254780232

254780232

inorganic pyrophosphatase

GeneID in NCBI database:8209213Locus tag:CLIBASIA_00585
Protein GI in NCBI database:254780232Protein Accession:YP_003064645.1
Gene range:-(125155, 125688)Protein Length:177aa
Gene description:inorganic pyrophosphatase
COG prediction:[C] Inorganic pyrophosphatase
KEGG prediction:inorganic pyrophosphatase (EC:3.6.1.1); K01507 inorganic pyrophosphatase [EC:3.6.1.1]
SEED prediction:Inorganic pyrophosphatase (EC 3.6.1.1)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Phosphate metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
cccHHHcccccccccEEEEEEEEccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccEEEEEEEcccccccccEEEEEEEEEEEEEcccccccEEEEEEcccccHHHcccccHHHHcHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHcc
cccHHHcccccEcccEEEEEEEEccccccEEEEEccccccEEEEEEcccccccccEEEEccccccccccccEEEEccccccccccEEEEEEEEEEEEEEccEEEEEEEEEEcccccccccccccHHHccHHHHHHHHHHHHHcccccccccEEEEEEEcHHHHHHHHHHHHHHHHcc
mvqlneislgsnspidvNVFIEIslggypikyemdkksgvLVVDrfistpmlypgnygfipntlsddgdpvdvimyssepilpgsvistrpigvmkmeddggidekilavpskniTSLYDSIQSYEDVPNAYLQKVEHFFKHYkdledgkwakldgwegvNSAHKIILEAVKRGIKE
mvqlneislgsnspidvNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYssepilpgsvistrPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
**Q*NEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGI**
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
*VQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE
MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
315122789176 inorganic pyrophosphatase [Candidatus Liberibacter sola 1 1e-80
159185313177 inorganic pyrophosphatase [Agrobacterium tumefaciens st 1 9e-60
325294030177 Inorganic pyrophosphatase [Agrobacterium sp. H13-3] Len 1 3e-59
163867464176 inorganic pyrophosphatase [Bartonella tribocorum CIP 10 1 4e-59
150398171199 inorganic pyrophosphatase [Sinorhizobium medicae WSM419 1 6e-59
27375659178 inorganic pyrophosphatase [Bradyrhizobium japonicum USD 1 2e-58
240849836176 inorganic pyrophosphatase [Bartonella grahamii as4aup] 1 2e-58
15966840177 inorganic pyrophosphatase [Sinorhizobium meliloti 1021] 1 2e-58
227823715177 inorganic pyrophosphatase [Sinorhizobium fredii NGR234] 1 4e-58
209551280178 inorganic pyrophosphatase [Rhizobium leguminosarum bv. 1 1e-57
>gi|315122789|ref|YP_004063278.1| inorganic pyrophosphatase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 176 Back     alignment and organism information
 Score =  302 bits (774), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/176 (81%), Positives = 164/176 (93%)

Query: 2   VQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIP 61
           ++L+ IS+GSN P+DVNVFIEISLGG+PIKYE+DKKSG L VDRF+ST MLYPGNYGFIP
Sbjct: 1   MKLDAISIGSNPPVDVNVFIEISLGGHPIKYEIDKKSGALKVDRFVSTSMLYPGNYGFIP 60

Query: 62  NTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDS 121
           +TLSDDGDP+DVI+Y+SEPILPGS IS RPIGVMKMEDDGG+DEKI AVPSK+ITSLY+S
Sbjct: 61  HTLSDDGDPIDVIIYNSEPILPGSFISVRPIGVMKMEDDGGMDEKIFAVPSKHITSLYES 120

Query: 122 IQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE 177
           IQSYEDVP+ +LQK+EHFFKHYKDLE GKWAKLDGWEGV SAHKIILEA++RG KE
Sbjct: 121 IQSYEDVPSFHLQKIEHFFKHYKDLESGKWAKLDGWEGVKSAHKIILEAIERGAKE 176


