254780229

254780229

hypothetical protein CLIBASIA_00570

GeneID in NCBI database:8209210Locus tag:CLIBASIA_00570
Protein GI in NCBI database:254780229Protein Accession:YP_003064642.1
Gene range:-(118077, 123404)Protein Length:1775aa
Gene description:hypothetical protein
COG prediction:[L] Superfamily I DNA and RNA helicases and helicase subunits
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770-----
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELRELISQKSSSTRE
ccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccccccEEcccEEHHHHHEEcccccccccccEEEEEEcccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccEEEccccccEEEEcccccHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccHHHHHHHHHHHHcccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccEEHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEccHHHHHccccccccccEEEEEcHHHccHHHHHHHHHcccEEEEEccccccccEEcccccccHHHcccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEEccHHHcccccccEEEEEEEEccccccccHHHHcccccccccccHHHHHHHHHccEEEEEEcccHHHccHHHHccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccEEEEccccccccEEEEEEcccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHcHHHHHHHHHHHHHHHHHHccccccc
ccccccccHHHHHHHHHHHHHHcccccHHHHcHccccccEEEccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHccccEEHHHHHHHcccccccccccHHHccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHEEEccccccccccEccEEEEEEEEEEcccccccEEEEEEEEEccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccEEccHHEEccccHHHcEEHccccccccHHccHHHHHcHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccHHHcccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccEHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHcHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHcEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEccHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHccEEEEEcccccccccHHHcccccccccHHHHHHHccHHHHHHHHHHcccHHHHHHHccccccHHHEcccHHHccccEEEccccccccccccEEEEEEccccEcccccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccEEEEcHHHcccccccEEEEEEEEcccccccEEEEccccccccccccHHEEEEEHccccEEEEEcccHHHcccccccccHHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHcccEEEcccccccEEEEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccHcccHHHHHHHHHHHHHHHHHHccccccc
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVmqfmplpmptkkqaqaygfadtgnhhtidestWIEKLglsinydlpieydsddekKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIkenkplkpphfqnnlsdnqIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLewyeiddydnprlaplftipvalekrsstsqpgltqyhLRYTGEEIILNLSLKEKLQSDFGIILpaiaegmwpedYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDldhlrwpegednilNHDIIQRLFIAqscdhdkdnassnqnieykideiedihqrcpliddsdssqhsAVIDVingknliiegppgtgksqTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRidnrniktvpqEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAAryrhnlpldpvqlhveglsgeNADRLLRSRLEDQIKAFKDVIVEFHKQAGesmelmnhpwygvhssdihILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAvdqvpslprVICFKAFKKLEDSSIASIKQWIVDFSHlqddfndinihldpkkleelkvgkdipyfpdlsgefgisaesSFKDIRNTISSLQKMMVSCEKYWESFSglmqcfppvfsqkilpnrqgFENAVLLMELAVELPVSLLRLRddffnnsgIDSVLEELFERLDSLKILQESLDDvfnmkklpdaqVLQDLNKVLHSAgllsswwgaSCKKAKASLLSLaknpgiswkKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQkelqnrsalfvgegnvFDSLIQRLShnfdpwqnwfkEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFgeeiklsvfdsntkesnKSLAVINSTLEFAHSIRERVLFDELIQGinhiddhtiYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRnseaikkprwlNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEIltekphlmhysaVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIaqgisgglksdyTELSLIRSElgkknrnipIRQLISRAKNSllqlkpcfmmspmsvanylepkdvkfDLVImdessqikpedalgviargkqivvvgdpkqlpptrffdhdndqedydEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENliacsnyyfydnslivfpspytsvdrygvgfthvkngvvvdqgnPEEARVIALAVKDhalrypeeslGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNlenvqgderdrifisftygphepggrvfqrfgpinsdigwRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAetgymehslktktnkqdsDFAVSVVNELEKtgfacdsqlgdmgfSIDVvvrdpnnpghylmgiecdgamynsaksarDRDRLRQEVLERMGWRIRRIWsvdwfsnpdevIEPIIRELRELISqkssstre
mnnynikhvRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLivediktsndlvdirEIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEksqisiketGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVAlekrsstsqpgltqYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLElhshkvhkrailddlrkridnrniktvpqeidvEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGntlgehyrglsTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLsvfdsntkesnkSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLIsrnseaikkprwLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIasvignqkiaqgisgglksdYTELSLIRSelgkknrnipiRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIvvvgdpkqlpptRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGvvvdqgnpEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKlrmhadpffiKNLENVQGDERDRIFISFTYGPHEPGGRVFQrfgpinsdigwrrlnvlftrsrrrievfstmryldvvvdidsklgiRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSaksardrdRLRQEVLErmgwrirriwsvdwfsnpdEVIEPIIRELRelisqkssstre
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGasckkakasllslakNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDeviepiirelreliSQKSSSTRE
******K***QCLDDMRRKLLDCSVQNKLLNFRM*Q******FNTSPNQLYQQIFREEVMQFMPLPMPTKK*******A***NHHTIDESTWI**L**********************VLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSI*************************HFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWP*****ILNHDIIQRLFIAQSC**********************IHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHS**************R*****************TRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIA*******************************QLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQ**YDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHV*********NPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAE******************FAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELR************
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEK********LTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNS*********LRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELRELI*********
*NNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMP*****************TIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSC*HDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELRELISQK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQExxxxxxxxxxxxxxxxxxxxxINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELRELISQKSSSTRE
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELRELISQKSSSTRE
MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIEPIIRELRELISQKSSSTRE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1775 hypothetical protein CLIBASIA_00570 [Candidatus Liberib
3151227861786 hypothetical protein CKC_05205 [Candidatus Liberibacter 1 0.0
323937166 1911 hypothetical protein ERCG_01734 [Escherichia coli E1520 1 0.0
323972583 1911 hypothetical protein ERHG_01326 [Escherichia coli TA007 1 0.0
300956025 1915 hypothetical protein HMPREF9547_01877 [Escherichia coli 1 0.0
114049182 1904 hypothetical protein Shewmr7_3695 [Shewanella sp. MR-7] 1 0.0
300837092 1911 hypothetical protein pKP048_p153 [Klebsiella pneumoniae 1 0.0
167623675 1916 hypothetical protein Shal_1744 [Shewanella halifaxensis 1 0.0
1676236751916 hypothetical protein Shal_1744 [Shewanella halifaxensis 1 2e-08
3129739101367 superfamily I DNA and RNA helicases and helicase subuni 1 0.0
297624445 1819 transcription elongation factor GreA/GreB domain-contai 1 0.0
>gi|315122786|ref|YP_004063275.1| hypothetical protein CKC_05205 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1786 Back     alignment and organism information
 Score = 2939 bits (7618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1414/1772 (79%), Positives = 1584/1772 (89%), Gaps = 1/1772 (0%)

