 6e-04
TIGR02493235 TIGR02493, PFLA, pyruvate formate-lyase 1-activating en 0.002
COG2896 322 COG2896, MoaA, Molybdenum cofactor biosynthesis enzyme 0.002
TIGR02494295 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating 0.002
COG0602212 COG0602, NrdG, Organic radical activating enzymes [Post 1e-33
>gnl|CDD|132408 TIGR03365, Bsubt_queE, 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|162888 TIGR02495, NrdG2, anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>gnl|CDD|31373 COG1180, PflA, Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|131546 TIGR02493, PFLA, pyruvate formate-lyase 1-activating enzyme Back     alignment and domain information
>gnl|CDD|32721 COG2896, MoaA, Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162887 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family Back     alignment and domain information
>gnl|CDD|30947 COG0602, NrdG, Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesi 100.0
COG0602212 NrdG Organic radical activating enzymes [Posttranslatio 100.0
TIGR02493243 PFLA pyruvate formate-lyase 1-activating enzyme; InterP 99.82
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; Provis 99.79
TIGR02495220 NrdG2 anaerobic ribonucleoside-triphosphate reductase a 99.71
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666 346 moaA molybdenum cofactor biosynthesis protein A; InterP 99.14
TIGR02668 324 moaA_archaeal probable molybdenum cofactor biosynthesis 99.08
COG2100 414 Predicted Fe-S oxidoreductase [General function predict 98.33
TIGR02494305 PFLE_PFLC glycyl-radical enzyme activating protein fami 99.66
PRK10076213 pyruvate formate lyase II activase; Provisional 99.22
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Posttran 99.53
PRK05301 375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 99.25
TIGR03470 318 HpnH hopanoid biosynthesis associated radical SAM prote 99.18
PRK13361 329 molybdenum cofactor biosynthesis protein A; Provisional 99.05
PRK00164 334 moaA molybdenum cofactor biosynthesis protein A; Review 99.05
COG2896 322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 98.97
PRK11121154 nrdG anaerobic ribonucleotide reductase-activating prot 98.86
PRK13758 370 anaerobic sulfatase-maturase; Provisional 98.56
COG0535 347 Predicted Fe-S oxidoreductases [General function predic 98.48
COG0641 378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [Gen 98.38
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 98.37
TIGR02109 363 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; Inter 98.36
PRK13745 412 anaerobic sulfatase-maturase; Provisional 98.22
TIGR02826165 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate r 98.17
COG5014228 Predicted Fe-S oxidoreductase [General function predict 98.12
COG2108 353 Uncharacterized conserved protein related to pyruvate f 97.98
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of this fa 97.93
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of pyru 97.73
COG0820349 Predicted Fe-S-cluster redox enzyme [General function p 97.13
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport and m 96.97
PRK11194372 hypothetical protein; Provisional 96.76
KOG2876 323 consensus 96.67
TIGR00048378 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR 96.57
TIGR01290 461 nifB nitrogenase cofactor biosynthesis protein NifB; In 96.23
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 94.89
TIGR02026 506 BchE magnesium-protoporphyrin IX monomethyl ester anaer 94.37
PRK09058 447 coproporphyrinogen III oxidase; Provisional 93.99
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 93.98
COG0635 416 HemN Coproporphyrinogen III oxidase and related Fe-S ox 93.31
TIGR01579492 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: 91.53
