peg_91

peg_91

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(93804, 93944)Protein Length:46aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:Putative deoxyribonuclease YcfH
Pathway involved in KEGG:not defined
Subsystem involved in SEED:YcfH
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40------
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
cccccccccccccccHHHHHHHHHHHHcccccEEEHHHHHHHHHcc
cccccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mlinthchfllpdfdedrHNVIMRAHQANVLKMIAIAIKVIRTLFL
mlinthchFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
oooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooo
oooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL
MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target46
254780215 262 hypothetical protein CLIBASIA_00500 [Candidatus Li 8e-18
>gi|254780215|ref|YP_003064628.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 79.7 bits (195), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 37/40 (92%), Positives = 39/40 (97%)

Query: 1  MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40
          MLI+THCH LLPDFDEDRH+VIMRAHQANVLKMIAIAIKV
Sbjct: 1  MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKV 40

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target46
254780215 262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib 1 1e-13
315122342 262 hypothetical protein CKC_02970 [Candidatus Liberibacter 1 1e-10
227822151 259 deoxyribonuclease [Sinorhizobium fredii NGR234] Length 1 2e-05
325292848 260 deoxyribonuclease [Agrobacterium sp. H13-3] Length = 26 1 4e-05
159184782 260 hypothetical protein Atu1495 [Agrobacterium tumefaciens 1 6e-05
218463183 260 hydrolase, TatD family protein [Rhizobium etli Kim 5] L 1 1e-04
241204712 260 hydrolase, TatD family [Rhizobium leguminosarum bv. tri 1 1e-04
209549395 260 hydrolase, TatD family [Rhizobium leguminosarum bv. tri 1 1e-04
150396507 259 TatD family hydrolase [Sinorhizobium medicae WSM419] Le 1 2e-04
218510041 173 hydrolase, TatD family protein [Rhizobium etli Brasil 5 1 3e-04
>gi|254780215|ref|YP_003064628.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment and organism information
 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/40 (92%), Positives = 39/40 (97%)

Query: 1  MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40
          MLI+THCH LLPDFDEDRH+VIMRAHQANVLKMIAIAIKV
Sbjct: 1  MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKV 40


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122342|ref|YP_004062831.1| hypothetical protein CKC_02970 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
>gi|227822151|ref|YP_002826122.1| deoxyribonuclease [Sinorhizobium fredii NGR234] Length = 259 Back     alignment and organism information
>gi|325292848|ref|YP_004278712.1| deoxyribonuclease [Agrobacterium sp. H13-3] Length = 260 Back     alignment and organism information
>gi|159184782|ref|NP_354501.2| hypothetical protein Atu1495 [Agrobacterium tumefaciens str. C58] Length = 260 Back     alignment and organism information
>gi|218463183|ref|ZP_03503274.1| hydrolase, TatD family protein [Rhizobium etli Kim 5] Length = 260 Back     alignment and organism information
>gi|241204712|ref|YP_002975808.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 260 Back     alignment and organism information
>gi|209549395|ref|YP_002281312.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 260 Back     alignment and organism information
>gi|150396507|ref|YP_001326974.1| TatD family hydrolase [Sinorhizobium medicae WSM419] Length = 259 Back     alignment and organism information
>gi|218510041|ref|ZP_03507919.1| hydrolase, TatD family protein [Rhizobium etli Brasil 5] Length = 173 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target46
cd01310 251 cd01310, TatD_DNAse, TatD like proteins; E 1e-04
PRK11449 258 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Pr 0.002
COG0084 256 COG0084, TatD, Mg-dependent DNase [DNA replication, rec 3e-05
>gnl|CDD|30053 cd01310, TatD_DNAse, TatD like proteins; E Back     alignment and domain information
>gnl|CDD|171118 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>gnl|CDD|30433 COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 46
PRK10425 258 DNase TatD; Provisional 99.37
COG0084 256 TatD Mg-dependent DNase [DNA replication, recombination 99.23
PRK10812 265 putative metallodependent hydrolase; Provisional 99.22
PRK11449 258 putative deoxyribonuclease YjjV; Provisional 99.21
TIGR00010 269 TIGR00010 hydrolase, TatD family; InterPro: IPR015991 E 99.13
cd01310 251 TatD_DNAse TatD like proteins; E.coli TatD is a cytopla 99.11
pfam01026 255 TatD_DNase TatD related DNase. This family of proteins 99.0
KOG3020 296 consensus 96.32
PRK07328 268 histidinol-phosphatase; Provisional 93.91
PRK05588 256 histidinol-phosphatase; Provisional 93.1
COG4464 254 CapC Capsular polysaccharide biosynthesis protein [Carb 93.08
pfam01979 307 Amidohydro_1 Amidohydrolase family. This family of enzy 90.94
COG3618 279 Predicted metal-dependent hydrolase of the TIM-barrel f 90.03
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10812 putative metallodependent hydrolase; Provisional Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>TIGR00010 TIGR00010 hydrolase, TatD family; InterPro: IPR015991 Escherichia coli TatD (synonym MttC) has been shown experimentally to be a DNase Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>pfam01026 TatD_DNase TatD related DNase Back     alignment and domain information
>KOG3020 consensus Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>COG4464 CapC Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01979 Amidohydro_1 Amidohydrolase family Back     alignment and domain information
>COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target46
1zzm_A 259 Crystal Structure Of Yjjv, Tatd Homolog From Escher 3e-10
2gzx_A 265 Crystal Structure Of The Tatd Deoxyribonuclease Mw0 1e-08
1j6o_A 268 Crystal Structure Of Tatd-Related Deoxyribonuclease 2e-06
1xwy_A 264 Crystal Structure Of Tatd Deoxyribonuclease From Es 4e-05
2y1h_A 272 Crystal Structure Of The Human Tatd-Domain Protein 1e-04
1yix_A 265 Crystal Structure Of Ycfh, Tatd Homolog From Escher 2e-04
gi|71042572|pdb|1ZZM|A Chain A, Crystal Structure Of Yjjv, Tatd Homolog From Escherichia Coli K12, At 1.8 A Resolution Length = 259 Back     alignment and structure
 Score = 68.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 2  LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43
           I+THCHF  P F  D    + RA QA V K+I  A +    
Sbjct: 5  FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENF 46


