254780205

254780205

prenyltransferase

GeneID in NCBI database:8209186Locus tag:CLIBASIA_00450
Protein GI in NCBI database:254780205Protein Accession:YP_003064618.1
Gene range:-(95327, 96259)Protein Length:310aa
Gene description:prenyltransferase
COG prediction:[H] 4-hydroxybenzoate polyprenyltransferase and related prenyltransferases
KEGG prediction:ubiA; prenyltransferase; K03179 4-hydroxybenzoate octaprenyltransferase [EC:2.5.1.-]
SEED prediction:4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.-)
Pathway involved in KEGG:Ubiquinone and other terpenoid-quinone biosynthesis [PATH:las00130]
Subsystem involved in SEED:Ubiquinone Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED6 TM-Helix
HMMTOP10 TM-Helix
MEMSAT9 TM-Helix
MEMSAT_SVM9 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHc
cccccccccHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccEcccHcccccccHEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc
MSQFFNFKWVRDCimgsaiapYVYLARWhsstgwhlavlpclwstvlaayplrragvLGWSTIFWYLFIYIVGAIVTrgaactwndlvdhdidsqvlrtrsrplpsgqctRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLlypfskrfilcpqvVLGIGFAGGVFVGwgalhasfswpafFLCIGTIFWVVYFDTVyahqdkkddeligvnsTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHqdkkddeligVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQvvlgigfaggvfvgwgalHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGililicliislflDQF
***FFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
****FNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxx
ooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF
MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target310 prenyltransferase [Candidatus Liberibacter asiaticus st
254780360305 protoheme IX farnesyltransferase [Candidatus Liber 1e-06
>gi|254780360|ref|YP_003064773.1| protoheme IX farnesyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 305 Back     alignment
 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 15/115 (13%)

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLL-LQFNPFVI 137
           GA+   N   D DID  + RT SRP+P GQ + ++A V  V   + S V++ L  N    
Sbjct: 55  GASGALNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAIN---- 110

Query: 138 CVGFALLFISL-----LYPF-SKRFILCPQVVLGIGFAGGV--FVGWGALHASFS 184
            V   LLF+S+     +Y    KRF   PQ ++  G AG +   +GW ++    S
Sbjct: 111 WVSATLLFMSIFCYVVIYTIWLKRF--TPQNIVIGGIAGAIPPMIGWASVTGDVS 163

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target310 prenyltransferase [Candidatus Liberibacter asiaticus st
315122630296 prenyltransferase [Candidatus Liberibacter solanacearum 1 1e-114
15964617318 prenyltransferase [Sinorhizobium meliloti 1021] Length 1 5e-67
37903514317 p-hydroxybenzoate decaprenyltransferase [Agrobacterium 1 1e-66
150395702321 4-hydroxybenzoate polyprenyltransferase [Sinorhizobium 1 3e-65
222085076319 4-hydroxybenzoate polyprenyl transferase [Agrobacterium 1 4e-65
327188118319 4-hydroxybenzoate octaprenyltransferase protein [Rhizob 1 4e-65
190890607319 4-hydroxybenzoate octaprenyltransferase protein [Rhizob 1 5e-65
15887993317 prenyltransferase [Agrobacterium tumefaciens str. C58] 1 5e-65
325292033317 4-hydroxybenzoate octaprenyltransferase [Agrobacterium 1 6e-65
241203335322 4-hydroxybenzoate polyprenyltransferase [Rhizobium legu 1 1e-64
>gi|315122630|ref|YP_004063119.1| prenyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 296 Back     alignment and organism information
 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/296 (67%), Positives = 238/296 (80%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           M S  +PY +LAR H  TGW L +LP LWS + AAYPLRRAG+L WSTIFWYL  Y++G+
Sbjct: 1   MNSVFSPYAHLARLHMLTGWRLMLLPSLWSIIFAAYPLRRAGLLSWSTIFWYLCFYLIGS 60

