255764461

255764461

methionyl-tRNA synthetase

GeneID in NCBI database:8209197Locus tag:CLIBASIA_00505
Protein GI in NCBI database:255764461Protein Accession:YP_003064629.2
Gene range:-(103058, 104593)Protein Length:511aa
Gene description:methionyl-tRNA synthetase
COG prediction:[J] Methionyl-tRNA synthetase
KEGG prediction:methionyl-tRNA synthetase (EC:6.1.1.10); K01874 methionyl-tRNA synthetase [EC:6.1.1.10]
SEED prediction:Methionyl-tRNA synthetase (EC 6.1.1.10)
Pathway involved in KEGG:Selenoamino acid metabolism [PATH:las00450]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Met
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
cccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccEEEcccccccccccccccHHHHHHcccccccccccccccccccccccEEEcccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccccHHHHcccccccHHHHHccccccEEEEEHHHHHHHHHHHHHHHHHccccHHHEEEEccEEccccEEccccccccccHHHHHHHccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHccccccccccccccccccccccc
ccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHHHccccHHHHHHHHcHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEcccccEccccccccccccccEEEEEcHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHcccccccccccccccccccEEEEEHHHHHHHHHHcccccccHHHHHcHHHHEEEEEEHHHHHHHHcHHHHHHHHccEccccEEEEEccEEEccEccccccccccEHHHHHHHccHHHHHHHHHHHccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHcccccccEEcccccccccccc
MKEREKLYISTAiaypnaqphigHAYEMIIADVLARFHrldgldvlfttgtdeHGQKIAKAAQNAGVTTKVFVdqnsrnfrdmaDVLDISYDDFIRTTEKRHHDTCRILWKkisdkgdiykgcysgwyslrdeayynddevykgadgqyynaqhnpvqwmeeEGYFFRLSAYQDKLLSYyeshpefilpieRRNEVISFVKSGLKdlslsrktfdwgikipddpqyIMYVWIDALTNYLtttgyldnpdgskakfwpadlhvIGKDILRFHAIYWPAfllsanlplpkkvfshgfilhKGEKISKslgnvidpieVIEEVGVDALRYFLVREIacgkdgfydkdglkKRVNADLANGIGNLVSRSVSMILkdydgmiptpgaftesdeSILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRyfdaqkpwelkktnpdrasTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLdqrlkpgfmlhktfdpifprfl
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAkaaqnagvttkvfvdqnsrnfrdMADVLDISYDDFirttekrhhdtcrilwkkisdkgdiyKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSglkdlslsrktfdwgikipddpQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACgkdgfydkdglKKRVNAdlangignlvsRSVSMILKDYDGMIPTpgaftesdesILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAqkpwelkktnpdrasTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDqrlkpgfmlhKTFDPIFPRFL
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
***REKL*ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
***REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target511 methionyl-tRNA synthetase [Candidatus Liberibacter asia
254780802869 leucyl-tRNA synthetase [Candidatus Liberibacter as 4e-13
254780802 869 leucyl-tRNA synthetase [Candidatus Liberibacter as 2e-10
254780445 963 isoleucyl-tRNA synthetase [Candidatus Liberibacter 1e-09
254780445 963 isoleucyl-tRNA synthetase [Candidatus Liberibacter 5e-05
254780933 947 valyl-tRNA synthetase [Candidatus Liberibacter asi 2e-08
254780933 947 valyl-tRNA synthetase [Candidatus Liberibacter asi 2e-05
>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Back     alignment
 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 21/178 (11%)

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS  NVIDP++VI+  G D  R F++ +    +D  +   G+           I  
Sbjct: 629 EKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDS--TYQFIQQIWR 686

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+          Y+       + T+ D S++S  ++ L+ I EN QN   ++A+A +  L
Sbjct: 687 LI----------YNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHEL 736

Query: 421 VSEVDR-YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
           V+ + +   +  K    KK+N DR ST+ Y    ++ +L I++   +P LA + + +L
Sbjct: 737 VNVISKPLMEIAK----KKSNADRISTIRY----ILEKLIIMMSPMIPHLAEECWQLL 786

>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Back     alignment
 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 8/188 (4%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K ++K ++     YP+   H+GH    +I DV+ARF R  G  VL   G D  G     A
Sbjct: 31  KNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENA 90

