254780231

254780231

hypothetical protein CLIBASIA_00580

GeneID in NCBI database:8209212Locus tag:CLIBASIA_00580
Protein GI in NCBI database:254780231Protein Accession:YP_003064644.1
Gene range:+(124869, 125165)Protein Length:98aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein; K09131 hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL
ccEEEEEEEEccccccEEEEEcccccccccEEEEEEEEcccccHHHHHHHHHHHHHHcccHHHEEEEEccccccEEEEEEcccHHHHHHHHHcccccc
cccEEEEEEEccccccEEEccccccccccEEEEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEccccccEEEEEcccHHHHHHHHHccccccc
MCNVIVRLIpnakksgiasleipkdtsdtiHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMlskqssplkiiYIDKDCKEITELLQNNDSLTL
MCNVIVRLipnakksgiasleipkdtsdtihMKIKvtatpqkgkaNKAMLAMLAKKLALSKSSLrmlskqssplkiIYIDKDCKEITEllqnndsltl
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGkankamlamlakklalsksslrmlskqssPLKIIYIDKDCKEITELLQNNDSLTL
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNN*S***
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNND****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL
MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
29839726112 RecName: Full=UPF0235 protein Atu2660 Length = 112 1 4e-11
159185312183 hypothetical protein Atu2660 [Agrobacterium tumefaciens 1 5e-11
222150063104 hypothetical protein Avi_4153 [Agrobacterium vitis S4] 1 6e-11
31512278850 hypothetical protein CKC_05215 [Candidatus Liberibacter 1 3e-10
222087485104 hypothetical protein Arad_4365 [Agrobacterium radiobact 1 5e-10
325294029112 hypothetical protein AGROH133_08898 [Agrobacterium sp. 1 6e-10
227823716105 hypothetical protein NGR_c32030 [Sinorhizobium fredii N 1 2e-09
218461695103 hypothetical protein RetlK5_20376 [Rhizobium etli Kim 5 1 4e-09
327188872103 hypothetical protein RHECNPAF_750023 [Rhizobium etli CN 1 5e-09
209551279103 hypothetical protein Rleg2_3707 [Rhizobium leguminosaru 1 2e-08
>gi|29839726|sp|Q8UC38|Y2660_AGRT5 RecName: Full=UPF0235 protein Atu2660 Length = 112 Back     alignment and organism information
 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 55/86 (63%), Gaps = 2/86 (2%)

Query: 6   VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65
           VRL PN  +  I  +E  +D     H+K +V+A P+ GKANKA++ +LAKKL L KSS+ 
Sbjct: 25  VRLTPNGGRDAIDGVE--QDADGNAHLKARVSAVPEGGKANKALIVLLAKKLGLPKSSIT 82