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159185313|ref|NP_355598.2| inorganic pyrophosphatase [Agrobacterium tumefaciens str. C58] Length = 177 Back     alignment and organism information
>gi|325294030|ref|YP_004279894.1| Inorganic pyrophosphatase [Agrobacterium sp. H13-3] Length = 177 Back     alignment and organism information
>gi|163867464|ref|YP_001608663.1| inorganic pyrophosphatase [Bartonella tribocorum CIP 105476] Length = 176 Back     alignment and organism information
>gi|150398171|ref|YP_001328638.1| inorganic pyrophosphatase [Sinorhizobium medicae WSM419] Length = 199 Back     alignment and organism information
>gi|27375659|ref|NP_767188.1| inorganic pyrophosphatase [Bradyrhizobium japonicum USDA 110] Length = 178 Back     alignment and organism information
>gi|240849836|ref|YP_002971224.1| inorganic pyrophosphatase [Bartonella grahamii as4aup] Length = 176 Back     alignment and organism information
>gi|15966840|ref|NP_387193.1| inorganic pyrophosphatase [Sinorhizobium meliloti 1021] Length = 177 Back     alignment and organism information
>gi|227823715|ref|YP_002827688.1| inorganic pyrophosphatase [Sinorhizobium fredii NGR234] Length = 177 Back     alignment and organism information
>gi|209551280|ref|YP_002283197.1| inorganic pyrophosphatase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 178 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
PRK01250176 PRK01250, PRK01250, inorganic pyrophosphatase; Provisio 5e-75
cd00412155 cd00412, pyrophosphatase, Inorganic pyrophosphatase 3e-51
COG0221171 COG0221, Ppa, Inorganic pyrophosphatase [Energy product 1e-47
PRK02230184 PRK02230, PRK02230, inorganic pyrophosphatase; Provisio 8e-33
PLN02373188 PLN02373, PLN02373, soluble inorganic pyrophosphatase 7e-29
PRK00642205 PRK00642, PRK00642, inorganic pyrophosphatase; Provisio 2e-21
KOG1626279 KOG1626, KOG1626, KOG1626, Inorganic pyrophosphatase/Nu 8e-20
PLN02707267 PLN02707, PLN02707, Soluble inorganic pyrophosphatase 8e-10
pfam00719156 pfam00719, Pyrophosphatase, Inorganic pyrophosphatase 1e-57
>gnl|CDD|179262 PRK01250, PRK01250, inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|29533 cd00412, pyrophosphatase, Inorganic pyrophosphatase Back     alignment and domain information
>gnl|CDD|30570 COG0221, Ppa, Inorganic pyrophosphatase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179388 PRK02230, PRK02230, inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|178001 PLN02373, PLN02373, soluble inorganic pyrophosphatase Back     alignment and domain information
>gnl|CDD|179080 PRK00642, PRK00642, inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|36839 KOG1626, KOG1626, KOG1626, Inorganic pyrophosphatase/Nucleosome remodeling factor, subunit NURF38 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178309 PLN02707, PLN02707, Soluble inorganic pyrophosphatase Back     alignment and domain information
>gnl|CDD|144352 pfam00719, Pyrophosphatase, Inorganic pyrophosphatase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 177 inorganic pyrophosphatase [Candidatus Liberibacter asia
PRK01250176 inorganic pyrophosphatase; Provisional 100.0
PRK02230185 inorganic pyrophosphatase; Provisional 100.0
PRK00642212 inorganic pyrophosphatase; Provisional 100.0
cd00412155 pyrophosphatase Inorganic pyrophosphatase. These enzyme 100.0
pfam00719156 Pyrophosphatase Inorganic pyrophosphatase. 100.0
COG0221171 Ppa Inorganic pyrophosphatase [Energy production and co 100.0
KOG1626279 consensus 100.0
>PRK01250 inorganic pyrophosphatase; Provisional Back     alignment and domain information
>PRK02230 inorganic pyrophosphatase; Provisional Back     alignment and domain information
>PRK00642 inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd00412 pyrophosphatase Inorganic pyrophosphatase Back     alignment and domain information
>pfam00719 Pyrophosphatase Inorganic pyrophosphatase Back     alignment and domain information
>COG0221 Ppa Inorganic pyrophosphatase [Energy production and conversion] Back     alignment and domain information
>KOG1626 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
3fq3_A197 Crystal Structure Of Inorganic Phosphatase From Bru 6e-57
3d63_A196 Crystal Structure Of Inorganic Pyrophosphatase From 2e-56
2eip_A175 Inorganic Pyrophosphatase Length = 175 3e-56
2au7_A175 The R43q Active Site Variant Of E.Coli Inorganic Py 4e-56
1mjw_A175 Structure Of Inorganic Pyrophosphatase Mutant D42n 5e-56
1obw_A175 Structure Of Inorganic Pyrophosphatase Length = 175 5e-56
1mjx_A175 Structure Of Inorganic Pyrophosphatase Mutant D65n 1e-55
1mjz_A175 Structure Of Inorganic Pyrophosphatase Mutant D97n 1e-55
1mjy_A175 Structure Of Inorganic Pyrophosphatase Mutant D70n 2e-55
3ld3_A199 Crystal Structure Of Inorganic Phosphatase From Ana 5e-53
1qez_A173 Sulfolobus Acidocaldarius Inorganic Pyrophosphatase 2e-51
3i4q_A176 Structure Of A Putative Inorganic Pyrophosphatase F 3e-51
3lo0_A193 Crystal Structure Of Inorganic Pyrophosphatase From 2e-50
1ude_A195 Crystal Structure Of The Inorganic Pyrophosphatase 6e-50
2prd_A174 Crystal Structure Of Inorganic Pyrophosphatase From 7e-49
3i98_A178 X-Ray Crystallographic Structure Of Inorganic Pyrop 1e-48
3d53_A173 2.2 A Crystal Structure Of Inorganic Pyrophosphatas 2e-48
2bqx_A173 Inorganic Pyrophosphatase From The Pathogenic Bacte 5e-48
2uxs_A169 2.7a Crystal Structure Of Inorganic Pyrophosphatase 6e-48
1sxv_A172 1.3a Crystal Structure Of Rv3628, Mycobacterium Tub 4e-47
1wcf_A171 1.54 A Crystal Structure Of Rv3628, Mycobacterium T 5e-47
1twl_A186 Inorganic Pyrophosphatase From Pyrococcus Furiosus 6e-47
1ygz_A173 Crystal Structure Of Inorganic Pyrophosphatase From 8e-46
1wgi_A286 Structure Of Inorganic Pyrophosphatase Length = 286 2e-31
1huj_A281 Refined Structure Of Yeast Inorganic Pyrophosphatas 2e-31
1m38_A287 Structure Of Inorganic Pyrophosphatase Length = 287 3e-31
1huk_A281 Refined Structure Of Yeast Inorganic Pyrophosphatas 3e-31
8prk_A287 The R78k And D117e Active Site Variants Of Saccharo 4e-31
1ypp_A286 Acid Anhydride Hydrolase Length = 286 5e-31
2ik2_A286 Yeast Inorganic Pyrophosphatase Variant D115e With 6e-31
117e_A286 The R78k And D117e Active Site Variants Of Saccharo 7e-31
2ik1_A286 Yeast Inorganic Pyrophosphatase Variant Y93f With M 1e-30
2ik7_A286 Yeast Inorganic Pyrophosphatase Variant D120n With 1e-30
2ik9_A286 Yeast Inorganic Pyrophosphatase Variant D152e With 1e-30
2ik6_A286 Yeast Inorganic Pyrophosphatase Variant D120e With 1e-30
2ik0_A286 Yeast Inorganic Pyrophosphatase Variant E48d With M 2e-30
1pyp_A285 X-Ray Diffraction Study Of Inorganic Pyrophosphatas 2e-30
>gi|221046919|pdb|3FQ3|A Chain A, Crystal Structure Of Inorganic Phosphatase From Brucella Melitensis Length = 197 Back     alignment and structure
 Score =  223 bits (569), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 98/176 (55%), Positives = 135/176 (76%)

Query: 2   VQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIP 61
           + ++ IS+GSN P DVNV IE+ +GG PIKYEMDKK+G L+VDRF+ TPM YPGNYGF+P
Sbjct: 22  MNIDAISIGSNPPEDVNVIIEVPVGGQPIKYEMDKKAGALIVDRFLYTPMTYPGNYGFVP 81