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           I+ R A CTWNDLVDH+IDSQV RTRSRPLP+GQC+R +A +FA+ QF+IS +LL+Q N 
Sbjct: 61  IIVRSAGCTWNDLVDHNIDSQVSRTRSRPLPAGQCSRSRAYIFAIFQFVISLILLMQLNY 120

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
           FVIC+GFA+  I L+YPFSKRFI CPQVVLGI   GGVF+GWG+LH SFSW AF+L IGT
Sbjct: 121 FVICIGFAVFVILLIYPFSKRFIPCPQVVLGICCGGGVFIGWGSLHESFSWTAFWLFIGT 180

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           IFWV++FDTVYAHQDKKDDE IG+NSTARLF+  TK+W+ ILYG+F LCFM+A  L+  N
Sbjct: 181 IFWVIHFDTVYAHQDKKDDEQIGINSTARLFADHTKIWISILYGLFTLCFMIALYLVQAN 240

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           FFAWIGLLIALF TIKRII LDIS S QC  FF +A + G+ I   L+ SLFLDQF
Sbjct: 241 FFAWIGLLIALFFTIKRIIILDISSSDQCFLFFKTADMTGMFIFASLLFSLFLDQF 296


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964617|ref|NP_384970.1| prenyltransferase [Sinorhizobium meliloti 1021] Length = 318 Back     alignment and organism information
>gi|37903514|gb|AAP56241.1| p-hydroxybenzoate decaprenyltransferase [Agrobacterium tumefaciens] Length = 317 Back     alignment and organism information
>gi|150395702|ref|YP_001326169.1| 4-hydroxybenzoate polyprenyltransferase [Sinorhizobium medicae WSM419] Length = 321 Back     alignment and organism information
>gi|222085076|ref|YP_002543606.1| 4-hydroxybenzoate polyprenyl transferase [Agrobacterium radiobacter K84] Length = 319 Back     alignment and organism information
>gi|327188118|gb|EGE55340.1| 4-hydroxybenzoate octaprenyltransferase protein [Rhizobium etli CNPAF512] Length = 319 Back     alignment and organism information
>gi|190890607|ref|YP_001977149.1| 4-hydroxybenzoate octaprenyltransferase protein [Rhizobium etli CIAT 652] Length = 319 Back     alignment and organism information
>gi|15887993|ref|NP_353674.1| prenyltransferase [Agrobacterium tumefaciens str. C58] Length = 317 Back     alignment and organism information
>gi|325292033|ref|YP_004277897.1| 4-hydroxybenzoate octaprenyltransferase [Agrobacterium sp. H13-3] Length = 317 Back     alignment and organism information
>gi|241203335|ref|YP_002974431.1| 4-hydroxybenzoate polyprenyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 322 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target310 prenyltransferase [Candidatus Liberibacter asiaticus st
PRK12878314 PRK12878, ubiA, 4-hydroxybenzoate polyprenyltransferase 4e-80
TIGR01474281 TIGR01474, ubiA_proteo, 4-hydroxybenzoate polyprenyl tr 5e-68
PRK12847285 PRK12847, ubiA, 4-hydroxybenzoate polyprenyltransferase 8e-47
PLN02809289 PLN02809, PLN02809, 4-hydroxybenzoate nonaprenyltransfe 3e-44
COG0382289 COG0382, UbiA, 4-hydroxybenzoate polyprenyltransferase 2e-35
PRK12873294 PRK12873, ubiA, prenyltransferase; Reviewed 1e-29
KOG1381353 KOG1381, KOG1381, KOG1381, Para-hydroxybenzoate-polypre 3e-44
PRK12870290 PRK12870, ubiA, 4-hydroxybenzoate polyprenyltransferase 5e-45
PRK12848282 PRK12848, ubiA, 4-hydroxybenzoate octaprenyltransferase 4e-43
pfam01040258 pfam01040, UbiA, UbiA prenyltransferase family 4e-17
KOG1380409 KOG1380, KOG1380, KOG1380, Heme A farnesyltransferase [ 5e-05
PRK12886291 PRK12886, ubiA, prenyltransferase; Reviewed 1e-23
TIGR01473280 TIGR01473, cyoE_ctaB, protoheme IX farnesyltransferase 5e-12
PRK13106300 PRK13106, ubiA, prenyltransferase; Reviewed 2e-10
TIGR01475282 TIGR01475, ubiA_other, putative 4-hydroxybenzoate polyp 5e-21
PRK12888284 PRK12888, ubiA, prenyltransferase; Reviewed 4e-18
PRK12874291 PRK12874, ubiA, prenyltransferase; Reviewed 3e-17
COG0109304 COG0109, CyoE, Polyprenyltransferase (cytochrome oxidas 2e-11
PRK12895286 PRK12895, ubiA, prenyltransferase; Reviewed 5e-10
PRK04375296 PRK04375, PRK04375, protoheme IX farnesyltransferase; P 9e-14
PRK12869279 PRK12869, ubiA, protoheme IX farnesyltransferase; Revie 2e-06