Query: 1    MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNTSPNQLYQQIFREEVM 60
            M+NY  KHV +CL+DMRRKLLD +VQNKLLNFR+D Q  LRIFNTSPNQLYQQIFREEVM
Sbjct: 7    MDNYKRKHVLECLEDMRRKLLDRTVQNKLLNFRIDHQCALRIFNTSPNQLYQQIFREEVM 66

Query: 61   QFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDLPIEYDSDDEKKNYQVL 120
            QFMPLPMPTKKQA+  G +D  N+H IDE  WIEKLG SI YDLP+EY  DDE+KN+Q L
Sbjct: 67   QFMPLPMPTKKQARENGLSDVDNYHDIDEQAWIEKLGFSIIYDLPVEYKLDDEEKNHQTL 126

Query: 121  QKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGYADIEDLERAIKENKPLK 180
            +K+RD I EDIKTS+D +DI  +EKK  I L++L S+IQNYGY DIEDLERA+++NKPL 
Sbjct: 127  RKIRDFICEDIKTSDDPIDINGLEKKTGIGLKELNSLIQNYGYDDIEDLERAVRDNKPLN 186

Query: 181  PPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGTSILYIVLGFLEWYEIDDY 240
             PH+QN+L+DNQIQTAYFQDKLE +LR INEKSQ SI+ETGTSILY+VLGFLEWYE DDY
Sbjct: 187  LPHYQNHLADNQIQTAYFQDKLEFVLRAINEKSQSSIRETGTSILYVVLGFLEWYEADDY 246

Query: 241  DNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILNLSLKEKLQSDFGIILPAIA 300
            +NPRLAPLFTIPV+LE+R+S SQ  L+QY LRYTGEEI+LN SLKEKLQSDFGIILP I 
Sbjct: 247  ENPRLAPLFTIPVSLERRNSASQSSLSQYQLRYTGEEILLNFSLKEKLQSDFGIILPPIE 306

Query: 301  EGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKMLMYLDLDHLRWPEGEDNILNH 360
            EGMWPEDYFLQIQKIIEESK HWAVRRYGVLGLLNFSKMLM LDLDHLRW EG+DNILNH
Sbjct: 307  EGMWPEDYFLQIQKIIEESKPHWAVRRYGVLGLLNFSKMLMCLDLDHLRWAEGDDNILNH 366

Query: 361  DIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRCPLIDDSDSSQHSAVIDVINGK 420
            DIIQRLF+AQS DHDK+   +NQ+ EY IDEIE IH   PLIDD+DSSQHSA+IDV+NGK
Sbjct: 367  DIIQRLFVAQSRDHDKETTCANQDTEYNIDEIEGIHHNFPLIDDADSSQHSALIDVMNGK 426

Query: 421  NLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLGEFCLELH 480
            NL+IEGPPGTGKSQTITNIIA AMLHGKKILFCAQKMAAIEVV+ RLEKAGLG+FCLELH
Sbjct: 427  NLVIEGPPGTGKSQTITNIIANAMLHGKKILFCAQKMAAIEVVKQRLEKAGLGDFCLELH 486

Query: 481  SHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELKGQLNQYAQEINQIWKNTELS 540
            SHKVHKRAILDDLRKRIDNRN++  P+EIDVEITRYEELKGQLNQYAQEINQIWKNTELS
Sbjct: 487  SHKVHKRAILDDLRKRIDNRNLQKSPKEIDVEITRYEELKGQLNQYAQEINQIWKNTELS 546