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYD---DFIRTTEKRHHDTCRILWKKISDKGD 118
           A+   V  K++  QN +  R     + +S D   DF       +H    +    +     
Sbjct: 91  AREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVI 150

Query: 119 IYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLS 178
           + K     W  +      N+  +    +G+ + +   PV+      +FF++S    +LL 
Sbjct: 151 VRKTAQVNWDPVEQTVLANEQVI----NGRGWRSDA-PVEQRSLPQWFFKISDLSQELLD 205

Query: 179 YYESHPEF 186
             E+  E+
Sbjct: 206 SIETLSEW 213

>gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Back     alignment
 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 115/269 (42%), Gaps = 47/269 (17%)

Query: 227 IMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILR--FHAIYWPAFLLSANL 284
           I+ VW D+   +    G   +P  +    WPAD+++ G D  R  F      +     + 
Sbjct: 562 ILDVWFDSACTHTILLG--KDPKLA----WPADVYLEGSDQHRGWFQHSLLESCATRGST 615

Query: 285 PLPKKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDK 343
           P    + +HGF +   GEK+SKS GNV+ P E+I E G D LRY+ V         ++D 
Sbjct: 616 PF-TSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAV------NSDYHDD 668

Query: 344 DGLKKRV---NADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQE 400
             L K +   N D    + N +   + M+  D  G  P+       ++ +L   + + Q 
Sbjct: 669 QRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHD-TGNEPSLADMPALEQLMLHRLTELDQV 727

Query: 401 IRE--------NMQNQLIHRALAQVISLVSEVDRYFDAQK-------PWELKKTNPDRAS 445
           +RE         +  QL + + A++ S       YFD +K       P  LK     R S
Sbjct: 728 VREAYDAFNFKEVVRQLTNFSNAELSSF------YFDIRKDSLYCDSPSSLK-----RLS 776

Query: 446 TVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           ++  + + + R L I +   +P  A + +
Sbjct: 777 SIAVIRI-LCRHLIIWIAPILPFTAEEAW 804

>gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Back     alignment
 Score = 40.8 bits (94), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 58/158 (36%), Gaps = 22/158 (13%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+   +     Y N   HIGHA   I+ DV+ R  ++   +  F  G D HG  I    +
Sbjct: 53  RKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVE 112

Query: 64  NAGV--------------------TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHH 103
           N  +                    +   +V   S+ F+ +  V D        T E    
Sbjct: 113 NEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQ 172

Query: 104 DTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEV 141
               +L  KI++   IY+G     +S+ ++    + E+
Sbjct: 173 IASELL--KIAESDQIYRGIKPIMWSIAEQTTLAEAEI 208

>gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Back     alignment
 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 16/96 (16%)

Query: 255 FWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKK-----------VFSHGFILHK-GEK 302
           ++P  + V G DIL F    W A ++   L   K            V+ H  +  K G+K
Sbjct: 537 YYPTSVLVTGFDILFF----WVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQK 592

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKD 338
           +SKS GNV+DPI+VI++ G DALR++       G+D
Sbjct: 593 MSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRD 628

>gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Back     alignment
 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 16/87 (18%)

Query: 12  AIAYPNAQP--HIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTT 69
           A+  PN     H+GHA+   I D++ RF R+ G +VL+  GTD           +AG+ T
Sbjct: 42  AMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTD-----------HAGIAT 90

Query: 70  KVFVDQNSRNFRDMADVL-DISYDDFI 95
           ++ V+  SR F   +    DI  D FI
Sbjct: 91  QITVE--SRLFAQSSLTREDIGRDAFI 115