PRK08208 436 coproporphyrinogen III oxidase; Validated 91.39
PRK08207 497 coproporphyrinogen III oxidase; Provisional 90.92
PRK13347 453 coproporphyrinogen III oxidase; Provisional 90.88
TIGR00238357 TIGR00238 lysine 2,3-aminomutase YodO family protein; I 90.65
PRK06294 374 coproporphyrinogen III oxidase; Provisional 90.37
TIGR02491158 NrdG anaerobic ribonucleoside-triphosphate reductase ac 98.74
COG1060 370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 92.87
PRK06245 336 cofG FO synthase subunit 1; Reviewed 91.49
COG0731296 Fe-S oxidoreductases [Energy production and conversion] 98.23
COG1964 475 Predicted Fe-S oxidoreductases [General function predic 97.61
TIGR03278 404 methan_mark_10 putative methanogenesis marker protein 1 95.7
PRK05904 353 coproporphyrinogen III oxidase; Provisional 95.0
PRK08599 377 coproporphyrinogen III oxidase; Provisional 94.37
PRK09057 381 coproporphyrinogen III oxidase; Provisional 94.15
PRK08949 378 consensus 93.24
PRK05799 374 coproporphyrinogen III oxidase; Provisional 93.15
PRK05660 378 coproporphyrinogen III oxidase; Provisional 92.88
PRK08446 351 coproporphyrinogen III oxidase; Provisional 92.83
PRK06582 390 coproporphyrinogen III oxidase; Provisional 92.81
PRK07094 323 biotin synthase; Provisional 92.78
PRK08807 385 consensus 92.1
TIGR03551 343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 91.74
PRK08898 393 coproporphyrinogen III oxidase; Provisional 90.77
PRK05628 376 coproporphyrinogen III oxidase; Validated 90.65
PRK06256325 biotin synthase; Validated 90.21
PRK13762321 tRNA-modifying enzyme; Provisional 97.7
PRK07379 399 coproporphyrinogen III oxidase; Provisional 92.97
TIGR03550 322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 90.58
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme; InterPro: IPR012838 Members of this family are iron-sulphur proteins with a radical-SAM domain Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840 This enzyme is a member of the radical-SAM family Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO) Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>pfam04055 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843 This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR014191 Members of this entry represent a set of proteins related to, yet architecturally different from, the activating protein for the glycine radical-containing, oxygen-sensitive ribonucleoside-triphosphate reductase (RNR, see IPR012837 from INTERPRO) Back     alignment and domain information
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11194 hypothetical protein; Provisional Back     alignment and domain information
>KOG2876 consensus Back     alignment and domain information
>TIGR00048 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR004383 This family of conserved hypothetical proteins groups bacterial proteins of unknown function Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB; InterPro: IPR005980 NifB is a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772 This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00238 TIGR00238 lysine 2,3-aminomutase YodO family protein; InterPro: IPR003739 This family represents essentially the whole of the Escherichia coli YjeK family and of some of its apparent orthologs Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837 This enzyme is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO) Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
3c8f_A245 4fe-4s-Pyruvate Formate-Lyase Activating Enzyme Wit 4e-06
>gi|210060915|pdb|3C8F|A Chain A, 4fe-4s-Pyruvate Formate-Lyase Activating Enzyme With Partially Disordered Adomet Length = 245 Back     alignment and structure
 Score = 55.7 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 52/168 (30%), Gaps = 23/168 (13%)