>gi|112491012|pdb|2GZX|A Chain A, Crystal Structure Of The Tatd Deoxyribonuclease Mw0446 From Staphylococcus Aureus. Northeast Structural Genomics Consortium Target Zr237. Length = 265 Back     alignment and structure
>gi|24987382|pdb|1J6O|A Chain A, Crystal Structure Of Tatd-Related Deoxyribonuclease (Tm0667) From Thermotoga Maritima At 1.8 A Resolution Length = 268 Back     alignment and structure
gi|60594083|pdb|1XWY|A Chain A, Crystal Structure Of Tatd Deoxyribonuclease From Escherichia Coli K12 At 2.0 A Resolution Length = 264 Back     alignment and structure
>gi|315583405|pdb|2Y1H|A Chain A, Crystal Structure Of The Human Tatd-Domain Protein 3 (Tatdn3) Length = 272 Back     alignment and structure
>gi|60594393|pdb|1YIX|A Chain A, Crystal Structure Of Ycfh, Tatd Homolog From Escherichia Coli K12, At 1.9 A Resolution Length = 265 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target46
1j6o_A 268 TATD-related deoxyribonuclease; structural genomics, TM 5e-06
2gzx_A 265 Putative TATD related DNAse; deoxyribonuclease, NESG, Z 6e-06
1xwy_A 264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc I 2e-05
1zzm_A 259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, 1e-04
2xio_A 301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Ho 4e-04
1yix_A 265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK 0.001
3e2v_A 401 3'-5'-exonuclease; structural genomics, hydrolase, PSI- 0.004
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Length = 268 Back     alignment and structure
 Score = 44.4 bits (104), Expect = 5e-06
 Identities = 10/37 (27%), Positives = 21/37 (56%)

Query: 2  LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38
          +++TH H     FD+DR+ VI    + N+  ++ + +
Sbjct: 13 MVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGV 49