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target511 methionyl-tRNA synthetase [Candidatus Liberibacter asia
315122341512 methionyl-tRNA synthetase [Candidatus Liberibacter sola 1 0.0
15888821516 methionyl-tRNA synthetase [Agrobacterium tumefaciens st 1 0.0
325292849516 Methionyl-tRNA synthetase [Agrobacterium sp. H13-3] Len 1 0.0
227822152516 methionyl-tRNA synthetase [Sinorhizobium fredii NGR234] 1 0.0
150396508516 methionyl-tRNA synthetase [Sinorhizobium medicae WSM419 1 0.0
116252220516 methionyl-tRNA synthetase [Rhizobium leguminosarum bv. 1 0.0
15965354516 methionyl-tRNA synthetase [Sinorhizobium meliloti 1021] 1 0.0
307317213516 methionyl-tRNA synthetase [Sinorhizobium meliloti AK83] 1 0.0
241204713516 methionyl-tRNA synthetase [Rhizobium leguminosarum bv. 1 0.0
327193417519 methionyl-tRNA synthetase protein [Rhizobium etli CNPAF 1 0.0
>gi|315122341|ref|YP_004062830.1| methionyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 512 Back     alignment and organism information
 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/510 (80%), Positives = 462/510 (90%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K REK YISTAIAYPNA+PHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDE+GQKIAK+
Sbjct: 3   KGREKFYISTAIAYPNAKPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEYGQKIAKS 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           AQNAG+ TK+FVDQNS +FR MADV  ISYDDFIRTTEKRHHDTCRILW+KI DKGDIYK
Sbjct: 63  AQNAGIETKIFVDQNSADFRQMADVFGISYDDFIRTTEKRHHDTCRILWQKILDKGDIYK 122

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
           G YSGWYSLRDE Y  DDEVYKG DGQ+YNAQ NPVQWMEEEGYFFRLSAYQDKLL+YY+
Sbjct: 123 GFYSGWYSLRDEMYCGDDEVYKGEDGQHYNAQKNPVQWMEEEGYFFRLSAYQDKLLAYYD 182

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           SHPEFILP+ERRNE++SFVKSGLKDLS+SRKTFDWGIKIP+DPQYIMYVWIDALTNYLT 
Sbjct: 183 SHPEFILPLERRNEIVSFVKSGLKDLSISRKTFDWGIKIPNDPQYIMYVWIDALTNYLTA 242

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
           TG L +P+G KAKFWPADLHVIGKDI+RFHA+YWPAFLLSANLPLPK +FSHGFIL+KGE
Sbjct: 243 TGLLPHPNGEKAKFWPADLHVIGKDIVRFHAVYWPAFLLSANLPLPKTIFSHGFILNKGE 302

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           KISKSLGNVIDP+EVI+E+GVDALRYFL+R+IACGKDGFYD + +K RVNADLANGIGNL
Sbjct: 303 KISKSLGNVIDPMEVIKEIGVDALRYFLIRDIACGKDGFYDINTVKNRVNADLANGIGNL 362

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           VSRS+SMI+K+Y G++P PG F E D+ IL  CS+ +QEIRE+M  QLIHRA+AQVIS+V
Sbjct: 363 VSRSISMIVKNYGGVMPNPGVFVEFDKEILYACSQNIQEIREHMDGQLIHRAVAQVISIV 422

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           SEVDRYF  QKPW+L KT+ DRA+TVLYVTV+V+RQLAILLQ FVP +ANKIFDIL +AD
Sbjct: 423 SEVDRYFATQKPWDLVKTDRDRAATVLYVTVDVVRQLAILLQPFVPGMANKIFDILSIAD 482

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           ENR F  LDQRLK G ++ K F P+FPRFL
Sbjct: 483 ENRSFAHLDQRLKVGLVIDKDFMPLFPRFL 512