Query: 8   EIFLTLQGEGGHAGRVAVFC-RFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYN 66
           E   T+ G G        F   F GC             +C +C           G    
Sbjct: 10  ESCGTVDGPGIR------FITFFQGC-----------LMRCLYCHNRDTW-DTHGGKEVT 51

Query: 67  VDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVD--VPLIQALNKRGFEIAVETNGTIEP 124
           V+ L   +          G     +GGE +LQ +      +A  K G    ++TNG +  
Sbjct: 52  VEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRR 111

Query: 125 --PQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENYIGFDFER 170
             P   + + V+     DLK    +  + +    N     +  +   +
Sbjct: 112 YDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANK 159


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
3can_A182 Pyruvate-formate lyase-activating enzyme; structural ge 0.001
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Length = 182 Back     alignment and structure
 Score = 38.7 bits (89), Expect = 0.001
 Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 2/54 (3%)

Query: 89  VLTGGEPLLQVD--VPLIQALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCD 140
              GGEPLL  +  + +++   ++G   AV+T          + +        D
Sbjct: 8   TFCGGEPLLHPEFLIDILKRCGQQGIHRAVDTTLLARKETVDEVMRNCELLLID 61


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet radi 99.78
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.40A {M 98.93
1tv8_A 340 MOAA, molybdenum cofactor biosynthesis protein A; TIM b 98.88
2a5h_A 416 L-lysine 2,3-aminomutase; radical SAM, four-iron-four-s 98.21
3iix_A 348 Biotin synthetase, putative; adoMet radical, SAM radica 96.81
2qgq_A 304 Protein TM_1862; alpha-beta protein, structural genomic 95.91
1r30_A 369 Biotin synthase; SAM radical protein, TIM barrel, FES c 92.24
2yx0_A342 Radical SAM enzyme; predicted tRNA modification enzyme, 99.05
3can_A182 Pyruvate-formate lyase-activating enzyme; structural ge 98.67
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
Probab=99.78  E-value=3.3e-18  Score=142.82  Aligned_cols=119  Identities=24%  Similarity=0.337  Sum_probs=92.6

Q ss_pred             CEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             12447751055840137315999768988875553333236888877575232588866078999999999875216678
Q gi|254780202|r    5 SIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKE   84 (211)
Q Consensus         5 ~i~EiF~SiQGEG~~~G~p~vFiRl~GCnL~c~~~~~~~~~~C~~CDT~y~~~~~~~~~~~~~~~i~~~i~~~~~~~~~~   84 (211)
                      .-.|.|.|++|||.+   -++|  |+|||+           +|.||....+ +....+..++.+++.+.+.+........
T Consensus         7 ~~~~~~s~~dg~G~r---~~vf--~~GCN~-----------~C~~C~n~~~-~~~~~~~~~~~~e~~~ei~~~~~~~~~~   69 (245)
T 3c8f_A            7 HSFESCGTVDGPGIR---FITF--FQGCLM-----------RCLYCHNRDT-WDTHGGKEVTVEDLMKEVVTYRHFMNAS   69 (245)
T ss_dssp             EEEEEEECTTSSSEE---EEEE--ESCCSC-----------CCTTCSCGGG-CCTTCSEEECHHHHHHHHGGGHHHHTST
T ss_pred             EEEEEECEEECCCCE---EEEE--CCCCCC-----------CCCCCCCHHH-HCCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             357995549489638---9998--787478-----------8989997134-1867991889999999999999975257


Q ss_pred             CCEEEEECCCCCCCC--CCHHHHHHHHCCCEEEEECCCCCCCC--------CCCEEEEECCCCCCC
Q ss_conf             738998077200003--51789999868987999727888667--------885079841677741
Q gi|254780202|r   85 GRYCVLTGGEPLLQV--DVPLIQALNKRGFEIAVETNGTIEPP--------QGIDWICVSPKAGCD  140 (211)
Q Consensus        85 ~~~VviTGGEPllq~--l~~L~~~l~~~g~~v~IETnGt~~~~--------~~~d~it~SPK~~~~  140 (211)
                      ...|++|||||++|.  +.++++.+++.|+++.++|||+....        ..+|++.+|.|...+
T Consensus        70 ~~~v~~sGGEP~l~~~~l~~l~~~~k~~g~~~~l~TnG~~~~~~~~~~~l~~~~d~v~id~~~~~~  135 (245)
T 3c8f_A           70 GGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMND  135 (245)
T ss_dssp             TCEEEEEESCGGGGHHHHHHHHHHHHTTTCCEEEEECCCCCCCCHHHHHHHHTCSEEEEECCCSSH
T ss_pred             CCEEECCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHCCCCEEEEECCCCCH
T ss_conf             875853555653469999999998886438479977886555345666652357579984354678



>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
d1tv8a_ 327 Molybdenum cofactor biosynthesis protein A MoaA {Staphy 98.51
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 92.48
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: MoCo biosynthesis proteins
domain: Molybdenum cofactor biosynthesis protein A MoaA
species: Staphylococcus aureus [TaxId: 1280]
Probab=98.51  E-value=5.3e-07  Score=65.17  Aligned_cols=102  Identities=27%  Similarity=0.296  Sum_probs=65.1

