254780203

254780203

hypothetical protein CLIBASIA_00440

GeneID in NCBI database:8209184Locus tag:CLIBASIA_00440
Protein GI in NCBI database:254780203Protein Accession:YP_003064616.1
Gene range:-(93989, 94237)Protein Length:82aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--
MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT
cccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEEHHHHccccccc
cccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEccccccccc
mddrkyrpskeeVRDAFPELIKALEKGlstfdveplknpvkshgkgyESYISHVCELIELlknkdfdgveierksynlrknt
mddrkyrpskeevrdAFPELIKALEkglstfdveplKNPVKSHGKGYESYISHVCELIELlknkdfdgveierksynlrknt
MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT
************VRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIE***Y******
************VRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT
*****YRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNL****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT
MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT
MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target82 hypothetical protein CLIBASIA_00440 [Candidatus Liberib
254781124101 hypothetical protein CLIBASIA_05130 [Candidatus Li 2e-10
254781189252 hypothetical protein CLIBASIA_05480 [Candidatus Li 4e-07
>gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment
 Score = 55.1 bits (131), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 2  DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59
          +  +YRP ++EVR+AFP+++K++EK L  + V+PL  PV+   +G   E Y  H+C LI+
Sbjct: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70

Query: 60 LLKNKD 65
          LL+N+ 
Sbjct: 71 LLENRS 76

>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Back     alignment
 Score = 44.3 bits (103), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 3   DRKYRPSKEEVRDAFP-ELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELL 61
           D KYRPS E +R   P +L+K  E  +S +      +P+      +  Y  H C L+  L
Sbjct: 177 DNKYRPSAEAMRTICPTKLMKIFEDTISLY-----VDPLTPRDISFTQYEKHACALVNWL 231

Query: 62  KNKDFDGVEIERKSYNLRKN 81
           +   F+ + I RK++N R  
Sbjct: 232 EKGKFNEMSIARKAFNRRSQ 251

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target82 hypothetical protein CLIBASIA_00440 [Candidatus Liberib
254781124101 hypothetical protein CLIBASIA_05130 [Candidatus Liberib 1 3e-06
254781189252 hypothetical protein CLIBASIA_05480 [Candidatus Liberib 2 2e-05
>gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment and organism information
 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 2  DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59
          +  +YRP ++EVR+AFP+++K++EK L  + V+PL  PV+   +G   E Y  H+C LI+
Sbjct: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70

Query: 60 LLKNKD 65
          LL+N+ 
Sbjct: 71 LLENRS 76


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00