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888821|ref|NP_354502.1| methionyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 516 Back     alignment and organism information
>gi|325292849|ref|YP_004278713.1| Methionyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 516 Back     alignment and organism information
>gi|227822152|ref|YP_002826123.1| methionyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 516 Back     alignment and organism information
>gi|150396508|ref|YP_001326975.1| methionyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 516 Back     alignment and organism information
>gi|116252220|ref|YP_768058.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 516 Back     alignment and organism information
>gi|15965354|ref|NP_385707.1| methionyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 516 Back     alignment and organism information
>gi|307317213|ref|ZP_07596654.1| methionyl-tRNA synthetase [Sinorhizobium meliloti AK83] Length = 516 Back     alignment and organism information
>gi|241204713|ref|YP_002975809.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 516 Back     alignment and organism information
>gi|327193417|gb|EGE60316.1| methionyl-tRNA synthetase protein [Rhizobium etli CNPAF512] Length = 519 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target511 methionyl-tRNA synthetase [Candidatus Liberibacter asia
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 0.0
PRK12267 648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 0.0
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 1e-138
KOG0436578 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [T 1e-129
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 1e-122
PLN02224616 PLN02224, PLN02224, methionine-tRNA ligase 1e-99
KOG1247567 KOG1247, KOG1247, KOG1247, Methionyl-tRNA synthetase [T 2e-40
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 1e-162
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 1e-130
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 1e-124
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 3e-60
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 9e-26
PRK00133 673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 1e-62
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 1e-25
cd07957129 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of 6e-37
cd07962135 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of 0.002
PLN02610 801 PLN02610, PLN02610, probable methionyl-tRNA synthetase 4e-34
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 2e-29
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 3e-23
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribo 4e-24
COG0060 933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, 7e-22
TIGR00392861 TIGR00392, ileS, isoleucyl-tRNA synthetase 8e-18
PRK05729 874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 3e-17
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 1e-13
COG0495814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, rib 7e-12
KOG0433 937 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [T 5e-11
KOG0432 995 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Trans 5e-10
KOG0435876 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Tran 1e-06
KOG0434 1070 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [T 3e-06
TIGR00395 938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 7e-06
PRK00133 673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 4e-20
cd00802143 cd00802, class_I_aaRS_core, catalytic core domain of cl 4e-11
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 1e-07
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, 2e-07
COG0060 933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, 6e-07
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 3e-05
PRK00390 805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 2e-04
pfam01406301 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) c 0.001
PRK06039 975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 0.001
TIGR00435465 TIGR00435, cysS, cysteinyl-tRNA synthetase 0.003
PRK06039 975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 1e-18
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 2e-06
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 9e-06
COG0495 814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, rib 2e-17
TIGR00396 842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 2e-11
KOG0435 876 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Tran 2e-09
PLN02563 963 PLN02563, PLN02563, aminoacyl-tRNA ligase 2e-06
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 1e-15
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, 2e-14
PRK13804 961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 1e-11
PRK05743 912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed 1e-10
PLN02843 974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 9e-09
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 2e-08
TIGR00396842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 2e-05
PLN02943 958 PLN02943, PLN02943, aminoacyl-tRNA ligase 2e-10
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; 6e-09
KOG0437 1080 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Tran 5e-07
PLN02959 1084 PLN02959, PLN02959, aminoacyl-tRNA ligase 1e-06
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; P 6e-04
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribo 3e-07
TIGR00395 938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 4e-07
PRK13208 800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 1e-06
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 2e-05
PRK05729 874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 4e-05
KOG0432 995 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Trans 1e-04
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; 2e-04
TIGR00392 861 TIGR00392, ileS, isoleucyl-tRNA synthetase 3e-04
PRK13804 961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 4e-04
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 0.003
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 6e-05
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 1e-04
cd00672213 cd00672, CysRS_core, catalytic core domain of cysteinyl 3e-04
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 3e-04
pfam08264148 pfam08264, Anticodon_1, Anticodon-binding domain 3e-04
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 8e-04
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information
>gnl|CDD|36461 KOG1247, KOG1247, KOG1247, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161872 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|153411 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of methionyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153416 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of valyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|178220 PLN02610, PLN02610, probable methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161854 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35654 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|161872 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|110410 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161877 TIGR00435, cysS, cysteinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178436 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178007 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|166584 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|185605 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185605 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|161854 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|149360 pfam08264, Anticodon_1, Anticodon-binding domain Back     alignment and domain information
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 511 methionyl-tRNA synthetase [Candidatus Liberibacter asia
PRK12267 644 methionyl-tRNA synthetase; Reviewed 100.0
PRK00133 666 metG methionyl-tRNA synthetase; Reviewed 100.0
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 100.0
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 100.0
PRK11893512 methionyl-tRNA synthetase; Reviewed 100.0