>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Length = 265 Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Length = 264 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Length = 259 Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Length = 301 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX research center for structural genomics, NYSGXRC, structural genomics, PSI; 1.90A {Escherichia coli K12} SCOP: c.1.9.12 Length = 265 Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.50A {Saccharomyces cerevisiae YJM789} Length = 401 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target46
2gzx_A 265 Putative TATD related DNAse; deoxyribonuclease, NESG, Z 99.26
1xwy_A 264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc I 99.17
2xio_A 301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Ho 99.08
1j6o_A 268 TATD-related deoxyribonuclease; structural genomics, TM 99.08
1yix_A 265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK 99.01
1zzm_A 259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, 98.98
3e2v_A 401 3'-5'-exonuclease; structural genomics, hydrolase, PSI- 98.94
3ipw_A 325 Hydrolase TATD family protein; niaid, ssgcid, seattle s 98.78
3guw_A 261 Uncharacterized protein AF_1765; alpha-beta protein, st 98.31
3gg7_A 254 Uncharacterized metalloprotein; structural genomics, un 98.05
1bf6_A 291 Phosphotriesterase homology protein; hypothetical prote 97.35
2vc7_A 314 Aryldialkylphosphatase; phosphotriesterase, promiscuous 96.74
3cjp_A 272 Predicted amidohydrolase, dihydroorotase family; struct 96.49
2ffi_A 288 2-pyrone-4,6-dicarboxylic acid hydrolase, putative; TIM 95.79
2wm1_A 336 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; 95.69
2ob3_A 330 Parathion hydrolase; metalloenzyme, TIM barrel, nerve a 95.68
3ojg_A 330 Phosphotriesterase; (beta/alpha)8 barrel, lactonase, hy 95.62
2qah_A 303 2-pyrone-4,6-dicarboxylic acid hydrolase; structural ge 94.52
2yxo_A 267 Histidinol phosphatase; metal-dependent, hydrolase; 1.6 93.65
2gwg_A 350 4-oxalomesaconate hydratase; TIM-barrel like protein, s 92.8
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
Probab=99.26  E-value=3.3e-12  Score=89.52  Aligned_cols=43  Identities=35%  Similarity=0.526  Sum_probs=41.2

Q ss_pred             CEEEEECCCCCHHHHCCHHHHHHHHHHCCCCEEEEEEEEEHHE
Q ss_conf             9176424888646506889999999986998899964330320
Q 537021.9.peg.9    1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT   43 (46)
Q Consensus         1 MliDtHcHL~~~~f~~d~d~vi~ra~~~gV~~~i~v~~~~~~s   43 (46)
                      |||||||||++++|++|++++++||+++||.+++++|++.+++
T Consensus         1 MlID~H~HL~~~~~~~d~~~vi~~a~~~gv~~ii~~~~~~~~~   43 (265)
T 2gzx_A            1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVVGFNKSTI   43 (265)
T ss_dssp             -CEEEEECTTSGGGTTTHHHHHHHHHHTTCCEEEEEECSHHHH
T ss_pred             CEEEECCCCCCHHHCCCHHHHHHHHHHCCCCEEEEECCCHHHH
T ss_conf             9498666989735475999999999987998899925899999



>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX research center for structural genomics, NYSGXRC, structural genomics, PSI; 1.90A {Escherichia coli K12} SCOP: c.1.9.12 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.50A {Saccharomyces cerevisiae YJM789} Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putative; TIM-barrel protein., structural genomics, PSI, protein structure initiative; 2.61A {Pseudomonas putida KT2440} SCOP: c.1.9.15 Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>3ojg_A Phosphotriesterase; (beta/alpha)8 barrel, lactonase, hydrolase; HET: KCX HL4; 1.60A {Geobacillus kaustophilus} PDB: 3f4c_A* 3f4d_A* Back     alignment and structure
>2qah_A 2-pyrone-4,6-dicarboxylic acid hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Sphingomonas paucimobilis} Back     alignment and structure
>2yxo_A Histidinol phosphatase; metal-dependent, hydrolase; 1.60A {Thermus thermophilus} PDB: 2yz5_A 2z4g_A Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein structure initiative; 1.80A {Rhodopseudomonas palustris CGA009} SCOP: c.1.9.15 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 46
d1j6oa_ 260 c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga m 4e-06
d1xwya1 260 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Esche 8e-06
d1zzma1 259 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Esc 7e-05
d1yixa1 265 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Esc 6e-04
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: TatD Mg-dependent DNase-like
domain: Hypothetical protein TM0667
species: Thermotoga maritima [TaxId: 2336]
 Score = 43.8 bits (102), Expect = 4e-06
 Identities = 10/40 (25%), Positives = 22/40 (55%)

Query: 1  MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40
           +++TH H     FD+DR+ VI    + N+  ++ + + +
Sbjct: 4  HMVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNL 43