Query: 66  MLSKQSSPLKIIYIDKDCKEITELLQ 91
            +S +++  KI+ ID D ++  +L +
Sbjct: 83  FISGETARKKILRIDTDPEDFEKLFK 108


Species: Agrobacterium tumefaciens
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159185312|ref|NP_530540.1| hypothetical protein Atu2660 [Agrobacterium tumefaciens str. C58] Length = 183 Back     alignment and organism information
>gi|222150063|ref|YP_002551020.1| hypothetical protein Avi_4153 [Agrobacterium vitis S4] Length = 104 Back     alignment and organism information
>gi|315122788|ref|YP_004063277.1| hypothetical protein CKC_05215 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 50 Back     alignment and organism information
>gi|222087485|ref|YP_002546022.1| hypothetical protein Arad_4365 [Agrobacterium radiobacter K84] Length = 104 Back     alignment and organism information
>gi|325294029|ref|YP_004279893.1| hypothetical protein AGROH133_08898 [Agrobacterium sp. H13-3] Length = 112 Back     alignment and organism information
>gi|227823716|ref|YP_002827689.1| hypothetical protein NGR_c32030 [Sinorhizobium fredii NGR234] Length = 105 Back     alignment and organism information
>gi|218461695|ref|ZP_03501786.1| hypothetical protein RetlK5_20376 [Rhizobium etli Kim 5] Length = 103 Back     alignment and organism information
>gi|327188872|gb|EGE56064.1| hypothetical protein RHECNPAF_750023 [Rhizobium etli CNPAF512] Length = 103 Back     alignment and organism information
>gi|209551279|ref|YP_002283196.1| hypothetical protein Rleg2_3707 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 103 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
PRK01310104 PRK01310, PRK01310, hypothetical protein; Validated 5e-13
COG1872102 COG1872, COG1872, Uncharacterized conserved protein [Fu 7e-09
PRK0064796 PRK00647, PRK00647, hypothetical protein; Validated 6e-07
PRK01530105 PRK01530, PRK01530, hypothetical protein; Reviewed 4e-05
PRK0509095 PRK05090, PRK05090, hypothetical protein; Validated 0.004
pfam0259478 pfam02594, DUF167, Uncharacterized ACR, YggU family COG 4e-10
>gnl|CDD|167208 PRK01310, PRK01310, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|32056 COG1872, COG1872, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|100624 PRK00647, PRK00647, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|134567 PRK01530, PRK01530, hypothetical protein; Reviewed Back     alignment and domain information
>gnl|CDD|179931 PRK05090, PRK05090, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|111487 pfam02594, DUF167, Uncharacterized ACR, YggU family COG1872 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
PRK01310106 hypothetical protein; Validated 99.95
PRK0064796 hypothetical protein; Validated 99.93
PRK01530105 hypothetical protein; Reviewed 99.92
COG1872102 Uncharacterized conserved protein [Function unknown] 99.91
PRK0402192 hypothetical protein; Reviewed 99.91
PRK0509095 hypothetical protein; Validated 99.91
pfam0259478 DUF167 Uncharacterized ACR, YggU family COG1872. 99.9
TIGR0025191 TIGR00251 conserved hypothetical protein TIGR00251; Int 99.83
KOG3276125 consensus 99.71
>PRK01310 hypothetical protein; Validated Back     alignment and domain information
>PRK00647 hypothetical protein; Validated Back     alignment and domain information
>PRK01530 hypothetical protein; Reviewed Back     alignment and domain information
>COG1872 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04021 hypothetical protein; Reviewed Back     alignment and domain information
>PRK05090 hypothetical protein; Validated Back     alignment and domain information
>pfam02594 DUF167 Uncharacterized ACR, YggU family COG1872 Back     alignment and domain information
>TIGR00251 TIGR00251 conserved hypothetical protein TIGR00251; InterPro: IPR005228 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>KOG3276 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
1n91_A108 Solution Nmr Structure Of Protein Yggu From Escheri 4e-17
1jrm_A104 Nmr Structure Of Mth0637. Ontario Centre For Struct 5e-13
>gi|28373966|pdb|1N91|A Chain A, Solution Nmr Structure Of Protein Yggu From Escherichia Coli. Northeast Structural Genomics Consortium Target Er14. Length = 108 Back     alignment and structure
 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 7/81 (8%)

Query: 4  VIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSS 63
          + + + P A +  I  L           +K+ +TA P  G+AN  ++  L K+  ++KS 
Sbjct: 17 LRLYIQPKASRDSIVGLH-------GDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQ 69

Query: 64 LRMLSKQSSPLKIIYIDKDCK 84
          + +   +    K I I    +
Sbjct: 70 VVIEKGELGRHKQIKIINPQQ 90


>gi|20150521|pdb|1JRM|A Chain A, Nmr Structure Of Mth0637. Ontario Centre For Structural Proteomics Target Mth0637_1_104; Northeast Structural Genomics Target Tt135 Length = 104 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
1n91_A108 ORF, hypothetical protein; alpha+beta, northeast struct 3e-12
1jrm_A104 MTH0637, conserved hypothetical protein MTH637; alpha-b 6e-10
>1n91_A ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, protein structure initiative, NESG; NMR {Escherichia coli O157} SCOP: d.206.1.1 PDB: 1yh5_A Length = 108 Back     alignment and structure
 Score = 65.1 bits (159), Expect = 3e-12
 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 10/89 (11%)

Query: 6   VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65
           + + P A +  I  L           +K+ +TA P  G+AN  ++  L K+  ++KS + 
Sbjct: 19  LYIQPKASRDSIVGLH-------GDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVV 71

Query: 66  MLSKQSSPLKIIYIDKDCK---EITELLQ 91
           +   +    K I I    +   E+  L+ 
Sbjct: 72  IEKGELGRHKQIKIINPQQIPPEVAALIN 100


>1jrm_A MTH0637, conserved hypothetical protein MTH637; alpha-beta protein, structural genomics, OCSP, NESG; NMR {Methanothermobacterthermautotrophicus} SCOP: d.206.1.1 Length = 104 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
1n91_A108 ORF, hypothetical protein; alpha+beta, northeast struct 99.89
1jrm_A104 MTH0637, conserved hypothetical protein MTH637; alpha-b 99.88
>1n91_A ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, protein structure initiative, NESG; NMR {Escherichia coli O157} SCOP: d.206.1.1 PDB: 1yh5_A Back     alignment and structure
Probab=99.89  E-value=6e-24  Score=162.47  Aligned_cols=84  Identities=24%  Similarity=0.336  Sum_probs=74.4