PRK13362306 PRK13362, PRK13362, protoheme IX farnesyltransferase; P 3e-06
PRK12884279 PRK12884, ubiA, prenyltransferase; Reviewed 6e-05
PRK12876300 PRK12876, ubiA, prenyltransferase; Reviewed 3e-04
PRK12324295 PRK12324, PRK12324, phosphoribose diphosphate:decapreny 0.001
PLN02776341 PLN02776, PLN02776, prenyltransferase 3e-04
PRK12882276 PRK12882, ubiA, prenyltransferase; Reviewed 0.001
>gnl|CDD|183808 PRK12878, ubiA, 4-hydroxybenzoate polyprenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|130539 TIGR01474, ubiA_proteo, 4-hydroxybenzoate polyprenyl transferase, proteobacterial Back     alignment and domain information
>gnl|CDD|183789 PRK12847, ubiA, 4-hydroxybenzoate polyprenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|178405 PLN02809, PLN02809, 4-hydroxybenzoate nonaprenyltransferase Back     alignment and domain information
>gnl|CDD|30731 COG0382, UbiA, 4-hydroxybenzoate polyprenyltransferase and related prenyltransferases [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|171787 PRK12873, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|36595 KOG1381, KOG1381, KOG1381, Para-hydroxybenzoate-polyprenyl transferase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|183804 PRK12870, ubiA, 4-hydroxybenzoate polyprenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183790 PRK12848, ubiA, 4-hydroxybenzoate octaprenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|144580 pfam01040, UbiA, UbiA prenyltransferase family Back     alignment and domain information
>gnl|CDD|36594 KOG1380, KOG1380, KOG1380, Heme A farnesyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|171798 PRK12886, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|162379 TIGR01473, cyoE_ctaB, protoheme IX farnesyltransferase Back     alignment and domain information
>gnl|CDD|183862 PRK13106, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|162380 TIGR01475, ubiA_other, putative 4-hydroxybenzoate polyprenyltransferase Back     alignment and domain information
>gnl|CDD|183814 PRK12888, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183806 PRK12874, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|30458 COG0109, CyoE, Polyprenyltransferase (cytochrome oxidase assembly factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|106021 PRK12895, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|179840 PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183803 PRK12869, ubiA, protoheme IX farnesyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184001 PRK13362, PRK13362, protoheme IX farnesyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183812 PRK12884, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|171790 PRK12876, ubiA, prenyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183439 PRK12324, PRK12324, phosphoribose diphosphate:decaprenyl-phosphate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178375 PLN02776, PLN02776, prenyltransferase Back     alignment and domain information
>gnl|CDD|183811 PRK12882, ubiA, prenyltransferase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 310 prenyltransferase [Candidatus Liberibacter asiaticus st
TIGR01474291 ubiA_proteo 4-hydroxybenzoate polyprenyl transferase; I 100.0
PRK12878314 ubiA prenyltransferase; Reviewed 100.0
PRK12894282 consensus 100.0
PRK12870289 ubiA prenyltransferase; Reviewed 100.0
PRK12848282 ubiA 4-hydroxybenzoate octaprenyltransferase; Reviewed 100.0
PRK12877283 consensus 100.0
PRK12847284 ubiA prenyltransferase; Reviewed 100.0
PRK12873297 ubiA prenyltransferase; Reviewed 100.0
PRK12888313 ubiA prenyltransferase; Reviewed 100.0
KOG1381353 consensus 100.0
PRK13106299 ubiA prenyltransferase; Reviewed 100.0
PRK12886291 ubiA prenyltransferase; Reviewed 100.0
PRK12895286 ubiA prenyltransferase; Reviewed 100.0
PRK12874291 ubiA prenyltransferase; Reviewed 100.0
PRK12876299 ubiA prenyltransferase; Reviewed 100.0