Query: 62  NTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDS 121
           +TLS+DGDP+DV++ ++ P++PG VI+ RPIGV+ MED+ G DEKI+AVPS ++T  Y+ 
Sbjct: 82  HTLSEDGDPIDVLVCNTRPLIPGCVINVRPIGVLVMEDNSGKDEKIIAVPSPHLTRRYEK 141

Query: 122 IQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE 177
           I  Y D+P   L+++ HFF+HYKDLE GKW K+  W   + A K I+EA++R   +
Sbjct: 142 IHDYTDMPEITLKQIAHFFEHYKDLEPGKWVKIGDWGDEDYARKFIVEAIERAKGK 197


>gi|193885439|pdb|3D63|A Chain A, Crystal Structure Of Inorganic Pyrophosphatase From Burkholderia Pseudomallei Length = 196 Back     alignment and structure
>gi|1943414|pdb|2EIP|A Chain A, Inorganic Pyrophosphatase Length = 175 Back     alignment and structure
>gi|114793440|pdb|2AU7|A Chain A, The R43q Active Site Variant Of E.Coli Inorganic Pyrophosphatase Length = 175 Back     alignment and structure
>gi|2781250|pdb|1MJW|A Chain A, Structure Of Inorganic Pyrophosphatase Mutant D42n Length = 175 Back     alignment and structure
>gi|2554846|pdb|1OBW|A Chain A, Structure Of Inorganic Pyrophosphatase Length = 175 Back     alignment and structure
>gi|2781252|pdb|1MJX|A Chain A, Structure Of Inorganic Pyrophosphatase Mutant D65n Length = 175 Back     alignment and structure
>gi|157831975|pdb|1MJZ|A Chain A, Structure Of Inorganic Pyrophosphatase Mutant D97n Length = 175 Back     alignment and structure
>gi|2781254|pdb|1MJY|A Chain A, Structure Of Inorganic Pyrophosphatase Mutant D70n Length = 175 Back     alignment and structure
>gi|292659737|pdb|3LD3|A Chain A, Crystal Structure Of Inorganic Phosphatase From Anaplasma Phagocytophilum At 1.75a Resolution Length = 199 Back     alignment and structure
gi|4930097|pdb|1QEZ|A Chain A, Sulfolobus Acidocaldarius Inorganic Pyrophosphatase: An Archael Pyrophosphatase. Length = 173 Back     alignment and structure
>gi|254839627|pdb|3I4Q|A Chain A, Structure Of A Putative Inorganic Pyrophosphatase From The Oil-Degrading Bacterium Oleispira Antarctica Length = 176 Back     alignment and structure
>gi|288965886|pdb|3LO0|A Chain A, Crystal Structure Of Inorganic Pyrophosphatase From Ehrlichia Chaffeensis Length = 193 Back     alignment and structure
>gi|42543708|pdb|1UDE|A Chain A, Crystal Structure Of The Inorganic Pyrophosphatase From The Hyperthermophilic Archaeon Pyrococcus Horikoshii Ot3 Length = 195 Back     alignment and structure
>gi|157835753|pdb|2PRD|A Chain A, Crystal Structure Of Inorganic Pyrophosphatase From Thermus Thermophilus Length = 174 Back     alignment and structure
>gi|256032864|pdb|3I98|A Chain A, X-Ray Crystallographic Structure Of Inorganic Pyrophosphatas From Archaeon Thermococcus Thioreducens Length = 178 Back     alignment and structure
>gi|189096264|pdb|3D53|A Chain A, 2.2 A Crystal Structure Of Inorganic Pyrophosphatase From Rickettsia Prowazekii Length = 173 Back     alignment and structure
gi|118137362|pdb|2BQX|A Chain A, Inorganic Pyrophosphatase From The Pathogenic Bacterium Helicobacter Pylori-Kinetic And Structural Properties Length = 173 Back     alignment and structure
>gi|189096044|pdb|2UXS|A Chain A, 2.7a Crystal Structure Of Inorganic Pyrophosphatase (Rv3628) From Mycobacterium Tuberculosis At Ph 7.5 Length = 169 Back     alignment and structure
>gi|66360131|pdb|1SXV|A Chain A, 1.3a Crystal Structure Of Rv3628, Mycobacterium Tuberculosis Inorganic Pyrophosphatase (Ppase) At Ph5.0 Length = 172 Back     alignment and structure
>gi|112489696|pdb|1WCF|A Chain A, 1.54 A Crystal Structure Of Rv3628, Mycobacterium Tuberculosis Inorganic Pyrophosphatase (Ppase) At Ph7.0 Length = 171 Back     alignment and structure
>gi|56966161|pdb|1TWL|A Chain A, Inorganic Pyrophosphatase From Pyrococcus Furiosus Pfu- 264096-001 Length = 186 Back     alignment and structure
>gi|82407515|pdb|1YGZ|A Chain A, Crystal Structure Of Inorganic Pyrophosphatase From Helicobacter Pylori Length = 173 Back     alignment and structure
>gi|2781300|pdb|1WGI|A Chain A, Structure Of Inorganic Pyrophosphatase Length = 286 Back     alignment and structure
>gi|3114389|pdb|1HUJ|A Chain A, Refined Structure Of Yeast Inorganic Pyrophosphatase And Its K61r Mutant Length = 281 Back     alignment and structure
gi|28373575|pdb|1M38|A Chain A, Structure Of Inorganic Pyrophosphatase Length = 287 Back     alignment and structure
>gi|3114391|pdb|1HUK|A Chain A, Refined Structure Of Yeast Inorganic Pyrophosphatase And Its K61r Mutant Length = 281 Back     alignment and structure
>gi|6729855|pdb|8PRK|A Chain A, The R78k And D117e Active Site Variants Of Saccharomyces Cerevisiae Soluble Inorganic Pyrophosphatase: Structural Studies And Mechanistic Implications Length = 287 Back     alignment and structure
>gi|1942886|pdb|1YPP|A Chain A, Acid Anhydride Hydrolase Length = 286 Back     alignment and structure
>gi|134104540|pdb|2IK2|A Chain A, Yeast Inorganic Pyrophosphatase Variant D115e With Magnesium And Phosphate Length = 286 Back     alignment and structure
>gi|6729690|pdb|117E|A Chain A, The R78k And D117e Active Site Variants Of Saccharomyces Cerevisiae Soluble Inorganic Pyrophosphatase: Structural Studies And Mechanistic Implications Length = 286 Back     alignment and structure
>gi|134104538|pdb|2IK1|A Chain A, Yeast Inorganic Pyrophosphatase Variant Y93f With Magnesium And Phosphate Length = 286 Back     alignment and structure
>gi|134104546|pdb|2IK7|A Chain A, Yeast Inorganic Pyrophosphatase Variant D120n With Magnesium And Phosphate Length = 286 Back     alignment and structure
>gi|134104548|pdb|2IK9|A Chain A, Yeast Inorganic Pyrophosphatase Variant D152e With Magnesium And Phosphate Length = 286 Back     alignment and structure
>gi|134104544|pdb|2IK6|A Chain A, Yeast Inorganic Pyrophosphatase Variant D120e With Magnesium And Phosphate Length = 286 Back     alignment and structure
>gi|134104536|pdb|2IK0|A Chain A, Yeast Inorganic Pyrophosphatase Variant E48d With Magnesium And Phosphate Length = 286 Back     alignment and structure
>gi|157833594|pdb|1PYP|A Chain A, X-Ray Diffraction Study Of Inorganic Pyrophosphatase From Baker,S Yeast At The 3 Angstroms Resolution (Russian) Length = 285 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
3lo0_A193 Inorganic pyrophosphatase; ALS collaborative crystallog 2e-62
3ld3_A199 Inorganic pyrophosphatase; structural genomics, seattle 7e-60
3fq3_A197 Inorganic pyrophosphatase:bacterial/archaeal inorganic 4e-58
3d53_A173 Inorganic pyrophosphatase; seattle structural genomics 1e-57
1qez_A173 Ppase, S-ppase, protein (inorganic pyrophosphatase); th 2e-52
3gvf_A196 Inorganic pyrophosphatase; structural genomics, hydrola 3e-52
2au7_A175 Inorganic pyrophosphatase; hydrolase, mutant; 1.05A {Es 1e-49
1sxv_A172 Inorganic pyrophosphatase; structural genomics, ppase,, 2e-47
2bqx_A173 Inorganic pyrophosphatase; hydrolase; 1.90A {Helicobact 5e-46
3i98_A178 TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1.85A 8e-45
2prd_A174 Pyrophosphate phosphohydrolase; 2.00A {Thermus thermoph 4e-44
1e9g_A286 Ppase, inorganic pyrophosphatase; pyrophosphate phospho 8e-40
>3lo0_A Inorganic pyrophosphatase; ALS collaborative crystallography, emerald biostructures, hydrolase, structural genomics; 1.95A {Ehrlichia chaffeensis} Length = 193 Back     alignment and structure
 Score =  233 bits (595), Expect = 2e-62
 Identities = 79/173 (45%), Positives = 115/173 (66%)