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCEEEEEECC
Q ss_conf             05999994186653023101456667776799999638767978899999999982998444799835577806999829
Q gi|254780231|r    2 CNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDK   81 (98)
Q Consensus         2 ~~i~v~V~P~a~~~~I~g~~~~~d~~~~~~lkv~v~ApPv~GkAN~ali~~Lak~l~v~ks~I~I~~G~~sr~K~i~I~~   81 (98)
                      +.|.|+|+|||++++|.|+       |+++|+|+|+|||+||+||++|++|||++|++|+|+|+|++|++||.|+++|.+
T Consensus        15 ~~i~v~V~P~A~~~~I~~~-------~~~~lkV~v~app~~GkAN~ali~~LAk~l~v~ks~I~Iv~G~tSr~K~i~I~~   87 (108)
T 1n91_A           15 LVLRLYIQPKASRDSIVGL-------HGDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIIN   87 (108)
T ss_dssp             EEEEEEEECSSSSCEEEEE-------CSSCEEEECCCCSSHHHHHHHHHHHHHHHTCCCTTTEEESSCTTSSEEEEEEES
T ss_pred             EEEEEEEEECCCCCCCCCC-------CCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHEEEEEECCCCCCCEEEEEC
T ss_conf             9999999759873410455-------188799999659978707999999999995997001899863777862899927


Q ss_pred             CH---HHHHHHHHH
Q ss_conf             98---999999975
Q gi|254780231|r   82 DC---KEITELLQN   92 (98)
Q Consensus        82 ~~---~~i~~~L~~   92 (98)
                      ..   +++.+.|..
T Consensus        88 ~~~~~~~i~~ll~~  101 (108)
T 1n91_A           88 PQQIPPEVAALINL  101 (108)
T ss_dssp             CCCCCHHHHCCCCC
T ss_pred             CCCCHHHHHHHHHH
T ss_conf             55398999999864



>1jrm_A MTH0637, conserved hypothetical protein MTH637; alpha-beta protein, structural genomics, OCSP, NESG; NMR {Methanothermobacterthermautotrophicus} SCOP: d.206.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
d1yh5a1100 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escheric 1e-11
d1jrma_104 d.206.1.1 (A:) Hypothetical protein MTH637 {Archaeon Me 1e-10
>d1yh5a1 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escherichia coli, o157 [TaxId: 562]} Length = 100 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: YggU-like
superfamily: YggU-like
family: YggU-like
domain: Hypothetical protein YggU
species: Escherichia coli, o157 [TaxId: 562]
 Score = 62.0 bits (151), Expect = 1e-11
 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 6  VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65
          + + P A +  I  L           +K+ +TA P  G+AN  ++  L K+  ++KS + 
Sbjct: 19 LYIQPKASRDSIVGLH-------GDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVV 71

Query: 66 MLSKQSSPLKIIYIDKDCK---EITELL 90
          +   +    K I I    +   E+  L+
Sbjct: 72 IEKGELGRHKQIKIINPQQIPPEVAALI 99


>d1jrma_ d.206.1.1 (A:) Hypothetical protein MTH637 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 104 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
d1yh5a1100 Hypothetical protein YggU {Escherichia coli, o157 [TaxI 99.88
d1jrma_104 Hypothetical protein MTH637 {Archaeon Methanobacterium 99.88
>d1yh5a1 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escherichia coli, o157 [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: YggU-like
superfamily: YggU-like
family: YggU-like
domain: Hypothetical protein YggU
species: Escherichia coli, o157 [TaxId: 562]
Probab=99.88  E-value=1.8e-23  Score=158.26  Aligned_cols=74  Identities=24%  Similarity=0.341  Sum_probs=69.4

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCEEEEEECC
Q ss_conf             05999994186653023101456667776799999638767978899999999982998444799835577806999829
Q gi|254780231|r    2 CNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDK   81 (98)
Q Consensus         2 ~~i~v~V~P~a~~~~I~g~~~~~d~~~~~~lkv~v~ApPv~GkAN~ali~~Lak~l~v~ks~I~I~~G~~sr~K~i~I~~   81 (98)
                      +.|.|+|+|||++++|.|+       ++++|+|+|+|||+||+||+||++|||++|++|||+|+|++|++||+|+++|.+
T Consensus        15 v~i~v~V~P~ak~~~i~~~-------~~~~l~v~v~app~~GkAN~ali~~Lak~l~v~ks~I~I~~G~tSr~K~i~I~~   87 (100)
T d1yh5a1          15 LVLRLYIQPKASRDSIVGL-------HGDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIIN   87 (100)
T ss_dssp             EEEEEECCBSCSSCCCCCC-------CSSCEECCBSSCSCTTTHHHHHHHHHHHHHTCCTTTEEEEECCSSSEEEEEEES
T ss_pred             EEEEEEEEECCCCCCCCCC-------CCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEEEEEEC
T ss_conf             8999999759751432551-------199899999669977717899999999995997100899864777850899957