TIGR01475301 ubiA_other 4-hydroxybenzoate polyprenyltransferase, put 100.0
PRK12869278 ubiA prenyltransferase; Reviewed 100.0
PRK04375303 protoheme IX farnesyltransferase; Provisional 100.0
PRK12871297 ubiA prenyltransferase; Reviewed 100.0
COG0382289 UbiA 4-hydroxybenzoate polyprenyltransferase and relate 100.0
TIGR01473297 cyoE_ctaB protoheme IX farnesyltransferase; InterPro: I 100.0
PRK13362306 protoheme IX farnesyltransferase; Provisional 100.0
COG0109304 CyoE Polyprenyltransferase (cytochrome oxidase assembly 100.0
PRK12884281 ubiA prenyltransferase; Reviewed 100.0
PRK12882276 ubiA prenyltransferase; Reviewed 100.0
PRK09573280 (S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase; 100.0
PRK13593283 consensus 100.0
PRK12883275 ubiA prenyltransferase UbiA-like protein; Reviewed 100.0
PRK13594278 consensus 100.0
PRK07566308 bacteriochlorophyll/chlorophyll a synthase; Reviewed 100.0
KOG1380409 consensus 100.0
pfam01040258 UbiA UbiA prenyltransferase family. 100.0
TIGR01476295 chlor_syn_BchG bacteriochlorophyll/chlorophyll syntheta 100.0
PRK12887309 ubiA tocopherol phytyltransferase; Reviewed 99.95
PRK06080300 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Valid 99.94
TIGR02056306 ChlG chlorophyll synthase, ChlG; InterPro: IPR011799 Th 99.92
PRK05951296 ubiA prenyltransferase; Reviewed 99.89
PRK13387317 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Provi 99.89
PRK13105291 ubiA prenyltransferase; Reviewed 99.85
PRK07419304 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Provi 99.83
PRK12875281 ubiA prenyltransferase; Reviewed 99.82
COG1575303 MenA 1,4-dihydroxy-2-naphthoate octaprenyltransferase [ 99.8
PRK13595298 ubiA prenyltransferase; Provisional 99.78
TIGR02235293 menA_cyano-plnt 1,4-dihydroxy-2-naphthoate phytyltransf 98.73
KOG4581359 consensus 98.7
PRK12392331 bacteriochlorophyll c synthase; Provisional 100.0
PRK12872297 ubiA prenyltransferase; Reviewed 99.89
PRK13592299 ubiA prenyltransferase; Provisional 98.55
TIGR00751286 menA 1,4-dihydroxy-2-naphthoate octaprenyltransferase; 96.16
PRK12324288 phosphoribose diphosphate:decaprenyl-phosphate phosphor 99.89
PRK08238481 hypothetical protein; Validated 99.82
PRK13591304 ubiA prenyltransferase; Provisional 98.3
>TIGR01474 ubiA_proteo 4-hydroxybenzoate polyprenyl transferase; InterPro: IPR006370 These sequences are a family of integral membrane proteins that condense para-hydroxybenzoate with any of several polyprenyldiphosphates Back     alignment and domain information
>PRK12878 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12894 consensus Back     alignment and domain information
>PRK12870 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12848 ubiA 4-hydroxybenzoate octaprenyltransferase; Reviewed Back     alignment and domain information
>PRK12877 consensus Back     alignment and domain information
>PRK12847 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12873 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12888 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>KOG1381 consensus Back     alignment and domain information
>PRK13106 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12886 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12895 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12874 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12876 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>TIGR01475 ubiA_other 4-hydroxybenzoate polyprenyltransferase, putative; InterPro: IPR006371 A fairly deep split separates this polyprenyltransferase subfamily from the set of mitochondrial and proteobacterial 4-hydroxybenzoate polyprenyltransferases, described in IPR006370 from INTERPRO Back     alignment and domain information
>PRK12869 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK04375 protoheme IX farnesyltransferase; Provisional Back     alignment and domain information