>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Length = 260 Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target46
d1xwya1 260 Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 99.22
d1j6oa_ 260 Hypothetical protein TM0667 {Thermotoga maritima [TaxId 99.19
d1yixa1 265 Putative deoxyribonuclease YcfH {Escherichia coli [TaxI 99.05
d1zzma1 259 Putative deoxyribonuclease YjjV {Escherichia coli [TaxI 98.99
d1bf6a_ 291 Phosphotriesterase homology protein {Escherichia coli [ 97.38
d2ffia1 271 Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP169 96.26
d1i0da_ 331 Phosphotriesterase (parathion hydrolase, PTE) {Pseudomo 95.34
d2gwga1 342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palu 92.22
d1onwa2 284 Isoaspartyl dipeptidase, catalytic domain {Escherichia 90.26
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: TatD Mg-dependent DNase-like
domain: Deoxyribonuclease TatD (MttC)
species: Escherichia coli [TaxId: 562]
Probab=99.22  E-value=3.2e-12  Score=88.21  Aligned_cols=42  Identities=17%  Similarity=0.320  Sum_probs=40.2

Q ss_pred             EEEEECCCCCHHHHCCHHHHHHHHHHCCCCEEEEEEEEEHHE
Q ss_conf             176424888646506889999999986998899964330320
Q 537021.9.peg.9    2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT   43 (46)
Q Consensus         2 liDtHcHL~~~~f~~d~d~vi~ra~~~gV~~~i~v~~~~~~s   43 (46)
                      ||||||||++++|++|+++|++||+++||.+++++|++++++
T Consensus         1 liD~H~HL~~~~f~~d~~~vl~~a~~~gV~~ii~~~~~~~~~   42 (260)
T d1xwya1           1 MFDIGVNLTSSQFAKDRDDVVACAFDAGVNGLLITGTNLRES   42 (260)
T ss_dssp             CEEEEECTTSGGGTTTHHHHHHHHHHTTCCEEEECCCSHHHH
T ss_pred             CEEEEECCCCHHHHCCHHHHHHHHHHCCCCEEEEECCCHHHH
T ss_conf             988786899967847799999999988999899963899999



>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 46
1xwy_A_ 264 (A:) DNAse TATD, deoxyribonuclease TATD; TIM barra 4e-04
1j6o_A_ 268 (A:) TATD-related deoxyribonuclease; structural ge 7e-04
2ogj_A_73-340 268 (A:73-340) Dihydroorotase; TIM barrel, binuclear z 0.001
2gzx_A_ 265 (A:) Putative TATD related DNAse; deoxyribonucleas 0.002
>1xwy_A (A:) DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli}Length = 264 Back     alignment and structure
 Score = 38.1 bits (87), Expect = 4e-04
 Identities = 7/38 (18%), Positives = 15/38 (39%)

Query: 1  MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38
           + +   +     F +DR +V+  A  A V  ++    
Sbjct: 4  RMFDIGVNLTSSQFAKDRDDVVACAFDAGVNGLLITGT 41


>1j6o_A (A:) TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima}Length = 268 Back     alignment and structure
>2ogj_A (A:73-340) Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrolase, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens str}Length = 268 Back     alignment and structure
>2gzx_A (A:) Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp}Length = 265 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target46
1xwy_A_ 264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 98.65
3ipw_A_ 325 Hydrolase TATD family protein; niaid, ssgcid, seat 98.64
2gzx_A_ 265 Putative TATD related DNAse; deoxyribonuclease, NE 98.51
3e2v_A_ 401 3'-5'-exonuclease; structural genomics, hydrolase, 98.46
1j6o_A_ 268 TATD-related deoxyribonuclease; structural genomic 98.33
1zzm_A_ 259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 98.29
3gg7_A_ 254 Uncharacterized metalloprotein; structural genomic 98.24
1yix_A_ 265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 98.15
2ogj_A_73-340 268 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 97.7
2vc7_A_ 314 Aryldialkylphosphatase; phosphotriesterase, promis 97.38
2vun_A_63-324 262 Enamidase; nicotinate degradation, binuclear metal 97.35
3gtx_A_ 339 Organophosphorus hydrolase; mutant, amidohydrolase 97.29
2ffi_A_ 288 2-pyrone-4,6-dicarboxylic acid hydrolase, putative 97.2
3f4c_A_ 332 Organophosphorus hydrolase; alpha-beta barrel, ami 97.13
2qah_A_ 303 2-pyrone-4,6-dicarboxylic acid hydrolase; structur 96.8
3irs_A_ 291 Uncharacterized protein BB4693; structural genomic 96.71
2ob3_A_ 330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 96.59
2ics_A_56-322 267 Adenine deaminase; TIM barrel, binuclear zinc, ade 96.13
3guw_A_ 261 Uncharacterized protein AF_1765; alpha-beta protei 96.04
3k2g_A_ 364 Resiniferatoxin-binding, phosphotriesterase- relat 95.81
3ij6_A_ 312 Uncharacterized metal-dependent hydrolase; structu 95.7
3cjp_A_ 272 Predicted amidohydrolase, dihydroorotase family; s 95.59
1m65_A_ 245 Hypothetical protein YCDX; structural genomics, be 92.24
1onw_A_64-347 284 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 91.41
2w9m_A_312-578 267 Polymerase X; SAXS, DNA repair, DNA polymerase, DN 91.3
2anu_A_ 255 Hypothetical protein TM0559; predicted metal-depen 91.03
2dvt_A_ 327 Thermophilic reversible gamma-resorcylate decarbox 90.87
>1xwy_A (A:) DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} Back     alignment and structure
Probab=98.65  E-value=2.8e-08  Score=68.25  Aligned_cols=42  Identities=17%  Similarity=0.294  Sum_probs=39.9

