254780224

254780224

hypothetical protein CLIBASIA_00545

GeneID in NCBI database:8209205Locus tag:CLIBASIA_00545
Protein GI in NCBI database:254780224Protein Accession:YP_003064637.1
Gene range:-(111601, 112749)Protein Length:382aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA
cHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHcccccEEcHHHHHHHHHHHcccHHHHHHHHHcHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHEEEcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHccHHHcHHHHcccccccHHHHHHHHHcccccHEEEEEccccccHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcc
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALsedhpdvsgtiilhspvlkdndlvdligrgnkLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYElvglspeiSEIFVEATMIWRELavgstvmepgIIAEKLLERMRKRnisglpagELLEMVERIYLDVNRRFVRSMATRSSRLIAAA
MSVQSFIKWaknaklqeriSIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVlsqskivqksitfrrtqiLFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRElavgstvmepGIIAEKLLERMRKRNIsglpagelleMVERIYLDVNRRFVrsmatrssrliaaa
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA
**VQSFIKWAK*****ERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQK*****************************QALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWREL***********IAEKLLERMRKRNISGLPAGELLEMVERIYLDV***********S*RL****
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRF**S************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA
MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
315122336382 hypothetical protein CKC_02940 [Candidatus Liberibacter 1 1e-158
209549435381 hypothetical protein Rleg2_1841 [Rhizobium leguminosaru 1 9e-63
241204761380 hypothetical protein Rleg_2040 [Rhizobium leguminosarum 1 1e-60
116252270380 hypothetical protein RL2524 [Rhizobium leguminosarum bv 1 1e-60
222086045379 hypothetical protein Arad_2466 [Agrobacterium radiobact 1 1e-60
218673678381 hypothetical protein RetlG_20018 [Rhizobium etli GR56] 1 6e-56
190891871391 hypothetical protein RHECIAT_CH0002280 [Rhizobium etli 1 1e-54
325293124384 hypothetical protein AGROH133_06700 [Agrobacterium sp. 1 1e-54
86357808333 hypothetical protein RHE_CH02192 [Rhizobium etli CFN 42 1 6e-54
222148643382 hypothetical protein Avi_2223 [Agrobacterium vitis S4] 1 1e-52
>gi|315122336|ref|YP_004062825.1| hypothetical protein CKC_02940 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 382 Back     alignment and organism information
 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 285/382 (74%), Positives = 330/382 (86%)

Query: 1   MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLS 60
           MSVQSFIKWAK AKLQERI IARILGRTWCMEELL  EKDSLVLAM HLLDDPSS+VRLS
Sbjct: 1   MSVQSFIKWAKTAKLQERICIARILGRTWCMEELLADEKDSLVLAMTHLLDDPSSQVRLS 60

Query: 61  LARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASR 120
           LARAIALS+TAPKHV+LALSEDHPDVSGTIILHSPVL DNDL+DLI RG  LT IF+ASR
Sbjct: 61  LARAIALSNTAPKHVILALSEDHPDVSGTIILHSPVLNDNDLIDLIARGGNLTCIFIASR 120

Query: 121 HKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLS 180
           ++LSHVV ENLIE GC+DNI+ALL NKS  LS+ LLM+I + F H+  IRNLLSLR+DLS
Sbjct: 121 YQLSHVVAENLIEIGCIDNIIALLENKSACLSSVLLMRIAKLFSHNPYIRNLLSLRSDLS 180

Query: 181 LKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVD 240
           LKARYLL+K+VCN L QSKI+   I+FRR ++L EE++RVGILEM+S+V D Q + ELV+
Sbjct: 181 LKARYLLIKNVCNSLCQSKIMNTVISFRRIKVLSEENIRVGILEMVSNVNDSQNISELVE 240

Query: 241 LLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVG 300
           +L ++GQLTP LLIYAI+IG+I FVS+ILA I+EY+ DRVYSILSTGGFHV+ +LYELVG
Sbjct: 241 ILQEEGQLTPVLLIYAIVIGSIQFVSIILAKISEYNQDRVYSILSTGGFHVVRSLYELVG 300

Query: 301 LSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMRKRNISGLPAGELLEMVERIY 360
           L+ +ISEIFVEATMIWRE+AV S V+ P II EKLLER+RKRNI G P  ELLEM+ERI+
Sbjct: 301 LTSDISEIFVEATMIWREIAVDSVVINPSIIVEKLLERVRKRNIRGFPKEELLEMIERIH 360