Query: 541  IHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLLRSRLEDQIKAFKDVIVEFHKQAGE 600
            IHQILMG+ARY HNLPLDP QLHVEGLSGENADRLL SRLEDQIKAF+DVI+EFHKQAGE
Sbjct: 547  IHQILMGSARYCHNLPLDPAQLHVEGLSGENADRLLLSRLEDQIKAFRDVIIEFHKQAGE 606

Query: 601  SMELMNHPWYGVHSSDIHILNYNKALSSLENWQSALIKWQKDHEVFLNRYGVQNQRQRLL 660
            SMELMNHPWYGVHSSDIH+LNY  ALSSL NWQ+ALI WQK HE FL +YG+ NQRQ+LL
Sbjct: 607  SMELMNHPWYGVHSSDIHVLNYRNALSSLSNWQTALIDWQKSHESFLEKYGIHNQRQQLL 666

Query: 661  YWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIASIKQWIVDFSHLQDDFNDINIHLDPK 720
            YWQGQ + AV+QVP+LP+++CF+AFKKL+D SIASI+QWI DFSH++DDF+DI  +L PK
Sbjct: 667  YWQGQFINAVEQVPTLPQLVCFEAFKKLDDDSIASIQQWIEDFSHIRDDFDDIKTYLAPK 726

Query: 721  KLEELKVGKDIPYFPDLSGEFGISAESSFKDIRNTISSLQKMMVSCEKYWESFSGLMQCF 780
            K+++LK+GK+I +  DLS EFGI AESSFKDI   ISSLQKM VSCEKYWESFSGL+QCF
Sbjct: 727  KIDDLKIGKEISFSFDLSEEFGIDAESSFKDISKIISSLQKMKVSCEKYWESFSGLIQCF 786

Query: 781  PPVFSQKILPNRQGFENAVLLMELAVELPVSLLRLRDDFFNNSGIDSVLEELFERLDSLK 840
            PPVF+Q I  +RQGF+NAVLLM+LAVELPVSLLRLRD FF+NSGIDSVLE+L ERLDSL 
Sbjct: 787  PPVFAQNIRADRQGFQNAVLLMDLAVELPVSLLRLRDSFFDNSGIDSVLEDLAERLDSLN 846

Query: 841  ILQESLDDVFNMKKLPDAQVLQDLNKVLHSAGLLSSWWGASCKKAKASLLSLAKNPGISW 900
            ILQ SL+DVFN+KKLPDA+VLQDLNK LHS+ L SSW  +S K+AK SLLSLAKN  ISW
Sbjct: 847  ILQASLEDVFNIKKLPDAKVLQDLNKELHSSALFSSW-SSSWKQAKKSLLSLAKNHSISW 905

Query: 901  KKLYAQLPNAYQFAVEKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDN 960
            KKLYAQLPNA+QF VE++KLEK+NF   LGEHYRGLSTDI AL NIREWYRKVHQ+WKD+
Sbjct: 906  KKLYAQLPNAHQFVVERDKLEKKNFSKILGEHYRGLSTDIGALINIREWYRKVHQVWKDH 965

Query: 961  SSLDDALINGFLMLDSQLFKRIQKLHCDELSKKITKVFGRIQELEQFLPKQKELQNRSAL 1020
            S LDD LINGFLMLDSQLFK IQKLH +EL +KITKV  RI ELEQ LPKQKELQ  SA+
Sbjct: 966  SGLDDVLINGFLMLDSQLFKGIQKLHREELGQKITKVLDRIIELEQVLPKQKELQEHSAI 1025

Query: 1021 FVGEGNVFDSLIQRLSHNFDPWQNWFKEDEILLQEAQEFSAKLHKIREKNIVLAEESLIK 1080
            FVGE N+F SLIQ+LSH+F+P Q+ F  D+ILLQ+A+E   KLH+I+ KNI L E SLIK
Sbjct: 1026 FVGEDNIFHSLIQKLSHSFEPLQSCFNGDDILLQKAKEIGEKLHQIQHKNIALEERSLIK 1085

Query: 1081 KFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNS 1140
             FFGE+IK SVF SN+KES  SL VINSTLEF  SI+++VLFDEL++GINHI+D   Y+ 
Sbjct: 1086 CFFGEKIKPSVFASNSKESAHSLEVINSTLEFISSIKKQVLFDELMEGINHINDRHSYDI 1145

Query: 1141 FIKDLKNLRMIWQQQVKTQEDFIEDTQLDMAQWAARCNDELVKLISRNSEAIKKPRWLNG 1200
            FIKDLK LR++WQ+Q+K Q+ FI+DTQLD+AQW  RCND+L+ LI+RN++AI KPRWLNG
Sbjct: 1146 FIKDLKKLRIVWQKQIKKQDSFIQDTQLDLAQWTLRCNDKLLTLIARNADAINKPRWLNG 1205

Query: 1201 WVNLMHMVQDMQDKGLKEIQAAIFNNSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYS 1260
            W+NLMHMV DMQ KGLK IQ AIFNN+LDVK LES LLAAIYHQLS+EILTEKPHLMHYS
Sbjct: 1206 WINLMHMVHDMQGKGLKAIQEAIFNNTLDVKQLESGLLAAIYHQLSREILTEKPHLMHYS 1265