Query: 1   MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFI 60
            + L+ ++ G N P ++NV IEIS    P+KYE DK+  +  VDRF+ T M YP NYGFI
Sbjct: 21  SMNLDNVTGGDNVPKEINVIIEISQNSCPVKYEFDKEKNLFCVDRFLPTSMYYPCNYGFI 80

Query: 61  PNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYD 120
           P+T + DGDPVDV++ S  P++ G+VI  RP+GV+ M D+ G D KILAVP+  +   Y+
Sbjct: 81  PHTCAGDGDPVDVLVASRFPVMSGAVIRARPVGVLVMHDESGEDVKILAVPTHKVDQYYN 140

Query: 121 SIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKR 173
           +I+ Y D P ++L  + HFF  YK LE+ K+  ++GW+ V  A K+IL A+ +
Sbjct: 141 NIKDYSDFPVSFLNSISHFFTFYKKLEEDKFVSVEGWKDVTVAEKLILSALIK 193


>3ld3_A Inorganic pyrophosphatase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 1.75A {Anaplasma phagocytophilum} PDB: 3lo0_A Length = 199 Back     alignment and structure
>3fq3_A Inorganic pyrophosphatase:bacterial/archaeal inorganic pyrophosphatase; ssgcid, inorganic phosphatase, hydrolase; 1.90A {Brucella melitensis biovar ABORTUS2308} Length = 197 Back     alignment and structure
>3d53_A Inorganic pyrophosphatase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, hydrolase, magnesium; 2.20A {Rickettsia prowazekii str} PDB: 3emj_A* Length = 173 Back     alignment and structure
>1qez_A Ppase, S-ppase, protein (inorganic pyrophosphatase); thermostability, magnesium, hydrolase; 2.70A {Sulfolobus acidocaldarius} SCOP: b.40.5.1 Length = 173 Back     alignment and structure
>3gvf_A Inorganic pyrophosphatase; structural genomics, hydrolase, seattle structural genomics center for infectious disease, ssgcid; HET: PGE; 1.75A {Burkholderia pseudomallei 1710B} PDB: 3d63_A* 3eiy_A 3ej0_A* 3ej2_A* 3eiz_A* Length = 196 Back     alignment and structure
>2au7_A Inorganic pyrophosphatase; hydrolase, mutant; 1.05A {Escherichia coli} PDB: 1i40_A 1i6t_A 1igp_A 1obw_A 2au6_A 2au8_A 2au9_A 2auu_A 1mjy_A 1faj_A 1ino_A 1ipw_A 1jfd_A 2eip_A 1mjz_A 1mjx_A 1mjw_A 3i4q_A* Length = 175 Back     alignment and structure
>1sxv_A Inorganic pyrophosphatase; structural genomics, ppase,, hydrolase; 1.30A {Mycobacterium tuberculosis} PDB: 1wcf_A 2uxs_A Length = 172 Back     alignment and structure
>2bqx_A Inorganic pyrophosphatase; hydrolase; 1.90A {Helicobacter pylori} PDB: 1ygz_A 2bqy_A Length = 173 Back     alignment and structure
>3i98_A TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1.85A {Thermococcus thioreducens} PDB: 1ude_A 1twl_A Length = 178 Back     alignment and structure
>2prd_A Pyrophosphate phosphohydrolase; 2.00A {Thermus thermophilus HB8} SCOP: b.40.5.1 Length = 174 Back     alignment and structure
>1e9g_A Ppase, inorganic pyrophosphatase; pyrophosphate phosphohydrolase, hydrolase, manganese; HET: PO4; 1.15A {Saccharomyces cerevisiae} SCOP: b.40.5.1 PDB: 1e6a_A* 1wgi_A 1wgj_A 2ihp_A* 8prk_A 2ik6_A 2ik2_A 2ik4_A 117e_A 2ik1_A* 2ik9_A 2ik0_A 2ik7_A 1m38_A 1ypp_A 1huk_A 1huj_A 1pyp_A Length = 286 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
3fq3_A197 Inorganic pyrophosphatase:bacterial/archaeal inorganic 100.0
3gvf_A196 Inorganic pyrophosphatase; structural genomics, hydrola 100.0
3ld3_A199 Inorganic pyrophosphatase; structural genomics, seattle 100.0
2au7_A175 Inorganic pyrophosphatase; hydrolase, mutant; 1.05A {Es 100.0
1qez_A173 Ppase, S-ppase, protein (inorganic pyrophosphatase); th 100.0
3d53_A173 Inorganic pyrophosphatase; seattle structural genomics 100.0
3i98_A178 TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1.85A 100.0
2prd_A174 Pyrophosphate phosphohydrolase; 2.00A {Thermus thermoph 100.0
2bqx_A173 Inorganic pyrophosphatase; hydrolase; 1.90A {Helicobact 100.0
1sxv_A172 Inorganic pyrophosphatase; structural genomics, ppase,, 100.0
1e9g_A286 Ppase, inorganic pyrophosphatase; pyrophosphate phospho 100.0
>3fq3_A Inorganic pyrophosphatase:bacterial/archaeal inorganic pyrophosphatase; ssgcid, inorganic phosphatase, hydrolase; 1.90A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
Probab=100.00  E-value=0  Score=473.79  Aligned_cols=177  Identities=55%  Similarity=1.055  Sum_probs=173.8