PRK12268558 methionyl-tRNA synthetase; Reviewed 100.0
KOG0436578 consensus 100.0
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 100.0
KOG1247567 consensus 100.0
PRK05729 877 valS valyl-tRNA synthetase; Reviewed 100.0
PRK13208809 valS valyl-tRNA synthetase; Reviewed 100.0
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 100.0
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK05743 910 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 100.0
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 100.0
PRK00390822 leuS leucyl-tRNA synthetase; Validated 100.0
TIGR00396916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 100.0
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 100.0
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 100.0
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 100.0
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 100.0
cd00814319 MetRS_core This is the catalytic core domain of methion 100.0
cd00817363 ValRS_core This is the catalytic core domain of valine 100.0
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 100.0
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 100.0
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 100.0
pfam00133606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 100.0
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 100.0
cd00672213 CysRS_core This is the catalytic core domain of cystein 99.96
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 99.75
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 99.71
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 99.7
cd00674354 LysRS_core_class_I This is the catalytic core domain of 99.68
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 99.29
PRK12558461 glutamyl-tRNA synthetase; Provisional 99.24
PRK12410433 glutamyl-tRNA synthetase; Provisional 99.23
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 99.1
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 99.04
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 99.01
KOG1149524 consensus 98.38
TIGR00463600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 98.28
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 100.0
KOG0432 995 consensus 100.0
KOG0435876 consensus 100.0
KOG0433 937 consensus 100.0
KOG0434 1070 consensus 100.0
KOG0437 1080 consensus 100.0
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 100.0
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 100.0
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 100.0
PRK12418384 cysteinyl-tRNA synthetase; Provisional 100.0
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 100.0
KOG2007586 consensus 100.0
PRK12451562 arginyl-tRNA synthetase; Reviewed 99.91
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 99.9
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 99.88
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 99.82
cd07957129 Anticodon_Ia_Met Anticodon-binding domain of methionyl 99.93
cd07961183 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archa 99.66
cd07962135 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA 99.65
cd07960180 Anticodon_Ia_Ile_BEm Anticodon-binding domain of bacter 99.56
cd07958117 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacter 99.41
cd07959117 Anticodon_Ia_Leu_AEc Anticodon-binding domain of archae 99.3
cd07375117 Anticodon_Ia_like Anticodon-binding domain of class Ia 99.2
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.83
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 99.68
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 99.04
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 99.04
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 98.9
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 98.73
PRK05347556 glutaminyl-tRNA synthetase; Provisional 98.35
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 98.31
KOG1147712 consensus 97.96
KOG1148764 consensus 97.35
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 97.02
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 96.84
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 96.79
TIGR00440564 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 Th 96.72
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 96.56
TIGR00233366 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 96.46
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 96.27
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 96.13
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 95.13
pfam08264148 Anticodon_1 Anticodon-binding domain. This domain is fo 99.42
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 98.66
KOG4426656 consensus 97.22
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 97.0
PRK13354405 tyrosyl-tRNA synthetase; Provisional 96.34
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 94.12
PRK05912402 tyrosyl-tRNA synthetase; Validated 93.82
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 93.75
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 97.84
TIGR00467539 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 Th 97.59
PRK08560333 tyrosyl-tRNA synthetase; Validated 97.08
PRK12285369 tryptophanyl-tRNA synthetase; Reviewed 97.01
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 96.65
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 95.89
pfam01927146 DUF82 Protein of unknown function DUF82. This prokaryot 95.25
cd07956156 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tR 97.67
KOG1195567 consensus 96.96
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 95.86
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 94.72
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 94.44
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 94.09
PRK13354405 tyrosyl-tRNA synthetase; Provisional 92.5
PRK05912402 tyrosyl-tRNA synthetase; Validated 92.24
PRK08560333 tyrosyl-tRNA synthetase; Validated 91.86
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 90.8
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 95.43
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 95.14
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 94.4
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 93.95
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 93.65
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 92.47
COG1656165 Uncharacterized conserved protein [Function unknown] 94.98
pfam05746117 DALR_1 DALR anticodon binding domain. This all alpha he 90.67
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0436 consensus Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1247 consensus Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>pfam01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS) Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS) Back     alignment and domain information
>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12410 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1149 consensus Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>KOG0434 consensus Back     alignment and domain information
>KOG0437 consensus Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>KOG2007 consensus Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd07957 Anticodon_Ia_Met Anticodon-binding domain of methionyl tRNA synthetases Back     alignment and domain information
>cd07961 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases Back     alignment and domain information
>cd07962 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA synthetases Back     alignment and domain information
>cd07960 Anticodon_Ia_Ile_BEm Anticodon-binding domain of bacterial and eukaryotic mitochondrial isoleucyl tRNA synthetases Back     alignment and domain information
>cd07958 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases Back     alignment and domain information
>cd07959 Anticodon_Ia_Leu_AEc Anticodon-binding domain of archaeal and eukaryotic cytoplasmic leucyl tRNA synthetases Back     alignment and domain information
>cd07375 Anticodon_Ia_like Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains Back     alignment and domain information
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain Back     alignment and domain information