>PRK12871 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>COG0382 UbiA 4-hydroxybenzoate polyprenyltransferase and related prenyltransferases [Coenzyme metabolism] Back     alignment and domain information
>TIGR01473 cyoE_ctaB protoheme IX farnesyltransferase; InterPro: IPR006369 This family describes protoheme IX farnesyltransferase, also called haeme O synthase, an enzyme that creates an intermediate in the biosynthesis of haeme A Back     alignment and domain information
>PRK13362 protoheme IX farnesyltransferase; Provisional Back     alignment and domain information
>COG0109 CyoE Polyprenyltransferase (cytochrome oxidase assembly factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12884 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK12882 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK09573 (S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase; Reviewed Back     alignment and domain information
>PRK13593 consensus Back     alignment and domain information
>PRK12883 ubiA prenyltransferase UbiA-like protein; Reviewed Back     alignment and domain information
>PRK13594 consensus Back     alignment and domain information
>PRK07566 bacteriochlorophyll/chlorophyll a synthase; Reviewed Back     alignment and domain information
>KOG1380 consensus Back     alignment and domain information
>pfam01040 UbiA UbiA prenyltransferase family Back     alignment and domain information
>TIGR01476 chlor_syn_BchG bacteriochlorophyll/chlorophyll synthetase; InterPro: IPR006372 These are a subfamily of a large family of polyprenyltransferases that also includes 4-hydroxybenzoate octaprenyltransferase and protoheme IX farnesyltransferase (heme O synthase) Back     alignment and domain information
>PRK12887 ubiA tocopherol phytyltransferase; Reviewed Back     alignment and domain information
>PRK06080 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated Back     alignment and domain information
>TIGR02056 ChlG chlorophyll synthase, ChlG; InterPro: IPR011799 This entry represents the strictly cyanobacterial and plant-specific chlorophyll synthase ChlG Back     alignment and domain information
>PRK05951 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK13387 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Provisional Back     alignment and domain information
>PRK13105 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK07419 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Provisional Back     alignment and domain information
>PRK12875 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>COG1575 MenA 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13595 ubiA prenyltransferase; Provisional Back     alignment and domain information
>TIGR02235 menA_cyano-plnt 1,4-dihydroxy-2-naphthoate phytyltransferase; InterPro: IPR011937 This family of phytyltransferases, found in plants and cyanobacteria, are involved in the biosythesis of phylloquinone (Vitamin K1) Back     alignment and domain information
>KOG4581 consensus Back     alignment and domain information
>PRK12392 bacteriochlorophyll c synthase; Provisional Back     alignment and domain information
>PRK12872 ubiA prenyltransferase; Reviewed Back     alignment and domain information
>PRK13592 ubiA prenyltransferase; Provisional Back     alignment and domain information
>TIGR00751 menA 1,4-dihydroxy-2-naphthoate octaprenyltransferase; InterPro: IPR004657 This membrane-associated enzyme converts 1,4-dihydroxy-2-naphthoic acid (DHNA) to demethylmenaquinone, a step in menaquinone biosynthesis Back     alignment and domain information
>PRK12324 phosphoribose diphosphate:decaprenyl-phosphate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK13591 ubiA prenyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00