Q ss_pred             CCCCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCHHHCCCCCCCCCEEEEEECCCC
Q ss_conf             96500188665799858999985686873026880665709994214776567778121105535899840289922777
Q gi|254780232|r    1 MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEP   80 (177)
Q Consensus         1 ~m~~~~i~~~~~~p~~vn~vIEIP~gs~~~KyE~d~~~g~~~~dR~l~~~~~yP~nYGfiP~T~~~DgDPLDvlvl~~~~   80 (177)
                      +||+++||+|+++|++||||||||+||+|+||||||++|.|++||+|++++.||+|||||||||++||||||||||+++|
T Consensus        21 ~m~~~~i~~g~~~P~~vnvvIEIP~gs~~~KyE~dk~~g~~~~dR~l~~~~~YP~nYGfIP~T~~~DgDPLDvlvl~~~~  100 (197)
T 3fq3_A           21 SMNIDAISIGSNPPEDVNVIIEVPVGGQPIKYEMDKKAGALIVDRFLYTPMTYPGNYGFVPHTLSEDGDPIDVLVCNTRP  100 (197)
T ss_dssp             -CCGGGSCSCSSTTSCEEEEEEECTTCCSEEEEEETTTTEEEEEEECCSSBCCSSEEEECTTCCCTTSSCCEEEECCSSC
T ss_pred             CCCCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCC
T ss_conf             66445488899998878999995899986208996689969999875767738765665567535799986799974777


Q ss_pred             CCCCCEEEEEEEEEEEEECCCCCCEEEEEEECCCCCHHHCCCCCHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCH
Q ss_conf             67742899869899996047877527999963788822256587789898999999999999642888971898031499
Q gi|254780232|r   81 ILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGV  160 (177)
Q Consensus        81 ~~~G~vv~~r~iG~l~m~D~ge~D~KiiaVp~~d~~~~~~~i~di~Dl~~~~l~~I~~fF~~YK~le~~K~v~v~g~~~~  160 (177)
                      +++|++++||+||+|+|+|+||.||||||||+++.+|+|++++|++|++++++++|++||++||+||++|++++.||.|+
T Consensus       101 ~~~G~vv~~r~IG~L~m~D~ge~D~KIIaVp~~~~dp~~~~i~dl~Dl~~~~l~~I~~fF~~YK~le~~K~v~v~g~~d~  180 (197)
T 3fq3_A          101 LIPGCVINVRPIGVLVMEDNSGKDEKIIAVPSPHLTRRYEKIHDYTDMPEITLKQIAHFFEHYKDLEPGKWVKIGDWGDE  180 (197)
T ss_dssp             CCTTCEEEEEEEEEEEEEETTEEEEEEEEEECTTTCSTTTTCCSGGGSCHHHHHHHHHHHHHTTTTSTTCCEEECCCBCH
T ss_pred             CCCCCEEEEEEEEEEEECCCCCCCCEEEEEECCCCCCHHCCCCCHHHCCHHHHHHHHHHHHHHCCCCCCCEEEECCCCCH
T ss_conf             89833899999899972359997563999766678802134388478999999999999999758789987987774599


Q ss_pred             HHHHHHHHHHHHHHHCC
Q ss_conf             99999999999988509
Q gi|254780232|r  161 NSAHKIILEAVKRGIKE  177 (177)
Q Consensus       161 ~~A~~iI~~~~~ry~k~  177 (177)
                      ++|+++|++||+||+.|
T Consensus       181 ~~A~~iI~e~~~~yk~k  197 (197)
T 3fq3_A          181 DYARKFIVEAIERAKGK  197 (197)
T ss_dssp             HHHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             99999999999998559