Query: 361 LDVNRRFVRSMATRSSRLIAAA 382
           LDVNRRFVRS+  +SSR I AA
Sbjct: 361 LDVNRRFVRSIENKSSRFIVAA 382


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209549435|ref|YP_002281352.1| hypothetical protein Rleg2_1841 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 381 Back     alignment and organism information
>gi|241204761|ref|YP_002975857.1| hypothetical protein Rleg_2040 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 380 Back     alignment and organism information
>gi|116252270|ref|YP_768108.1| hypothetical protein RL2524 [Rhizobium leguminosarum bv. viciae 3841] Length = 380 Back     alignment and organism information
>gi|222086045|ref|YP_002544577.1| hypothetical protein Arad_2466 [Agrobacterium radiobacter K84] Length = 379 Back     alignment and organism information
>gi|218673678|ref|ZP_03523347.1| hypothetical protein RetlG_20018 [Rhizobium etli GR56] Length = 381 Back     alignment and organism information
>gi|190891871|ref|YP_001978413.1| hypothetical protein RHECIAT_CH0002280 [Rhizobium etli CIAT 652] Length = 391 Back     alignment and organism information
>gi|325293124|ref|YP_004278988.1| hypothetical protein AGROH133_06700 [Agrobacterium sp. H13-3] Length = 384 Back     alignment and organism information
>gi|86357808|ref|YP_469700.1| hypothetical protein RHE_CH02192 [Rhizobium etli CFN 42] Length = 333 Back     alignment and organism information
>gi|222148643|ref|YP_002549600.1| hypothetical protein Avi_2223 [Agrobacterium vitis S4] Length = 382 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
pfam10098263 pfam10098, DUF2336, Uncharacterized protein conserved i 3e-24
COG5330364 COG5330, COG5330, Uncharacterized protein conserved in 2e-29
>gnl|CDD|150738 pfam10098, DUF2336, Uncharacterized protein conserved in bacteria (DUF2336) Back     alignment and domain information
>gnl|CDD|34910 COG5330, COG5330, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
COG5330364 Uncharacterized protein conserved in bacteria [Function 100.0
pfam10098263 DUF2336 Uncharacterized protein conserved in bacteria ( 100.0
COG5330364 Uncharacterized protein conserved in bacteria [Function 98.62
pfam10098263 DUF2336 Uncharacterized protein conserved in bacteria ( 96.58
PRK09687280 hypothetical protein; Provisional 96.65
KOG2025 892 consensus 91.22
>COG5330 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10098 DUF2336 Uncharacterized protein conserved in bacteria (DUF2336) Back     alignment and domain information
>COG5330 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10098 DUF2336 Uncharacterized protein conserved in bacteria (DUF2336) Back     alignment and domain information
>PRK09687 hypothetical protein; Provisional Back     alignment and domain information
>KOG2025 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
1ejl_I 460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 0.003
1q1s_C 466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 0.004
>gi|7766973|pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
 Score = 47.7 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 54/184 (29%), Gaps = 22/184 (11%)

Query: 128 VENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLRTDLSLKARYLL 187
            + +++ G +   ++LL +    +S   +  +       ++ R+L+     +      L 
Sbjct: 86  TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLA 145

Query: 188 MKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGILEMISHVRDVQALRELVDLLHDDGQ 247
           +  +  +                  L         L+ +        L  LV LLH +  
Sbjct: 146 VPDLSTLACGYLRNLTW----TLSNLCRNKNPAPPLDAVEQ-----ILPTLVRLLHHN-- 194

Query: 248 LTPALLIYAIMIGAIDFVSVILANIAEYSTDRVYSILSTGGFHVICALYELVGLSPEISE 307
             P +L  +            ++ + +   +R+  ++  G    +  L     L      
Sbjct: 195 -DPEVLADS---------CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT-P 243

Query: 308 IFVE 311
               
Sbjct: 244 ALRA 247


>gi|47168602|pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 6e-06
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 47.3 bits (111), Expect = 6e-06
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 5/29 (17%)

Query: 233 QALREL---VDLLHDDGQLTPALLIYAIM 258
           QAL++L   + L  DD    PAL I A M
Sbjct: 20  QALKKLQASLKLYADDS--APALAIKATM 46


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich repeats, 98.46
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich repeats, 98.11
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, prot 94.13
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, prot 91.6
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
Probab=98.46  E-value=9.1e-09  Score=70.59  Aligned_cols=142  Identities=15%  Similarity=0.156  Sum_probs=90.9

