254780204

254780204

hypothetical protein CLIBASIA_00445

GeneID in NCBI database:8209185Locus tag:CLIBASIA_00445
Protein GI in NCBI database:254780204Protein Accession:YP_003064617.1
Gene range:-(94327, 94869)Protein Length:180aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED2 TM-Helix
HMMTOP4 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSMKH
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccc
ccccccHHHHHEHcHHHHHHHHHHEEEcccEEEEEccHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccEEccccHHHHHHHHHHHccc
MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIaiptieegmtmndIKYERKQVISRKAKEKDLEESLYQISEFAAclehpnrywhtdsasigfrvPIYLLQFQILSMKH
MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRhtvaetpkiMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAiptieegmtmndiKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSMKH
MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKsfqyllffsglsyllfhsASFVLSLTSaclvvtailaillsiaiPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSMKH
***KGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAIPTIEEGMTMNDIKY******************LYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSM**
MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSMKH
*NLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSMK*
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRVPIYLLQFQILSMKH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target180 hypothetical protein CLIBASIA_00445 [Candidatus Liberib
254781189 252 hypothetical protein CLIBASIA_05480 [Candidatus Li 4e-07
>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Back     alignment
 Score = 45.8 bits (107), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 101 LSIAIPT--IEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRY 154
           LS+AI    +EE + +NDIKYE +Q I  K KE    E L + +E  ACL   +RY
Sbjct: 65  LSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRY 120

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target180 hypothetical protein CLIBASIA_00445 [Candidatus Liberib
254781189 252 hypothetical protein CLIBASIA_05480 [Candidatus Liberib 1 0.002
>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Back     alignment and organism information
 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 101 LSIAIPT--IEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRY 154
           LS+AI    +EE + +NDIKYE +Q I  K KE    E L + +E  ACL   +RY
Sbjct: 65  LSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRY 120


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00