>3gvf_A Inorganic pyrophosphatase; structural genomics, hydrolase, seattle structural genomics center for infectious disease, ssgcid; HET: PGE; 1.75A {Burkholderia pseudomallei 1710B} PDB: 3d63_A* 3eiy_A 3ej0_A* 3ej2_A* 3eiz_A* Back     alignment and structure
>3ld3_A Inorganic pyrophosphatase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 1.75A {Anaplasma phagocytophilum} PDB: 3lo0_A Back     alignment and structure
>2au7_A Inorganic pyrophosphatase; hydrolase, mutant; 1.05A {Escherichia coli} PDB: 1i40_A 1i6t_A 1igp_A 1obw_A 2au6_A 2au8_A 2au9_A 2auu_A 1mjy_A 1faj_A 1ino_A 1ipw_A 1jfd_A 2eip_A 1mjz_A 1mjx_A 1mjw_A 3i4q_A* Back     alignment and structure
>1qez_A Ppase, S-ppase, protein (inorganic pyrophosphatase); thermostability, magnesium, hydrolase; 2.70A {Sulfolobus acidocaldarius} SCOP: b.40.5.1 Back     alignment and structure
>3d53_A Inorganic pyrophosphatase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, hydrolase, magnesium; 2.20A {Rickettsia prowazekii str} PDB: 3emj_A* Back     alignment and structure
>3i98_A TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1.85A {Thermococcus thioreducens} PDB: 1ude_A 1twl_A Back     alignment and structure
>2prd_A Pyrophosphate phosphohydrolase; 2.00A {Thermus thermophilus HB8} SCOP: b.40.5.1 Back     alignment and structure
>2bqx_A Inorganic pyrophosphatase; hydrolase; 1.90A {Helicobacter pylori} PDB: 1ygz_A 2bqy_A Back     alignment and structure
>1sxv_A Inorganic pyrophosphatase; structural genomics, ppase,, hydrolase; 1.30A {Mycobacterium tuberculosis} PDB: 1wcf_A 2uxs_A Back     alignment and structure
>1e9g_A Ppase, inorganic pyrophosphatase; pyrophosphate phosphohydrolase, hydrolase, manganese; HET: PO4; 1.15A {Saccharomyces cerevisiae} SCOP: b.40.5.1 PDB: 1e6a_A* 1wgi_A 1wgj_A 2ihp_A* 8prk_A 2ik6_A 2ik2_A 2ik4_A 117e_A 2ik1_A* 2ik9_A 2ik0_A 2ik7_A 1m38_A 1ypp_A 1huk_A 1huj_A 1pyp_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 177 inorganic pyrophosphatase [Candidatus Liberibacter asia
d1i40a_175 b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia co 1e-49
d1qeza_170 b.40.5.1 (A:) Inorganic pyrophosphatase {Archaeon Sulfo 2e-47
d2prda_174 b.40.5.1 (A:) Inorganic pyrophosphatase {Thermus thermo 2e-45
d1twla_173 b.40.5.1 (A:) Inorganic pyrophosphatase {Pyrococcus fur 9e-45
d1e9ga_284 b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast 8e-34
>d1i40a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 175 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Inorganic pyrophosphatase
family: Inorganic pyrophosphatase
domain: Inorganic pyrophosphatase
species: Escherichia coli [TaxId: 562]
 Score =  189 bits (481), Expect = 1e-49
 Identities = 83/170 (48%), Positives = 113/170 (66%)

Query: 4   LNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNT 63
           L  +  G + P D+ V IEI     PIKYE+DK+SG L VDRF+ST M YP NYG+I +T
Sbjct: 2   LLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYINHT 61

Query: 64  LSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQ 123
           LS DGDPVDV++ +  P+ PGSV   RP+GV+KM D+ G D K++AVP   ++  YD I+
Sbjct: 62  LSLDGDPVDVLVPTPYPLQPGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIK 121

Query: 124 SYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKR 173
              D+P     ++ HFF+HYKDLE GKW K++GWE   +A   I+ + +R
Sbjct: 122 DVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFER 171


>d1qeza_ b.40.5.1 (A:) Inorganic pyrophosphatase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 170 Back     information, alignment and structure
>d2prda_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1twla_ b.40.5.1 (A:) Inorganic pyrophosphatase {Pyrococcus furiosus [TaxId: 2261]} Length = 173 Back     information, alignment and structure
>d1e9ga_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 284 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
d1i40a_175 Inorganic pyrophosphatase {Escherichia coli [TaxId: 562 100.0
d2prda_174 Inorganic pyrophosphatase {Thermus thermophilus [TaxId: 100.0
d1qeza_170 Inorganic pyrophosphatase {Archaeon Sulfolobus acidocal 100.0
d1twla_173 Inorganic pyrophosphatase {Pyrococcus furiosus [TaxId: 100.0
d1e9ga_284 Inorganic pyrophosphatase {Baker's yeast (Saccharomyces 100.0
>d1i40a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Inorganic pyrophosphatase
family: Inorganic pyrophosphatase
domain: Inorganic pyrophosphatase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=451.64  Aligned_cols=175  Identities=47%  Similarity=0.877  Sum_probs=171.7

Q ss_pred             CCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCHHHCCCCCCCCCEEEEEECCCCCC
Q ss_conf             50018866579985899998568687302688066570999421477656777812110553589984028992277767
Q gi|254780232|r    3 QLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPIL   82 (177)
Q Consensus         3 ~~~~i~~~~~~p~~vn~vIEIP~gs~~~KyE~d~~~g~~~~dR~l~~~~~yP~nYGfiP~T~~~DgDPLDvlvl~~~~~~   82 (177)
                      ||+|||+|++.|++||||||||+||+|+|||||+++|.|++||++++++.||||||||||||++|||||||||+++.+++
T Consensus         1 ~l~dip~~~~~p~~vn~vIEIP~gs~~~KyE~dk~~g~~~~dr~l~~~~~yP~nYGfiP~T~~~DgDPLDvlvl~~~~~~   80 (175)
T d1i40a_           1 SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQ   80 (175)
T ss_dssp             CGGGCCSCSBTTTBEEEEEEECTTCCSEEEEECTTTCCEEEEEECSSSCCCSSEEEECTTCCCTTSSCCEEEECCSSCCC
T ss_pred             CCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCC
T ss_conf             90006899999998999999569998604899626897899875366552887678522432589998057887056556


Q ss_pred             CCCEEEEEEEEEEEEECCCCCCEEEEEEECCCCCHHHCCCCCHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHH
Q ss_conf             74289986989999604787752799996378882225658778989899999999999964288897189803149999
Q gi|254780232|r   83 PGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNS  162 (177)
Q Consensus        83 ~G~vv~~r~iG~l~m~D~ge~D~KiiaVp~~d~~~~~~~i~di~Dl~~~~l~~I~~fF~~YK~le~~K~v~v~g~~~~~~  162 (177)
                      +|++++||+||+|+|+|+||.||||||||+++.+|++++++|++|++++++++|++||++||++|++|++++.||.|+++
T Consensus        81 ~G~vv~~r~iG~l~~~D~ge~D~Kii~V~~~~~~~~~~~i~dl~dl~~~~l~~I~~fF~~YK~le~~k~v~v~g~~~~~~  160 (175)
T d1i40a_          81 PGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA  160 (175)
T ss_dssp             TTCEEEEEEEEEEEEEETTEEEEEEEEEECTTTCSTTTTCCSGGGSCHHHHHHHHHHHHHTTTTSTTCCEEEEEEECHHH
T ss_pred             CCEEEEEEEEEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHH
T ss_conf             61389998889999740898666369866466764124418856889889999999999976867799368886539999


Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             999999999988509
Q gi|254780232|r  163 AHKIILEAVKRGIKE  177 (177)
Q Consensus       163 A~~iI~~~~~ry~k~  177 (177)
                      |.++|++||+||++|
T Consensus       161 A~~~I~~~~~~yk~k  175 (175)
T d1i40a_         161 AKAEIVASFERAKNK  175 (175)
T ss_dssp             HHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             999999999998649



>d2prda_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qeza_ b.40.5.1 (A:) Inorganic pyrophosphatase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1twla_ b.40.5.1 (A:) Inorganic pyrophosphatase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e9ga_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 177 inorganic pyrophosphatase [Candidatus Liberibacter
2au7_A_175 (A:) Inorganic pyrophosphatase; hydrolase, mutant; 1e-52
3lo0_A_193 (A:) Inorganic pyrophosphatase; ALS collaborative 1e-52
3fq3_A_197 (A:) Inorganic pyrophosphatase:bacterial/archaeal 6e-52
3gvf_A_196 (A:) Inorganic pyrophosphatase; structural genomic 2e-51
3d53_A_173 (A:) Inorganic pyrophosphatase; seattle structural 2e-51
1qez_A_173 (A:) Ppase, S-ppase, protein (inorganic pyrophosph 6e-51
2bqx_A_173 (A:) Inorganic pyrophosphatase; hydrolase; 1.90A { 9e-49
3i98_A_178 (A:) TH-IPP; pyrophosphatase, beta barrel, hydrola 2e-48
1sxv_A_172 (A:) Inorganic pyrophosphatase; structural genomic 5e-48
2prd_A_174 (A:) Pyrophosphate phosphohydrolase; 2.00A {Thermu 7e-48
1e9g_A_286 (A:) Ppase, inorganic pyrophosphatase; pyrophospha 2e-41
>2au7_A (A:) Inorganic pyrophosphatase; hydrolase, mutant; 1.05A {Escherichia coli} PDB: 1i40_A 1i6t_A 1igp_A 1obw_A 2au6_A 2au8_A 2au9_A 2auu_A 1mjy_A 1faj_A 1ino_A 1ipw_A 1jfd_A 2eip_A 1mjz_A 1mjx_A 1mjw_A 3i4q_A*Length = 175 Back     alignment and structure
 Score =  200 bits (509), Expect = 1e-52
 Identities = 82/174 (47%), Positives = 114/174 (65%)

Query: 4   LNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNT 63
           L  +  G + P D+ V IEI     PIKYE+DK+SG L VD+F+ST M YP NYG+I +T
Sbjct: 2   LLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDQFMSTAMFYPCNYGYINHT 61

Query: 64  LSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQ 123
           LS DGDPVDV++ +  P+ PGSV   RP+GV+KM D+ G D K++AVP   ++  YD I+
Sbjct: 62  LSLDGDPVDVLVPTPYPLQPGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIK 121

Query: 124 SYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE 177
              D+P     ++ HFF+HYKDLE GKW K++GWE   +A   I+ + +R   +
Sbjct: 122 DVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK 175


>3lo0_A (A:) Inorganic pyrophosphatase; ALS collaborative crystallography, emerald biostructures, hydrolase, structural genomics; 1.95A {Ehrlichia chaffeensis}Length = 193 Back     alignment and structure
>3fq3_A (A:) Inorganic pyrophosphatase:bacterial/archaeal inorganic pyrophosphatase; ssgcid, inorganic phosphatase, hydrolase; 1.90A {Brucella melitensis biovar ABORTUS2308}Length = 197 Back     alignment and structure
>3gvf_A (A:) Inorganic pyrophosphatase; structural genomics, hydrolase, seattle structural genomics center for infectious disease, ssgcid; HET: PGE; 1.75A {Burkholderia pseudomallei 1710B} PDB: 3d63_A* 3eiy_A 3ej0_A* 3ej2_A* 3eiz_A*Length = 196 Back     alignment and structure
>3d53_A (A:) Inorganic pyrophosphatase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, hydrolase, magnesium; 2.20A {Rickettsia prowazekii str} PDB: 3emj_A*Length = 173 Back     alignment and structure
>1qez_A (A:) Ppase, S-ppase, protein (inorganic pyrophosphatase); thermostability, magnesium, hydrolase; 2.70A {Sulfolobus acidocaldarius}Length = 173 Back     alignment and structure
>2bqx_A (A:) Inorganic pyrophosphatase; hydrolase; 1.90A {Helicobacter pylori} PDB: 1ygz_A 2bqy_ALength = 173 Back     alignment and structure
>3i98_A (A:) TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1.85A {Thermococcus thioreducens} PDB: 1ude_A 1twl_ALength = 178 Back     alignment and structure
>1sxv_A (A:) Inorganic pyrophosphatase; structural genomics, ppase,, hydrolase; 1.30A {Mycobacterium tuberculosis} PDB: 1wcf_A 2uxs_ALength = 172 Back     alignment and structure
>2prd_A (A:) Pyrophosphate phosphohydrolase; 2.00A {Thermus thermophilus HB8}Length = 174 Back     alignment and structure
>1e9g_A (A:) Ppase, inorganic pyrophosphatase; pyrophosphate phosphohydrolase, hydrolase, manganese; HET: PO4; 1.15A {Saccharomyces cerevisiae}Length = 286 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 inorganic pyrophosphatase [Candidatus Liberibacter asia
2au7_A_175 Inorganic pyrophosphatase; hydrolase, mutant; 1.05 100.0
3gvf_A_196 Inorganic pyrophosphatase; structural genomics, hy 100.0
2bqx_A_173 Inorganic pyrophosphatase; hydrolase; 1.90A {Helic 100.0
3fq3_A_197 Inorganic pyrophosphatase:bacterial/archaeal inorg 100.0
3i98_A_178 TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1 100.0
3d53_A_173 Inorganic pyrophosphatase; seattle structural geno 100.0
1qez_A_173 Ppase, S-ppase, protein (inorganic pyrophosphatase 100.0
2prd_A_174 Pyrophosphate phosphohydrolase; 2.00A {Thermus the 100.0
1sxv_A_172 Inorganic pyrophosphatase; structural genomics, pp 100.0
3lo0_A_193 Inorganic pyrophosphatase; ALS collaborative cryst 100.0
1e9g_A_286 Ppase, inorganic pyrophosphatase; pyrophosphate ph 100.0
>2au7_A (A:) Inorganic pyrophosphatase; hydrolase, mutant; 1.05A {Escherichia coli} PDB: 1i40_A 1i6t_A 1igp_A 1obw_A 2au6_A 2au8_A 2au9_A 2auu_A 1mjy_A 1faj_A 1ino_A 1ipw_A 1jfd_A 2eip_A 1mjz_A 1mjx_A 1mjw_A 3i4q_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=448.89  Aligned_cols=175  Identities=47%  Similarity=0.871  Sum_probs=172.3