Q ss_pred             HHHHHHH--------HCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCHH
Q ss_conf             8999998--------41799789999999999996357899899999999999985196989999999982148789889
Q gi|254780224|r    3 VQSFIKW--------AKNAKLQERISIARILGRTWCMEELLDQEKDSLVLAMMHLLDDPSSRVRLSLARAIALSDTAPKH   74 (382)
Q Consensus         3 v~~fl~~--------~~~a~~~~Ra~~a~~l~r~~~~~~l~~~er~~a~~iL~~L~~d~~~~vR~alA~~La~~~~aP~~   74 (382)
                      |..|.+|        ..+...+.|+.+++.         .+       ...|..|++|+++.||..+|.+|      |.+
T Consensus        44 i~rf~~~~p~la~~~l~~p~~evRa~aAr~---------a~-------~~~L~~Ll~D~d~~VR~~aA~~L------~~~  101 (244)
T 1lrv_A           44 IDRFFRNNPHLAVQYLADPFWERRAIAVRY---------SP-------VEALTPLIRDSDEVVRRAVAYRL------PRE  101 (244)
T ss_dssp             HHHHHHHCGGGGGGGTTCSSHHHHHHHHTT---------SC-------GGGGGGGTTCSSHHHHHHHHTTS------CSG
T ss_pred             HHHHHHHCHHHHHHHCCCCCHHHHHHHHHH---------CC-------HHHHHHHHCCCCHHHHHHHHHHC------CHH
T ss_conf             999987599999987049979999999862---------99-------99999880697989999999978------999


Q ss_pred             HHHHHCCCCHHHHHHHHHHCCCCCHHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHCCCCCCCHH
Q ss_conf             99987089778999999738589989999999549999999986299999899999984398999999860899846946
Q gi|254780224|r   75 VVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNS  154 (382)
Q Consensus        75 vi~~LA~D~~~vA~pvL~~Sp~L~d~dLv~ia~~~~~~~~~AIA~R~~ls~~V~~aLae~gd~~v~~~Ll~N~~A~is~~  154 (382)
                      .+..|..|++.-++-.+..+  |+...|..++.+.++.+|.+++++  ++..+...+....+..|....+.|-+.    .
T Consensus       102 ~L~~L~~D~d~~VR~~aa~~--L~~~~L~~Ll~D~d~~VR~aaa~~--~~~~~L~~l~~d~d~~VR~~aA~~l~~----~  173 (244)
T 1lrv_A          102 QLSALMFDEDREVRITVADR--LPLEQLEQMAADRDYLVRAYVVQR--IPPGRLFRFMRDEDRQVRKLVAKRLPE----E  173 (244)
T ss_dssp             GGGGTTTCSCHHHHHHHHHH--SCTGGGGGGTTCSSHHHHHHHHHH--SCGGGGGGTTTCSCHHHHHHHHHHSCG----G
T ss_pred             HHHHHHCCCCHHHHHHHHHH--CCHHHHHHHHCCCCHHHHHHHHHC--CCHHHHHHHHCCCCHHHHHHHHHHCCH----H
T ss_conf             99998249898899999982--999999988329988988887612--674899998729988899999860057----9


Q ss_pred             HHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7999999817898999998624
Q gi|254780224|r  155 LLMQIVERFCHDASIRNLLSLR  176 (382)
Q Consensus       155 ~l~~lv~ra~~~~~l~~~L~~R  176 (382)
                      .+..+.  ...++.++...+.+
T Consensus       174 ~L~~l~--~D~d~~VR~~aa~~  193 (244)
T 1lrv_A          174 SLGLMT--QDPEPEVRRIVASR  193 (244)
T ss_dssp             GGGGST--TCSSHHHHHHHHHH
T ss_pred             HHHHHH--CCCCHHHHHHHHHC
T ss_conf             999986--17978999999980



>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandii [Ta 98.44
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandii [Ta 98.26
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Leucine-rich repeat variant
domain: Leucine-rich repeat variant
species: Azotobacter vinelandii [TaxId: 354]
Probab=98.44  E-value=2.2e-08  Score=66.76  Aligned_cols=117  Identities=15%  Similarity=0.137  Sum_probs=88.5

Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCHHHHHHHHHCCCHHHHHHHHCCCCC
Q ss_conf             99999851969899999999821487898899998708977899999973858998999999954999999998629999
Q gi|254780224|r   44 LAMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHKL  123 (382)
Q Consensus        44 ~iL~~L~~d~~~~vR~alA~~La~~~~aP~~vi~~LA~D~~~vA~pvL~~Sp~L~d~dLv~ia~~~~~~~~~AIA~R~~l  123 (382)
                      ..|..|++|+++.||...+.+|      |.+.+..|..|++..++..+..+  |+...|..++.+++..+|.+++++  +
T Consensus        69 ~~L~~Ll~D~d~~VR~~AA~~L------p~~~L~~L~~D~d~~VR~~aa~~--l~~~~L~~Ll~D~d~~VR~~aa~~--~  138 (233)
T d1lrva_          69 EALTPLIRDSDEVVRRAVAYRL------PREQLSALMFDEDREVRITVADR--LPLEQLEQMAADRDYLVRAYVVQR--I  138 (233)
T ss_dssp             GGGGGGTTCSSHHHHHHHHTTS------CSGGGGGTTTCSCHHHHHHHHHH--SCTGGGGGGTTCSSHHHHHHHHHH--S
T ss_pred             HHHHHHHCCCCHHHHHHHHHHC------CHHHHHHHHCCCCHHHHHHHHHC--CCHHHHHHHHCCCCHHHHHHHHHC--C
T ss_conf             9999882698989999999974------89999998449974689988742--688999998559987899999861--1


Q ss_pred             CHHHHHHHHHCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             98999999843989999998608998469467999999817898999998624
Q gi|254780224|r  124 SHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERFCHDASIRNLLSLR  176 (382)
Q Consensus       124 s~~V~~aLae~gd~~v~~~Ll~N~~A~is~~~l~~lv~ra~~~~~l~~~L~~R  176 (382)
                      +..+...++.+++..|...++.|.+..    .+..++  ...++.++...+.+
T Consensus       139 ~~~~L~~L~~D~d~~VR~~aA~~~~~~----~L~~l~--~D~d~~VR~~aa~~  185 (233)
T d1lrva_         139 PPGRLFRFMRDEDRQVRKLVAKRLPEE----SLGLMT--QDPEPEVRRIVASR  185 (233)
T ss_dssp             CGGGGGGTTTCSCHHHHHHHHHHSCGG----GGGGST--TCSSHHHHHHHHHH
T ss_pred             CHHHHHHHHCCCCHHHHHHHHHHCCHH----HHHHHC--CCCCHHHHHHHHHH
T ss_conf             066899883489789999999845999----999870--59988999999984



>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target382 hypothetical protein CLIBASIA_00545 [Candidatus Liberib
1lrv_A_1-128128 LRV, leucine-rich repeat variant; leucine-rich rep 94.76
1lrv_A_1-128128 LRV, leucine-rich repeat variant; leucine-rich rep 93.25
1lrv_A_129-244116 LRV, leucine-rich repeat variant; leucine-rich rep 90.23
>1lrv_A (A:1-128) LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} Back     alignment and structure
Probab=94.76  E-value=0.014  Score=33.33  Aligned_cols=70  Identities=21%  Similarity=0.207  Sum_probs=52.8

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCHHHHHHHHHCCCHHHHHHHHCCCC
Q ss_conf             999985196989999999982148789889999870897789999997385899899999995499999999862999
Q gi|254780224|r   45 AMMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVDLIGRGNKLTSIFVASRHK  122 (382)
Q Consensus        45 iL~~L~~d~~~~vR~alA~~La~~~~aP~~vi~~LA~D~~~vA~pvL~~Sp~L~d~dLv~ia~~~~~~~~~AIA~R~~  122 (382)
                      ....++.||...||..+|      ..+|...+-.|.+|+++.++-..+.  .|+.+-|..++.+.+.+++..||.|-.
T Consensus        54 LA~~~L~dP~~EVRaiaA------Rr~~~~~L~~L~~DpD~~VR~~VA~--RLp~~~L~~l~~DpD~eVR~~VA~RL~  123 (128)
T 1lrv_A           54 LAVQYLADPFWERRAIAV------RYSPVEALTPLIRDSDEVVRRAVAY--RLPREQLSALMFDEDREVRITVADRLP  123 (128)
T ss_dssp             GGGGGTTCSSHHHHHHHH------TTSCGGGGGGGTTCSSHHHHHHHHT--TSCSGGGGGTTTCSCHHHHHHHHHHSC
T ss_pred             HHHHHHCCCCHHHHHHHH------HHCCHHHHHHHHCCCCHHHHHHHHH--HCCHHHHHHHHCCCCHHHHHHHHHHCC
T ss_conf             999884399899999988------5099999998816989899999999--768999999835998899999999689



>1lrv_A (A:1-128) LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} Back     alignment and structure
>1lrv_A (A:129-244) LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} Back     alignment and structure