Q ss_pred             CEEEEECCCCCHHHHCCHHHHHHHHHHCCCCEEEEEEEEEHH
Q ss_conf             917642488864650688999999998699889996433032
Q 537021.9.peg.9    1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR   42 (46)
Q Consensus         1 MliDtHcHL~~~~f~~d~d~vi~ra~~~gV~~~i~v~~~~~~   42 (46)
                      |+||+|||+++..|++++++++++|+++||+++++++++...
T Consensus         4 ~iID~H~Hl~~~~~~~~~~~~~~~~~~~Gv~~~v~~~~~~~~   45 (264)
T 1xwy_A            4 RMFDIGVNLTSSQFAKDRDDVVACAFDAGVNGLLITGTNLRE   45 (264)
T ss_dssp             -CEEEEECTTSGGGTTTHHHHHHHHHHTTCCEEEECCCSHHH
T ss_pred             CEEEEEECCCCHHHHCCHHHHHHHHHHCCCCEEEEECCCHHH
T ss_conf             679985678985770789999999998799989996389999



>3ipw_A (A:) Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>2gzx_A (A:) Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3e2v_A (A:) 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.50A {Saccharomyces cerevisiae YJM789} Back     alignment and structure
>1j6o_A (A:) TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} Back     alignment and structure
>1zzm_A (A:) Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} Back     alignment and structure
>3gg7_A (A:) Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} Back     alignment and structure
>1yix_A (A:) Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX research center for structural genomics, NYSGXRC, structural genomics, PSI; 1.90A {Escherichia coli K12} Back     alignment and structure
>2ogj_A (A:73-340) Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrolase, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens str} Back     alignment and structure
>2vc7_A (A:) Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>2vun_A (A:63-324) Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>3gtx_A (A:) Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>2ffi_A (A:) 2-pyrone-4,6-dicarboxylic acid hydrolase, putative; TIM-barrel protein., structural genomics, PSI, protein structure initiative; 2.61A {Pseudomonas putida KT2440} Back     alignment and structure
>3f4c_A (A:) Organophosphorus hydrolase; alpha-beta barrel, amidohydrolase, binuclear metal enzyme, glycerol-bound; HET: KCX; 2.07A {Geobacillus stearothermophilus 10} PDB: 3f4d_A* Back     alignment and structure
>2qah_A (A:) 2-pyrone-4,6-dicarboxylic acid hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Sphingomonas paucimobilis} Back     alignment and structure
>3irs_A (A:) Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TIM-barrel protein; HET: GOL; 1.76A {Bordetella bronchiseptica} Back     alignment and structure
>2ob3_A (A:) Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>2ics_A (A:56-322) Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} Back     alignment and structure
>3guw_A (A:) Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3k2g_A (A:) Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3ij6_A (A:) Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>3cjp_A (A:) Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1m65_A (A:) Hypothetical protein YCDX; structural genomics, beta-alpha-barrel, zinc, metallo- enzyme, structure 2 function project, S2F, unknown function; 1.57A {Escherichia coli} Back     alignment and structure
>1onw_A (A:64-347) Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} Back     alignment and structure
>2w9m_A (A:312-578) Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} Back     alignment and structure
>2anu_A (A:) Hypothetical protein TM0559; predicted metal-dependent phosphoesterase (PHP family), structural genomics; 2.40A {Thermotoga maritima MSB8} Back     alignment and structure
>2dvt_A (A:) Thermophilic reversible gamma-resorcylate decarboxylase; TIM barrel, lyase; 1.70A {Rhizobium SP} Back     alignment and structure