Q ss_pred             CCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCHHHCCCCCCCCCEEEEEECCCCCC
Q ss_conf             50018866579985899998568687302688066570999421477656777812110553589984028992277767
Q gi|254780232|r    3 QLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPIL   82 (177)
Q Consensus         3 ~~~~i~~~~~~p~~vn~vIEIP~gs~~~KyE~d~~~g~~~~dR~l~~~~~yP~nYGfiP~T~~~DgDPLDvlvl~~~~~~   82 (177)
                      |+|+||++++.|++||||||||+||+|+|||||+++|.|++||++++++.||||||||||||++||||||||||++.|+.
T Consensus         1 ~whdip~~~~~~~~v~~viEIP~gs~n~KyE~d~~~g~i~~Dr~~~~~~~yP~nYGfIP~T~~~DgDPLDvlvl~~~~~~   80 (175)
T 2au7_A            1 SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDQFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQ   80 (175)
T ss_dssp             CGGGCCSCSBTTTBEEEEEEECTTCCSEEEEECTTTCCEEEEEECSSSCCCSSEEEECTTCCCTTSSCCEEEECCSSCCC
T ss_pred             CCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCEECCCCCCCCCEEEEEEECCCCC
T ss_conf             95547899999988999999579998524899626896899875577664886222011433579997147887066666


Q ss_pred             CCCEEEEEEEEEEEEECCCCCCEEEEEEECCCCCHHHCCCCCHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHH
Q ss_conf             74289986989999604787752799996378882225658778989899999999999964288897189803149999
Q gi|254780232|r   83 PGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNS  162 (177)
Q Consensus        83 ~G~vv~~r~iG~l~m~D~ge~D~KiiaVp~~d~~~~~~~i~di~Dl~~~~l~~I~~fF~~YK~le~~K~v~v~g~~~~~~  162 (177)
                      +|++++||+||+|+|+|+||.||||||||+++.+|++++++|++|++++++++|++||++||.|+++|++++.||.|+++
T Consensus        81 ~G~v~~~rviG~l~m~D~ge~D~Kii~V~~~~~dp~~~~i~di~dl~~~~l~~i~~fF~~YK~le~~k~~~~~g~~~~~~  160 (175)
T 2au7_A           81 PGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA  160 (175)
T ss_dssp             TTCEEEEEEEEEEEEEETTEECCEEEEEECTTTCSTTTTCCSGGGSCHHHHHHHHHHHHHTTTTSTTCCEEEEEEECHHH
T ss_pred             CEEEEEEEEEEEEECCCCCCCCCCEEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHCCCCCCCEEEECCEECHHH
T ss_conf             52589999999998044999625179875225676446528845789899999999999866867898189885709999


Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             999999999988509
Q gi|254780232|r  163 AHKIILEAVKRGIKE  177 (177)
Q Consensus       163 A~~iI~~~~~ry~k~  177 (177)
                      |+++|++||++|++|
T Consensus       161 A~~~I~~~~~~~~~~  175 (175)
T 2au7_A          161 AKAEIVASFERAKNK  175 (175)
T ss_dssp             HHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             999999999998649



>3gvf_A (A:) Inorganic pyrophosphatase; structural genomics, hydrolase, seattle structural genomics center for infectious disease, ssgcid; HET: PGE; 1.75A {Burkholderia pseudomallei 1710B} PDB: 3d63_A* 3eiy_A 3ej0_A* 3ej2_A* 3eiz_A* Back     alignment and structure
>2bqx_A (A:) Inorganic pyrophosphatase; hydrolase; 1.90A {Helicobacter pylori} PDB: 1ygz_A 2bqy_A Back     alignment and structure
>3fq3_A (A:) Inorganic pyrophosphatase:bacterial/archaeal inorganic pyrophosphatase; ssgcid, inorganic phosphatase, hydrolase; 1.90A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3i98_A (A:) TH-IPP; pyrophosphatase, beta barrel, hydrolase; 1.85A {Thermococcus thioreducens} PDB: 1ude_A 1twl_A Back     alignment and structure
>3d53_A (A:) Inorganic pyrophosphatase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, hydrolase, magnesium; 2.20A {Rickettsia prowazekii str} PDB: 3emj_A* Back     alignment and structure
>1qez_A (A:) Ppase, S-ppase, protein (inorganic pyrophosphatase); thermostability, magnesium, hydrolase; 2.70A {Sulfolobus acidocaldarius} Back     alignment and structure
>2prd_A (A:) Pyrophosphate phosphohydrolase; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>1sxv_A (A:) Inorganic pyrophosphatase; structural genomics, ppase,, hydrolase; 1.30A {Mycobacterium tuberculosis} PDB: 1wcf_A 2uxs_A Back     alignment and structure
>3lo0_A (A:) Inorganic pyrophosphatase; ALS collaborative crystallography, emerald biostructures, hydrolase, structural genomics; 1.95A {Ehrlichia chaffeensis} Back     alignment and structure
>1e9g_A (A:) Ppase, inorganic pyrophosphatase; pyrophosphate phosphohydrolase, hydrolase, manganese; HET: PO4; 1.15A {Saccharomyces cerevisiae} Back     alignment and structure