Q ss_pred             CCCEEEEE---CCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECC
Q ss_conf             73159997---6898887555333323688887757523----2588866078999999999875216678738998077
Q gi|254780202|r   21 GRVAVFCR---FSGCNLWSGREQDRLSAQCRFCDTDFVG----IQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGG   93 (211)
Q Consensus        21 G~p~vFiR---l~GCnL~c~~~~~~~~~~C~~CDT~y~~----~~~~~~~~~~~~~i~~~i~~~~~~~~~~~~~VviTGG   93 (211)
                      |+|--.+|   ..-|||           +|.||-.....    ........++.+++..++.++...   +...|.+|||
T Consensus         8 ~r~~~~l~ieiT~~CNl-----------rC~~C~~~~~~~~~~~~~~~~~~ls~e~~~~li~~~~~~---g~~~v~~~GG   73 (327)
T d1tv8a_           8 GRPIRDLRLSVTDRCNF-----------RCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAEL---GVKKIRITGG   73 (327)
T ss_dssp             SCBCCEEEEECCSCCSC-----------CCTTTSCTTTSSTTCCCCCGGGSCCHHHHHHHHHHHHHT---TCCEEEEESS
T ss_pred             CCCCCCEEEEECCCCCC-----------CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC---CCEEEEECCC
T ss_conf             99208579972210089-----------694789760167777647721459999999999999875---9838973798


Q ss_pred             CCCCCC-CCHHHHHHHHC-CCEEEEECCCCCCC--------CCCCEEEEECCC
Q ss_conf             200003-51789999868-98799972788866--------788507984167
Q gi|254780202|r   94 EPLLQV-DVPLIQALNKR-GFEIAVETNGTIEP--------PQGIDWICVSPK  136 (211)
Q Consensus        94 EPllq~-l~~L~~~l~~~-g~~v~IETnGt~~~--------~~~~d~it~SPK  136 (211)
                      ||++.+ ..+++...... +....+=|||+...        ...++++.+|--
T Consensus        74 Ep~l~~~~~e~i~~~~~~~~~~~~~~Tng~ll~~~~~~~l~~~g~~~i~iSld  126 (327)
T d1tv8a_          74 EPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLD  126 (327)
T ss_dssp             CGGGSTTHHHHHHHHTTCTTCCEEEEEECSTTHHHHHHHHHHHTCCEEEEECC
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEECC
T ss_conf             61246647999998754212220134443111206799999839987862025



>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 211 hypothetical protein CLIBASIA_00435 [Candidatus Li
3c8f_A_245 (A:) Pyruvate formate-lyase 1-activating enzyme; a 2e-07
>3c8f_A (A:) Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*Length = 245 Back     alignment and structure
 Score = 50.5 bits (119), Expect = 2e-07
 Identities = 26/144 (18%), Positives = 44/144 (30%), Gaps = 15/144 (10%)

Query: 5   SIKEIFLTLQGEGGHAGRVAVFCRFS-GCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGG 63
           S+     + +  G   G    F  F  GC +           +C +C           G 
Sbjct: 1   SVIGRIHSFESCGTVDGPGIRFITFFQGCLM-----------RCLYCHNRD-TWDTHGGK 48

Query: 64  RYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI--QALNKRGFEIAVETNGT 121
              V+ L   +          G     +GGE +LQ +      +A  K G    ++TNG 
Sbjct: 49  EVTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGF 108

