254780230

254780230

hypothetical protein CLIBASIA_00575

GeneID in NCBI database:8209211Locus tag:CLIBASIA_00575
Protein GI in NCBI database:254780230Protein Accession:YP_003064643.1
Gene range:+(124546, 124836)Protein Length:96aa
Gene description:hypothetical protein
COG prediction:[S] Predicted integral membrane protein
KEGG prediction:hypothetical protein; K02221 YggT family protein
SEED prediction:hypothetical conserved membrane protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHHHHHHHcc
MNFLFKILLLLLELYANIVITRIVFSFLYtydiinplnFFVQTARQLLYsftepflipirrftpslgvewkridlspiILLTVIYILQCFLKFLIL
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
MNFLFKIlllllelYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
ooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL
MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target96 hypothetical protein CLIBASIA_00575 [Candidatus Liberib
8635949296 hypothetical protein RHE_CH03911 [Rhizobium etli CFN 42 1 6e-12
11859211798 hypothetical protein SIAM614_25612 [Stappia aggregata I 1 9e-12
190893760106 hypothetical conserved membrane protein [Rhizobium etli 1 1e-11
218672708106 hypothetical conserved membrane protein [Rhizobium etli 1 1e-11
21846169696 hypothetical conserved membrane protein [Rhizobium etli 1 1e-11
4947382497 hypothetical protein BQ01560 [Bartonella quintana str. 1 4e-11
25450457292 YGGT family, putative [Labrenzia alexandrii DFL-11] Len 1 4e-11
25447237596 YGGT family, putative [Pseudovibrio sp. JE062] Length = 1 1e-10
153008324114 hypothetical protein Oant_0989 [Ochrobactrum anthropi A 1 3e-10
328541880110 hypothetical protein SL003B_0256 [Polymorphum gilvum SL 1 5e-10
>gi|86359492|ref|YP_471384.1| hypothetical protein RHE_CH03911 [Rhizobium etli CFN 42] Length = 96 Back     alignment and organism information
 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 58/88 (65%), Gaps = 4/88 (4%)

Query: 4  LFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFT 63
          LF+ + L+L +Y  I+I   VFS+LY +++IN  N FV +    LY+ TEP L PIRR  
Sbjct: 4  LFQTIDLVLNIYTWILIASAVFSWLYAFNVINSSNQFVNSVGMFLYNVTEPALKPIRRLL 63

Query: 64 PSLGVEWKRIDLSPIILLTVIYILQCFL 91
          P+LG     ID+SPIILL +I+ L+ FL
Sbjct: 64 PNLG----GIDISPIILLVIIFFLRTFL 87


Species: Rhizobium etli
Genus: Rhizobium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|118592117|ref|ZP_01549511.1| hypothetical protein SIAM614_25612 [Stappia aggregata IAM 12614] Length = 98 Back     alignment and organism information
>gi|190893760|ref|YP_001980302.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652] Length = 106 Back     alignment and organism information
>gi|218672708|ref|ZP_03522377.1| hypothetical conserved membrane protein [Rhizobium etli GR56] Length = 106 Back     alignment and organism information
>gi|218461696|ref|ZP_03501787.1| hypothetical conserved membrane protein [Rhizobium etli Kim 5] Length = 96 Back     alignment and organism information
>gi|49473824|ref|YP_031866.1| hypothetical protein BQ01560 [Bartonella quintana str. Toulouse] Length = 97 Back     alignment and organism information
>gi|254504572|ref|ZP_05116723.1| YGGT family, putative [Labrenzia alexandrii DFL-11] Length = 92 Back     alignment and organism information
>gi|254472375|ref|ZP_05085775.1| YGGT family, putative [Pseudovibrio sp. JE062] Length = 96 Back     alignment and organism information
>gi|153008324|ref|YP_001369539.1| hypothetical protein Oant_0989 [Ochrobactrum anthropi ATCC 49188] Length = 114 Back     alignment and organism information
>gi|328541880|ref|YP_004301989.1| hypothetical protein SL003B_0256 [Polymorphum gilvum SL003B-26A1] Length = 110 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 96 hypothetical protein CLIBASIA_00575 [Candidatus Liberib
pfam0232575 YGGT YGGT family. This family consists of a repeat foun 99.81
COG076296 Predicted integral membrane protein [Function unknown] 99.75
>pfam02325 YGGT YGGT family Back     alignment and domain information
>COG0762 Predicted integral membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00