Query: 1261 AVQFTAKQERFREYDKRLQFLQRQRIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKK 1320
             VQFTAKQERFREYDK+LQ LQRQ IASVIGNQKI QGISGGLKSDYTELSLIRSELGKK
Sbjct: 1266 GVQFTAKQERFREYDKKLQILQRQHIASVIGNQKITQGISGGLKSDYTELSLIRSELGKK 1325

Query: 1321 NRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALG 1380
            +RNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKD+KFDLVIMDESSQIKPEDALG
Sbjct: 1326 SRNIPIRQLISRAKNSLLQLKPCFMMSPMSVANYLEPKDIKFDLVIMDESSQIKPEDALG 1385

Query: 1381 VIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQW 1440
            VIARGKQ+VVVGDPKQLPPTRFFDHD +Q DYDEEVAAVSQTESILDALLPLFSMRRLQW
Sbjct: 1386 VIARGKQVVVVGDPKQLPPTRFFDHDGEQGDYDEEVAAVSQTESILDALLPLFSMRRLQW 1445

Query: 1441 HYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIA 1500
            HYRSLNENLIACSNY+FYDNSLIVFPSPYT+V+RYG+GFTHVKNG+++DQ NPEEARVIA
Sbjct: 1446 HYRSLNENLIACSNYHFYDNSLIVFPSPYTNVERYGIGFTHVKNGMIIDQYNPEEARVIA 1505

Query: 1501 LAVKDHALRYPEESLGVIAMNAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKN 1560
            LAVKDHA+++P ESLGV+AMNAKQRD IE+ INKLCRKDS + KAIS LRMH+DPFF+KN
Sbjct: 1506 LAVKDHAMQHPTESLGVVAMNAKQRDQIENEINKLCRKDSAIGKAISNLRMHSDPFFVKN 1565

Query: 1561 LENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTM 1620
            LENVQGDERDRIFISFTYGP+EPGGR+FQRFGPINSD+GWRRLNVLFTR+R+RI+VFSTM
Sbjct: 1566 LENVQGDERDRIFISFTYGPNEPGGRIFQRFGPINSDVGWRRLNVLFTRARKRIDVFSTM 1625

Query: 1621 RYLDVVVDIDSKLGIRVMRDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFAC 1680
            RYLD++VD DSKLGIRVMRDFLHFAE G+MEHSLK  T K DSDFA+SV  EL+K GF C
Sbjct: 1626 RYLDIMVDADSKLGIRVMRDFLHFAEMGHMEHSLKKNTEKIDSDFAMSVKEELKKVGFDC 1685

Query: 1681 DSQLGDMGFSIDVVVRDPNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIR 1740
            D+QLGDMGFS+DV V DP+NPG+YLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIR
Sbjct: 1686 DTQLGDMGFSLDVAVYDPSNPGYYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIR 1745

Query: 1741 RIWSVDWFSNPDEVIEPIIRELRELISQKSSS 1772
            RIWSVDWFSNPDE IEPIIRELR+L  + + +
Sbjct: 1746 RIWSVDWFSNPDEAIEPIIRELRQLTKKSNHA 1777


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|323937166|gb|EGB33446.1| hypothetical protein ERCG_01734 [Escherichia coli E1520] Length = 1911 Back     alignment and organism information
>gi|323972583|gb|EGB67786.1| hypothetical protein ERHG_01326 [Escherichia coli TA007] Length = 1911 Back     alignment and organism information
>gi|300956025|ref|ZP_07168354.1| hypothetical protein HMPREF9547_01877 [Escherichia coli MS 175-1] Length = 1915 Back     alignment and organism information
>gi|114049182|ref|YP_739732.1| hypothetical protein Shewmr7_3695 [Shewanella sp. MR-7] Length = 1904 Back     alignment and organism information
>gi|300837092|ref|YP_003754146.1| hypothetical protein pKP048_p153 [Klebsiella pneumoniae] Length = 1911 Back     alignment and organism information
>gi|167623675|ref|YP_001673969.1| hypothetical protein Shal_1744 [Shewanella halifaxensis HAW-EB4] Length = 1916 Back     alignment and organism information
>gi|167623675|ref|YP_001673969.1| hypothetical protein Shal_1744 [Shewanella halifaxensis HAW-EB4] Length = 1916 Back     alignment and organism information
>gi|312973910|ref|ZP_07788081.1| superfamily I DNA and RNA helicases and helicase subunits-like domain protein [Escherichia coli 1827-70] Length = 1367 Back     alignment and organism information
>gi|297624445|ref|YP_003705879.1| transcription elongation factor GreA/GreB domain-containing protein [Truepera radiovictrix DSM 17093] Length = 1819 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1775 hypothetical protein CLIBASIA_00570 [Candidatus Liberib
TIGR00376637 TIGR00376, TIGR00376, DNA helicase, putative 6e-11
KOG18051100 KOG1805, KOG1805, KOG1805, DNA replication helicase [Re 1e-10
KOG1803649 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, r 4e-09
KOG1802935 KOG1802, KOG1802, KOG1802, RNA helicase nonsense mRNA r 6e-07
TIGR00376637 TIGR00376, TIGR00376, DNA helicase, putative 4e-09
KOG1803649 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, r 6e-09
KOG1802935 KOG1802, KOG1802, KOG1802, RNA helicase nonsense mRNA r 4e-06
cd00221115 cd00221, Vsr, Very Short Patch Repair (Vsr) Endonucleas 1e-05
KOG18051100 KOG1805, KOG1805, KOG1805, DNA replication helicase [Re 9e-05
COG2852129 COG2852, COG2852, Uncharacterized protein conserved in 0.003
COG1112767 COG1112, COG1112, Superfamily I DNA and RNA helicases a 3e-28
>gnl|CDD|161845 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
>gnl|CDD|37016 KOG1805, KOG1805, KOG1805, DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|37014 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|37013 KOG1802, KOG1802, KOG1802, RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|161845 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
>gnl|CDD|37014 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|37013 KOG1802, KOG1802, KOG1802, RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|29956 cd00221, Vsr, Very Short Patch Repair (Vsr) Endonuclease Back     alignment and domain information
>gnl|CDD|37016 KOG1805, KOG1805, KOG1805, DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|32680 COG2852, COG2852, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|31309 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1775 hypothetical protein CLIBASIA_00570 [Candidatus Liberib
COG1112767 Superfamily I DNA and RNA helicases and helicase subuni 100.0
KOG1803649 consensus 99.95
KOG1802935 consensus 99.88
KOG18071025 consensus 99.61
TIGR00376709 TIGR00376 DNA helicase, putative; InterPro: IPR004483 E 99.57
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 98.19
KOG18051100 consensus 99.91
KOG1801827 consensus 99.71
KOG1804775 consensus 99.44
KOG18061320 consensus 98.45
PRK11054684 helD DNA helicase IV; Provisional 98.18
COG3973747 Superfamily I DNA and RNA helicases [General function p 97.41
KOG1804 775 consensus 94.71
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 99.38
TIGR021681191 SMC_prok_B chromosome segregation protein SMC; InterPro 99.1
TIGR006181063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 98.18
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 95.88
KOG1803649 consensus 99.14
COG11961163 Smc Chromosome segregation ATPases [Cell division and c 99.13
PRK102461047 exonuclease subunit SbcC; Provisional 99.06
PRK03918882 chromosome segregation protein; Provisional 98.87
PRK02224880 chromosome segregation protein; Provisional 98.82
PRK11773722 uvrD DNA-dependent helicase II; Provisional 98.7
COG0419908 SbcC ATPase involved in DNA repair [DNA replication, re 98.5
KOG18051100 consensus 98.47
PRK01156895 chromosome segregation protein; Provisional 98.45
KOG1802935 consensus 98.44
TIGR00376709 TIGR00376 DNA helicase, putative; InterPro: IPR004483 E 98.17
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 97.86
PRK12377248 putative replication protein; Provisional 97.77
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 97.71
PRK11054684 helD DNA helicase IV; Provisional 97.63
pfam04851103 ResIII Type III restriction enzyme, res subunit. 97.6
smart00487201 DEXDc DEAD-like helicases superfamily. 97.58
PRK08181269 transposase; Validated 97.57
PRK07952242 DNA replication protein DnaC; Validated 97.56
PRK094011176 reverse gyrase; Reviewed 97.56
PRK06526254 transposase; Provisional 97.55
PRK08116262 hypothetical protein; Validated 97.55
COG11101187 Reverse gyrase [DNA replication, recombination, and rep 97.54
PRK09183258 transposase/IS protein; Provisional 97.52
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.52
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 97.51
PRK108761181 recB exonuclease V subunit beta; Provisional 97.5
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.47
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 97.46
CHL00181287 cbbX CbbX; Provisional 97.45
PRK05580699 primosome assembly protein PriA; Validated 97.43
PRK13909911 putative recombination protein RecB; Provisional 97.35
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 97.35
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 97.22
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.21
PRK06835330 DNA replication protein DnaC; Validated 97.11
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 97.1
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.09
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 97.06
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 97.05
COG10741139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 97.05
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.05
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.02
KOG09791072 consensus 97.01
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.99
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.99
PRK00254717 ski2-like helicase; Provisional 96.97
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 96.97
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 96.95
PRK08939306 primosomal protein DnaI; Reviewed 96.92
PRK09435325 arginine/ornithine transport system ATPase; Provisional 96.92
cd01124187 KaiC KaiC is a circadian clock protein primarily found 96.91
COG0714329 MoxR-like ATPases [General function prediction only] 96.88
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 96.86
smart00382148 AAA ATPases associated with a variety of cellular activ 96.85
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 96.84
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 96.83
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.83
PRK08084235 DNA replication initiation factor; Provisional 96.81
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.81
PRK04328250 hypothetical protein; Provisional 96.8
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 96.8
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 96.79
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 96.78
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.77
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 96.77
PRK01172674 ski2-like helicase; Provisional 96.77
PRK06067241 flagellar accessory protein FlaH; Validated 96.76
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.74
cd01394218 radB RadB. The archaeal protein radB shares similarity 96.74
pfam06745231 KaiC KaiC. This family represents a conserved region wi 96.74
PRK13946195 shikimate kinase; Provisional 96.71
PRK13531498 regulatory ATPase RavA; Provisional 96.71
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.7
PRK02362736 ski2-like helicase; Provisional 96.7
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.7
PRK138261102 Dtr system oriT relaxase; Provisional 96.7
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.69
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 96.64
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 96.64
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 96.61
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 96.57
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 96.56
COG0497557 RecN ATPase involved in DNA repair [DNA replication, re 96.53
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 96.53
PRK06921265 hypothetical protein; Provisional 96.5
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 96.48
PRK06696227 uridine kinase; Validated 96.47
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.47
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.45
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.44
PRK11823454 DNA repair protein RadA; Provisional 96.42
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 96.42
PRK13407334 bchI magnesium chelatase subunit I; Provisional 96.41
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 96.39
COG45811041 Superfamily II RNA helicase [DNA replication, recombina 96.39
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.38
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.37
KOG0991333 consensus 96.36
COG3973747 Superfamily I DNA and RNA helicases [General function p 96.36
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.36
pfam07726131 AAA_3 ATPase family associated with various cellular ac 96.35
pfam00308219 Bac_DnaA Bacterial dnaA protein. 96.33
pfam00004131 AAA ATPase family associated with various cellular acti 96.32
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.32
PRK09270230 frcK putative fructose transport system kinase; Reviewe 96.29
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.28
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 96.27
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, reco 96.25
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 96.23
PRK13851343 type IV secretion system protein VirB11; Provisional 96.21
PRK13767878 ATP-dependent helicase; Provisional 96.2
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 96.2
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 96.2
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.19
cd03114148 ArgK-like The function of this protein family is unkown 96.16
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.13
PRK09862506 putative ATP-dependent protease; Provisional 96.12
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.12
PRK08727233 hypothetical protein; Validated 96.12
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.12
PRK06761281 hypothetical protein; Provisional 96.11
PRK13833323 conjugal transfer protein TrbB; Provisional 96.09
PRK03839180 putative kinase; Provisional 96.07
PRK114481126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 96.07
PRK00698204 tmk thymidylate kinase; Validated 96.05
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.05
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 96.04
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 96.02
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 96.02
PRK13898800 type IV secretion system ATPase VirB4; Provisional 96.02
COG1201814 Lhr Lhr-like helicases [General function prediction onl 96.01
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 95.99
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 95.95
PRK13894320 conjugal transfer ATPase TrbB; Provisional 95.94
PRK08903227 hypothetical protein; Validated 95.93
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.91
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. This m 95.91
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 95.89
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.87
PRK13853789 type IV secretion system protein VirB4; Provisional 95.86
PRK10436461 hypothetical protein; Provisional 95.86
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 95.83
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.83
TIGR006091324 recB exodeoxyribonuclease V, beta subunit; InterPro: IP 95.83
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 95.82
PRK05298657 excinuclease ABC subunit B; Provisional 95.81
PRK05642234 DNA replication initiation factor; Validated 95.8
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.8
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 95.79
PRK07667190 uridine kinase; Provisional 95.77
PRK13766764 Hef nuclease; Provisional 95.76
PRK05595444 replicative DNA helicase; Provisional 95.75
PRK13830818 conjugal transfer protein TrbE; Provisional 95.72
TIGR01074677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 95.71
PRK13973216 thymidylate kinase; Provisional 95.71
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 95.7
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.64
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 95.64
PRK13768253 GTPase; Provisional 95.63
PRK13889992 conjugal transfer relaxase TraA; Provisional 95.6
COG1643845 HrpA HrpA-like helicases [DNA replication, recombinatio 95.59
KOG0733802 consensus 95.57
PRK06893229 DNA replication initiation factor; Validated 95.55
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 95.53
KOG1533290 consensus 95.52
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 95.49
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 95.48
COG1204766 Superfamily II helicase [General function prediction on 95.48
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 95.47
CHL00176631 ftsH cell division protein; Validated 95.46
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 95.45
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 95.45
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 95.44
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 95.43
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.42
PRK00149447 dnaA chromosomal replication initiation protein; Review 95.41
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.39
PRK10416499 cell division protein FtsY; Provisional 95.37
PRK08006471 replicative DNA helicase; Provisional 95.37
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 95.36
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.36
PRK05541176 adenylylsulfate kinase; Provisional 95.36
COG1221403 PspF Transcriptional regulators containing an AAA-type 95.35
PRK13700732 conjugal transfer protein TraD; Provisional 95.34
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 95.33
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 95.33
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 95.29
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 95.28
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 95.28
COG4181228 Predicted ABC-type transport system involved in lysopho 95.27
PRK01184183 hypothetical protein; Provisional 95.27
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.25
KOG1969877 consensus 95.25
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 95.24
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 95.24
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.23
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.22
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 95.22
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 95.19
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 95.19
PRK07263453 consensus 95.17
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 95.16
pfam06309127 Torsin Torsin. This family consists of several eukaryot 95.15
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 95.14
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 95.13
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 95.12
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 95.08
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.08
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.07
PRK06851368 hypothetical protein; Provisional 95.06
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.06
PRK048631486 mukB cell division protein MukB; Provisional 95.05
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 95.01
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 95.0
PRK05748448 replicative DNA helicase; Provisional 94.99
PRK08840464 replicative DNA helicase; Provisional 94.98
PRK13721864 conjugal transfer ATP-binding protein TraC; Provisional 94.97
PRK04040189 adenylate kinase; Provisional 94.97
COG1205851 Distinct helicase family with a unique C-terminal domai 94.96
PRK13873815 conjugal transfer ATPase TrbE; Provisional 94.95
PRK08506473 replicative DNA helicase; Provisional 94.95
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 94.92
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 94.91
KOG0731774 consensus 94.91
PRK08694468 consensus 94.91
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 94.87
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.87
PRK03695245 vitamin B12-transporter ATPase; Provisional 94.86
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 94.86
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 94.86
KOG1942456 consensus 94.85
PRK00771433 signal recognition particle protein Srp54; Provisional 94.84
KOG3928461 consensus 94.84
cd03234226 ABCG_White The White subfamily represents ABC transport 94.83
PRK09165484 replicative DNA helicase; Provisional 94.81
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 94.8
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.8
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 94.79
PRK13891852 conjugal transfer protein TrbE; Provisional 94.78
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 94.76
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 94.74
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 94.73
PRK06904472 replicative DNA helicase; Validated 94.73
PRK13695174 putative NTPase; Provisional 94.72
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 94.72
cd03246173 ABCC_Protease_Secretion This family represents the ABC 94.7
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 94.7
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.7
pfam03266168 DUF265 Protein of unknown function, DUF265. 94.69
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.68
PRK03846198 adenylylsulfate kinase; Provisional 94.67
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.66
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are 94.66
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 94.64
PRK13764605 ATPase; Provisional 94.64
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 94.63
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.61
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 94.61
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 94.61
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.6
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.59
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 94.59
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 94.58
KOG0734752 consensus 94.56
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 94.56
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 94.55
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 94.52
PRK08082453 consensus 94.52
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 94.5
PRK05636507 replicative DNA helicase; Provisional 94.49
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.49
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.48
PRK13976202 thymidylate kinase; Provisional 94.48
PRK08760476 replicative DNA helicase; Provisional 94.48
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 94.47
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 94.47
PRK06749428 replicative DNA helicase; Provisional 94.45
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 94.44
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 94.44
cd01128249 rho_factor Transcription termination factor rho is a ba 94.43
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 94.43
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.42
pfam02223186 Thymidylate_kin Thymidylate kinase. 94.41
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.41
KOG2859293 consensus 94.4
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.39
PRK07004460 replicative DNA helicase; Provisional 94.39
KOG0354746 consensus 94.38
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 94.38
PRK05480209 uridine kinase; Provisional 94.37
PRK10867453 signal recognition particle protein; Provisional 94.36
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 94.36
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 94.35
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.34
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.34
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 94.34
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 94.33
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 94.32
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 94.31
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 94.3
pfam10443428 RNA12 RNA12 protein. This family includes RNA12 from S. 94.3
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 94.29
COG1123539 ATPase components of various ABC-type transport systems 94.29
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.28
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 94.26
COG4525259 TauB ABC-type taurine transport system, ATPase componen 94.26
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 94.26
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 94.25
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.24
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.24
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 94.24
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 94.22
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 94.22
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 94.21
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 94.21
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.21
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 94.2
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.18
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.17
pfam02534468 TraG TraG/TraD family. These proteins contain a P-loop 94.17
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 94.16
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.16
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.14
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.14
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.14
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 94.13
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 94.13
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.11
PRK12422455 chromosomal replication initiation protein; Provisional 94.11
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 94.1
COG4096875 HsdR Type I site-specific restriction-modification syst 94.09
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 94.08
PRK06793432 fliI flagellum-specific ATP synthase; Validated 94.08
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 94.07
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.07
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 94.07
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 94.06
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 94.06
CHL00095823 clpC Clp protease ATP binding subunit 94.06
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.04
cd01038108 Endonuclease_DUF559 Domain of unknown function, appears 98.71
pfam04480109 DUF559 Protein of unknown function (DUF559). 98.55
cd00221115 Vsr Very Short Patch Repair (Vsr) Endonuclease. Endonuc 98.46
PRK09767116 hypothetical protein; Provisional 98.31
COG2852129 Very-short-patch-repair endonuclease [Replication, reco 98.3
pfam10881127 DUF2726 Protein of unknown function (DUF2726). This bac 97.18
cd0103780 Restriction_endonuclease_like Superfamily of nucleases 96.96
TIGR00632143 vsr DNA mismatch endonuclease Vsr; InterPro: IPR004603 95.75
COG3727150 Vsr DNA G:T-mismatch repair endonuclease [DNA replicati 95.63
TIGR021681191 SMC_prok_B chromosome segregation protein SMC; InterPro 98.46
KOG01611930 consensus 98.36
KOG18071025 consensus 98.24
TIGR02746900 TraC-F-type type-IV secretion system protein TraC; Inte 95.3
PRK10875607 recD exonuclease V subunit alpha; Provisional 98.16
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 97.57
PRK11773722 uvrD DNA-dependent helicase II; Provisional 97.25
COG4988559 CydD ABC-type transport system involved in cytochrome b 95.69
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 98.13
PRK13889 992 conjugal transfer relaxase TraA; Provisional 97.51
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 96.97
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.59
PRK13341726 recombination factor protein RarA/unknown domain fusion 97.51
PRK13342417 recombination factor protein RarA; Reviewed 97.46
PRK10869553 recombination and repair protein; Provisional 97.23
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.18
PRK00440318 rfc replication factor C small subunit; Reviewed 97.05
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 96.97
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.76
KOG02501074 consensus 96.75
PRK04195403 replication factor C large subunit; Provisional 96.48
KOG0989346 consensus 96.48
PRK12402337 replication factor C small subunit 2; Reviewed 96.43
PRK03992390 proteasome-activating nucleotidase; Provisional 96.36
PRK06620214 hypothetical protein; Validated 96.35
PRK13765637 ATP-dependent protease Lon; Provisional 96.27
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 96.27
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.24
PRK00131175 aroK shikimate kinase; Reviewed 96.23
KOG0743457 consensus 96.09
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.09
TIGR00634605 recN DNA repair protein RecN; InterPro: IPR004604 DNA r 95.87
pfam121281192 DUF3584 Protein of unknown function (DUF3584). This pro 95.85
PRK09087226 hypothetical protein; Validated 95.82
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 95.77
PRK09825176 idnK D-gluconate kinase; Provisional 95.77
PRK05057172 aroK shikimate kinase I; Reviewed 95.76
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 95.73
KOG0744423 consensus 95.71
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 95.59
PRK02496185 adk adenylate kinase; Provisional 95.56
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 95.5
CHL00195491 ycf46 Ycf46; Provisional 95.5
PRK13947171 shikimate kinase; Provisional 95.4
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 95.4
KOG0738491 consensus 95.36
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 95.34
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 95.31
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 95.28
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.28
PRK03731172 aroL shikimate kinase II; Reviewed 95.26
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 95.24
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 95.22
KOG0736953 consensus 95.19
PRK00279215 adk adenylate kinase; Reviewed 95.16
PRK13949169 shikimate kinase; Provisional 95.12
PTZ00088225 adenylate kinase 1; Provisional 95.11
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 95.08
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 95.03
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 95.02
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 95.0
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.0
KOG2028554 consensus 94.94
PRK13948182 shikimate kinase; Provisional 94.93
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 94.91
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 94.9
KOG3347176 consensus 94.81
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 94.8
PRK00300208 gmk guanylate kinase; Provisional 94.77
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 94.76
PRK00625173 shikimate kinase; Provisional 94.63
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 94.54
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 94.54
PRK11545177 gntK gluconate kinase 1; Provisional 94.53
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 94.45
PRK08118167 topology modulation protein; Reviewed 94.27
KOG0741744 consensus 94.25
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 94.23
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 94.22
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 94.21
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 94.16
PRK00023225 cmk cytidylate kinase; Provisional 94.12
pfam00693279 Herpes_TK Thymidine kinase from herpesvirus. 94.08
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 94.06
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.05
KOG09941758 consensus 97.49
KOG09961293 consensus 97.39
PRK10875607 recD exonuclease V subunit alpha; Provisional 97.28
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.59
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 96.52
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 96.5
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.39
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.15
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 96.13
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.72
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 95.71
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.64
PRK10536262 hypothetical protein; Provisional 95.41
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.29
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.24
KOG0058716 consensus 95.15
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.08
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha subu 94.89
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 94.58
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.12
KOG09941758 consensus 97.27
PRK138261102 Dtr system oriT relaxase; Provisional 95.14
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 97.25
PRK09302501 circadian clock protein KaiC; Reviewed 97.03
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 96.74
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 96.24
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 95.94
COG10741139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 95.32
COG3839338 MalK ABC-type sugar transport systems, ATPase component 95.06
PRK09302501 circadian clock protein KaiC; Reviewed 96.92
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 95.35
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 96.43
PRK13909911 putative recombination protein RecB; Provisional 96.37
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 96.06
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 95.68
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 95.44
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 94.83
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 94.47
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 96.35
PRK048631486 mukB cell division protein MukB; Provisional 96.28
KOG18061320 consensus 95.68
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.43
KOG0057591 consensus 95.41
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 95.41
TIGR01073811 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR0057 95.25
KOG09761265 consensus 95.01
pfam07088484 GvpD GvpD gas vesicle protein. This family consists of 94.29
pfam02399829 Herpes_ori_bp Origin of replication binding protein. Th 94.54
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1803 consensus Back     alignment and domain information
>KOG1802 consensus Back     alignment and domain information
>KOG1807 consensus Back     alignment and domain information
>TIGR00376 TIGR00376 DNA helicase, putative; InterPro: IPR004483 Eukaryotic members of this family have been characterised as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT) Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>KOG1801 consensus Back     alignment and domain information
>KOG1804 consensus Back     alignment and domain information
>KOG1806 consensus Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information