Q ss_pred             C
Q ss_conf             9
Q gi|254780231|r   82 D   82 (98)
Q Consensus        82 ~   82 (98)
                      .
T Consensus        88 ~   88 (100)
T d1yh5a1          88 P   88 (100)
T ss_dssp             C
T ss_pred             C
T ss_conf             5



>d1jrma_ d.206.1.1 (A:) Hypothetical protein MTH637 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 98 hypothetical protein CLIBASIA_00580 [Candidatus Li
1n91_A_108 (A:) ORF, hypothetical protein; alpha+beta, northe 8e-11
1jrm_A_104 (A:) MTH0637, conserved hypothetical protein MTH63 2e-09
>1n91_A (A:) ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, protein structure initiative, NESG; NMR {Escherichia coli O157}Length = 108 Back     alignment and structure
 Score = 60.5 bits (147), Expect = 8e-11
 Identities = 19/86 (22%), Positives = 36/86 (41%), Gaps = 7/86 (8%)

Query: 6  VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65
          + + P A +  I  L           +K+ +TA P  G+AN  ++  L K+  ++KS + 
Sbjct: 19 LYIQPKASRDSIVGLHGD-------EVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVV 71

Query: 66 MLSKQSSPLKIIYIDKDCKEITELLQ 91
          +   +    K I I    +   E+  
Sbjct: 72 IEKGELGRHKQIKIINPQQIPPEVAA 97


>1jrm_A (A:) MTH0637, conserved hypothetical protein MTH637; alpha-beta protein, structural genomics, OCSP, NESG; NMR {Methanothermobacterthermautotrophicus}Length = 104 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_00580 [Candidatus Liberib
1n91_A_108 ORF, hypothetical protein; alpha+beta, northeast s 99.89
1jrm_A_104 MTH0637, conserved hypothetical protein MTH637; al 99.87
>1n91_A (A:) ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, protein structure initiative, NESG; NMR {Escherichia coli O157} Back     alignment and structure
Probab=99.89  E-value=1e-23  Score=161.97  Aligned_cols=85  Identities=24%  Similarity=0.332  Sum_probs=76.6

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCEEEEEECC
Q ss_conf             05999994186653023101456667776799999638767978899999999982998444799835577806999829
Q gi|254780231|r    2 CNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDK   81 (98)
Q Consensus         2 ~~i~v~V~P~a~~~~I~g~~~~~d~~~~~~lkv~v~ApPv~GkAN~ali~~Lak~l~v~ks~I~I~~G~~sr~K~i~I~~   81 (98)
                      +.|.|+|+|||++++|.|++       ++.|+|+|+|||+||+||++|++|||++|+||+|+|+|++|++||.|+++|+|
T Consensus        15 ~~i~i~v~P~a~~~~i~~~~-------~~~l~v~v~app~~GkAN~~li~~Lak~l~v~ks~I~i~~G~tsr~K~i~i~g   87 (108)
T 1n91_A           15 LVLRLYIQPKASRDSIVGLH-------GDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIIN   87 (108)
T ss_dssp             EEEEEEEECSSSSCEEEEEC-------SSCEEEECCCCSSHHHHHHHHHHHHHHHTCCCTTTEEESSCTTSSEEEEEEES
T ss_pred             EEEEEEEEECCCCCCCCCEE-------CCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHEEEEEECCCCCCCEEEEEC
T ss_conf             99999998598635104450-------88799999669978707899999999995997000899863777852899957


Q ss_pred             C---HHHHHHHHHHH
Q ss_conf             9---89999999752
Q gi|254780231|r   82 D---CKEITELLQNN   93 (98)
Q Consensus        82 ~---~~~i~~~L~~~   93 (98)
                      .   .+++.+.|+..
T Consensus        88 ~~~~~~~l~~~L~~~  102 (108)
T 1n91_A           88 PQQIPPEVAALINLE  102 (108)
T ss_dssp             CCCCCHHHHCCCCCC
T ss_pred             CCCCHHHHHHHHHHH
T ss_conf             553879999998644



>1jrm_A (A:) MTH0637, conserved hypothetical protein MTH637; alpha-beta protein, structural genomics, OCSP, NESG; NMR {Methanothermobacterthermautotrophicus} Back     alignment and structure