Query: 122 IEPPQGIDWICVSPKAGCDLKIKG 145
           +     +    +       L +K 
Sbjct: 109 VRRYDPVIDELLEVTDLVMLDLKQ 132


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target211 hypothetical protein CLIBASIA_00435 [Candidatus Liberib
3c8f_A_245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.47
1tv8_A_1-313 313 MOAA, molybdenum cofactor biosynthesis protein A; 98.96
2yx0_A_342 Radical SAM enzyme; predicted tRNA modification en 98.63
2a5h_A_95-342248 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 98.3
3iix_A_ 348 Biotin synthetase, putative; adoMet radical, SAM r 98.24
1r30_A_ 369 Biotin synthase; SAM radical protein, TIM barrel, 98.17
1olt_A_1-364 364 Oxygen-independent coproporphyrinogen III oxidase; 97.35
2qgq_A_1-112112 Protein TM_1862; alpha-beta protein, structural ge 95.62
2z2u_A_311 UPF0026 protein MJ0257; metal binding protein; 2.4 98.81
3can_A_182 Pyruvate-formate lyase-activating enzyme; structur 98.54
>3c8f_A (A:) Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
Probab=99.47  E-value=2e-12  Score=104.64  Aligned_cols=123  Identities=21%  Similarity=0.302  Sum_probs=97.8

Q ss_pred             CEEEEEECCCCCCCCCCCCEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             1244775105584013731599976-898887555333323688887757523258886607899999999987521667
Q gi|254780202|r    5 SIKEIFLTLQGEGGHAGRVAVFCRF-SGCNLWSGREQDRLSAQCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEK   83 (211)
Q Consensus         5 ~i~EiF~SiQGEG~~~G~p~vFiRl-~GCnL~c~~~~~~~~~~C~~CDT~y~~~~~~~~~~~~~~~i~~~i~~~~~~~~~   83 (211)
                      ||.|+|+++|+++.+.|.+.+++.+ .|||+           +|.||++...+ .......++.+++...++++......
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~i~~t~~Cn~-----------~C~~C~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~   68 (245)
T 3c8f_A            1 SVIGRIHSFESCGTVDGPGIRFITFFQGCLM-----------RCLYCHNRDTW-DTHGGKEVTVEDLMKEVVTYRHFMNA   68 (245)
T ss_dssp             CCCEEEEEEEEEECTTSSSEEEEEEESCCSC-----------CCTTCSCGGGC-CTTCSEEECHHHHHHHHGGGHHHHTS
T ss_pred             CCEEEEEEEEEEEEEECCCCEEEEECCCCCC-----------CCCCCCCHHHH-CCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             9258984789940682797289998689688-----------79899980331-86799178899999999999998515


Q ss_pred             CCCEEEEECCCCCCCC--CCHHHHHHHHCCCEEEEECCCCCCCCC--------CCEEEEECCCCCC
Q ss_conf             8738998077200003--517899998689879997278886678--------8507984167774
Q gi|254780202|r   84 EGRYCVLTGGEPLLQV--DVPLIQALNKRGFEIAVETNGTIEPPQ--------GIDWICVSPKAGC  139 (211)
Q Consensus        84 ~~~~VviTGGEPllq~--l~~L~~~l~~~g~~v~IETnGt~~~~~--------~~d~it~SPK~~~  139 (211)
                      ....+.++||||+++.  +..|.+.+++.|..+.+.|||+.....        ..+.+.+|-....
T Consensus        69 ~~~~~~~~gGep~l~~~~~~~l~~~~~~~~~~~~~~tn~~~~~~~~~~~l~~~~~~~~~~~l~~~~  134 (245)
T 3c8f_A           69 SGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMN  134 (245)
T ss_dssp             TTCEEEEEESCGGGGHHHHHHHHHHHHTTTCCEEEEECCCCCCCCHHHHHHHHTCSEEEEECCCSS
T ss_pred             CCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             886687156774426789999999988635714661377311445556542133210114500100



>1tv8_A (A:1-313) MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} Back     alignment and structure
>2yx0_A (A:) Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>2a5h_A (A:95-342) L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3iix_A (A:) Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1r30_A (A:) Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} Back     alignment and structure
>1olt_A (A:1-364) Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} Back     alignment and structure
>2qgq_A (A:1-112) Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>2z2u_A (A:) UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3can_A (A:) Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure