254780250

254780250

50S ribosomal protein L24

GeneID in NCBI database:8209231Locus tag:CLIBASIA_00675
Protein GI in NCBI database:254780250Protein Accession:YP_003064663.1
Gene range:-(137452, 137760)Protein Length:102aa
Gene description:50S ribosomal protein L24
COG prediction:[J] Ribosomal protein L24
KEGG prediction:rplX; 50S ribosomal protein L24; K02895 large subunit ribosomal protein L24
SEED prediction:LSU ribosomal protein L24p (L26e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG
ccccccccEEEEEEccccccEEEEEEEEccccEEEEEccEEEEEEEcccccccccEEEEEccccHHHEEEEcccccccEEEEEEEccEEEEEEccccccccc
ccEEccccEEEEEEccccccccEEEEEccccccEEEEccEEEEEcccccccccccEEEEcccEEEEEEEEEcccccccEEEEEccccccccHHHHccccEEc
mekirtgdRVLVLAgkdkgkagqVMGVVRKSGRAFVQGVNIVKrhqrqtpnkeagiISKEASIHLSnlslidkdgkqvrvgfsfvdgkkiriakrsgepidg
mekirtgdrvlvlagkdkgkagqvmgvvrksgrafvqgvnivkrhqrqtpnkeagiiskEASIHLSNlslidkdgkqvrvgfsfvdgkkiriakrsgepidg
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG
*EKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVK****************EASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPI**
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSG*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG
MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
315122807102 50S ribosomal protein L24 [Candidatus Liberibacter sola 1 2e-39
222148377102 50S ribosomal protein L24 [Agrobacterium vitis S4] Leng 1 1e-33
209548946102 50S ribosomal protein L24 [Rhizobium leguminosarum bv. 1 1e-32
222085686102 ribosomal protein L24 [Agrobacterium radiobacter K84] L 1 2e-32
116251551102 50S ribosomal protein L24 [Rhizobium leguminosarum bv. 1 3e-32
15889232102 50S ribosomal protein L24 [Agrobacterium tumefaciens st 1 3e-32
86357316102 50S ribosomal protein L24 [Rhizobium etli CFN 42] Lengt 1 3e-32
325293325102 50S ribosomal protein L24 [Agrobacterium sp. H13-3] Len 1 6e-32
15965120103 50S ribosomal protein L24 [Sinorhizobium meliloti 1021] 1 6e-29
239832111103 ribosomal protein L24 [Ochrobactrum intermedium LMG 330 1 7e-29
>gi|315122807|ref|YP_004063296.1| 50S ribosomal protein L24 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%)

Query: 1   MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKE 60
           MEKIR GDRV+VLAGKDKG+ GQV GVVRKS RAFVQGVNIVKRHQRQTPN+EAGIISKE
Sbjct: 1   MEKIRMGDRVVVLAGKDKGRIGQVTGVVRKSRRAFVQGVNIVKRHQRQTPNQEAGIISKE 60

Query: 61  ASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPID 101
           ASIHLSN++L+ KDGK++++ FSFVDGKKIR+ KRSGE ID
Sbjct: 61  ASIHLSNIALVGKDGKKLKIAFSFVDGKKIRVEKRSGERID 101


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148377|ref|YP_002549334.1| 50S ribosomal protein L24 [Agrobacterium vitis S4] Length = 102 Back     alignment and organism information
>gi|209548946|ref|YP_002280863.1| 50S ribosomal protein L24 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 102 Back     alignment and organism information
>gi|222085686|ref|YP_002544216.1| ribosomal protein L24 [Agrobacterium radiobacter K84] Length = 102 Back     alignment and organism information
>gi|116251551|ref|YP_767389.1| 50S ribosomal protein L24 [Rhizobium leguminosarum bv. viciae 3841] Length = 102 Back     alignment and organism information
>gi|15889232|ref|NP_354913.1| 50S ribosomal protein L24 [Agrobacterium tumefaciens str. C58] Length = 102 Back     alignment and organism information
>gi|86357316|ref|YP_469208.1| 50S ribosomal protein L24 [Rhizobium etli CFN 42] Length = 102 Back     alignment and organism information
>gi|325293325|ref|YP_004279189.1| 50S ribosomal protein L24 [Agrobacterium sp. H13-3] Length = 102 Back     alignment and organism information
>gi|15965120|ref|NP_385473.1| 50S ribosomal protein L24 [Sinorhizobium meliloti 1021] Length = 103 Back     alignment and organism information
>gi|239832111|ref|ZP_04680440.1| ribosomal protein L24 [Ochrobactrum intermedium LMG 3301] Length = 103 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
PRK00004105 PRK00004, rplX, 50S ribosomal protein L24; Reviewed 2e-29
TIGR01079104 TIGR01079, rplX_bact, ribosomal protein L24, bacterial/ 5e-21
KOG1708236 KOG1708, KOG1708, KOG1708, Mitochondrial/chloroplast ri 2e-12
CHL0014183 CHL00141, rpl24, ribosomal protein L24; Validated 2e-09
PRK01191120 PRK01191, rpl24p, 50S ribosomal protein L24P; Validated 7e-04
COG0198104 COG0198, RplX, Ribosomal protein L24 [Translation, ribo 8e-16
PRK1228176 PRK12281, rplX, 50S ribosomal protein L24; Reviewed 2e-11
>gnl|CDD|178786 PRK00004, rplX, 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>gnl|CDD|162194 TIGR01079, rplX_bact, ribosomal protein L24, bacterial/organelle Back     alignment and domain information
>gnl|CDD|36920 KOG1708, KOG1708, KOG1708, Mitochondrial/chloroplast ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177063 CHL00141, rpl24, ribosomal protein L24; Validated Back     alignment and domain information
>gnl|CDD|179242 PRK01191, rpl24p, 50S ribosomal protein L24P; Validated Back     alignment and domain information
>gnl|CDD|30547 COG0198, RplX, Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183399 PRK12281, rplX, 50S ribosomal protein L24; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 102 50S ribosomal protein L24 [Candidatus Liberibacter asia
TIGR01079109 rplX_bact ribosomal protein L24; InterPro: IPR003256 Ri 100.0
PRK00004102 rplX 50S ribosomal protein L24; Reviewed 100.0
COG0198104 RplX Ribosomal protein L24 [Translation, ribosomal stru 100.0
CHL0014190 rpl24 ribosomal protein L24; Validated 100.0
KOG1708236 consensus 99.96
PRK1228177 rplX 50S ribosomal protein L24; Reviewed 99.97
PRK01191119 rpl24p 50S ribosomal protein L24P; Validated 99.54
TIGR01080116 rplX_A_E ribosomal protein L24; InterPro: IPR005756 Rib 99.32
PTZ00194143 60S ribosomal protein L26; Provisional 99.24
KOG3401145 consensus 97.65
TIGR00405151 L26e_arch ribosomal protein L24; InterPro: IPR011590 Ri 97.57
pfam0046732 KOW KOW motif. This family has been extended to coincid 97.43
PRK08559153 nusG transcription antitermination protein NusG; Valida 96.77
smart0073928 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in rib 96.46
PRK05609183 nusG transcription antitermination protein NusG; Valida 96.38
PRK0433383 50S ribosomal protein L14e; Validated 95.85
COG0250178 NusG Transcription antiterminator [Transcription] 95.76
KOG1999 1024 consensus 94.29
PRK09014162 rfaH transcriptional activator RfaH; Provisional 93.92
>TIGR01079 rplX_bact ribosomal protein L24; InterPro: IPR003256 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00004 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>COG0198 RplX Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00141 rpl24 ribosomal protein L24; Validated Back     alignment and domain information
>KOG1708 consensus Back     alignment and domain information
>PRK12281 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated Back     alignment and domain information
>TIGR01080 rplX_A_E ribosomal protein L24; InterPro: IPR005756 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PTZ00194 60S ribosomal protein L26; Provisional Back     alignment and domain information
>KOG3401 consensus Back     alignment and domain information
>TIGR00405 L26e_arch ribosomal protein L24; InterPro: IPR011590 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>pfam00467 KOW KOW motif Back     alignment and domain information
>PRK08559 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information
>PRK05609 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>PRK04333 50S ribosomal protein L14e; Validated Back     alignment and domain information
>COG0250 NusG Transcription antiterminator [Transcription] Back     alignment and domain information
>KOG1999 consensus Back     alignment and domain information
>PRK09014 rfaH transcriptional activator RfaH; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
3e1b_O103 Structure Of The 50s Subunit Of E. Coli Ribosome In 2e-21
2j28_U102 Model Of E. Coli Srp Bound To 70s Rncs Length = 102 3e-21
1vs6_U104 Crystal Structure Of The Bacterial Ribosome From Es 6e-21
1p85_S103 Real Space Refined Coordinates Of The 50s Subunit F 7e-21
1nkw_S115 Crystal Structure Of The Large Ribosomal Subunit Fr 3e-20
2gya_S99 Structure Of The 50s Subunit Of A Pre-Translocation 4e-20
1pnu_S113 Crystal Structure Of A Streptomycin Dependent Ribos 2e-19
2ftc_N96 Structural Model For The Large Subunit Of The Mamma 1e-17
2j01_Y110 Structure Of The Thermus Thermophilus 70s Ribosome 3e-17
3mrz_U109 Recognition Of The Amber Stop Codon By Release Fact 4e-17
3bbo_W191 Homology Model For The Spinach Chloroplast 50s Subu 4e-16
3fin_Y101 T. Thermophilus 70s Ribosome In Complex With Mrna, 3e-15
3pyo_U100 Crystal Structure Of A Complex Containing Domain 3 2e-14
3izr_Y150 Localization Of The Large Subunit Ribosomal Protein 0.004
>gi|256032387|pdb|3E1B|O Chain O, Structure Of The 50s Subunit Of E. Coli Ribosome In Pre- Accommodation State Length = 103 Back     alignment and structure
 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 69/102 (67%), Gaps = 4/102 (3%)

Query: 2   EKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP--NKEAGIISK 59
            KIR  D V+VL GKDKGK G+V  V+  SG+  V+G+N+VK+HQ+  P  N+  GI+ K
Sbjct: 3   AKIRRDDEVIVLTGKDKGKRGKVKNVL-SSGKVIVEGINLVKKHQKPVPALNQPGGIVEK 61

Query: 60  EASIHLSNLSLID-KDGKQVRVGFSFVDGKKIRIAKRSGEPI 100
           EA+I +SN+++ +   GK  RVGF F DGKK+R  K + E I
Sbjct: 62  EAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSETI 103


>gi|119390365|pdb|2J28|U Chain U, Model Of E. Coli Srp Bound To 70s Rncs Length = 102 Back     alignment and structure
gi|116666590|pdb|1VS6|U Chain U, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 104 Back     alignment and structure
>gi|33357919|pdb|1P85|S Chain S, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 103 Back     alignment and structure
gi|28948938|pdb|1NKW|S Chain S, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 115 Back     alignment and structure
>gi|116667452|pdb|2GYA|S Chain S, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 99 Back     alignment and structure
>gi|34811572|pdb|1PNU|S Chain S, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 113 Back     alignment and structure
>gi|99032320|pdb|2FTC|N Chain N, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 96 Back     alignment and structure
gi|116668256|pdb|2J01|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 110 Back     alignment and structure
>gi|300508649|pdb|3MRZ|U Chain U, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 109 Back     alignment and structure
gi|189096145|pdb|3BBO|W Chain W, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 191 Back     alignment and structure
>gi|224510800|pdb|3FIN|Y Chain Y, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 101 Back     alignment and structure
>gi|322812592|pdb|3PYO|U Chain U, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 100 Back     alignment and structure
>gi|315113264|pdb|3IZR|Y Chain Y, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 150 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, spinach 6e-24
3ofq_U102 50S ribosomal protein L24; protein biosynthesis, riboso 8e-23
2j01_Y110 50S ribosomal protein L24; ribosome, tRNA, paromomycin, 6e-22
3i1n_U104 50S ribosomal protein L24; ribosome structure, protein- 2e-21
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosomal su 2e-21
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial ribo 1e-18
2wwb_L127 60S ribosomal protein L26-A; ribosome, protein EXIT tun 2e-11
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein-prote 3e-11
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 191 Back     alignment and structure
 Score =  104 bits (260), Expect = 6e-24
 Identities = 32/102 (31%), Positives = 56/102 (54%), Gaps = 3/102 (2%)

Query: 3   KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAG-IISKEA 61
            ++ GD V V++G +KGK G++  + + +    ++ +N   +H +     E G II  EA
Sbjct: 68  HVKVGDTVKVISGGEKGKIGEISKIHKHNSTVIIKDLNFKTKHVKSKEEGEQGQIIKIEA 127

Query: 62  SIHLSNLSLID-KDGKQVRVGFSFV-DGKKIRIAKRSGEPID 101
           +IH SN+ LI  +     RVG   + D +K+R   ++GE +D
Sbjct: 128 AIHSSNVMLILKEQEVADRVGHKILEDVRKVRYLIKTGEIVD 169


>3ofq_U 50S ribosomal protein L24; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 2j28_U* 3fik_U 2wwq_U 3ofr_U* 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3kcr_U 3orb_U* 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S ... Length = 102 Back     alignment and structure
>2j01_Y 50S ribosomal protein L24; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.34.5.1 PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 3d5b_Y 3d5d_Y 3f1f_Y 3f1h_Y ... Length = 110 Back     alignment and structure
>3i1n_U 50S ribosomal protein L24; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_U 1vs6_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S 2awb_U 2aw4_U 2i2v_U 2i2t_U* 2qao_U* 2qba_U* 2qbc_U* 2qbe_U ... Length = 104 Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Length = 115 Back     alignment and structure
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_N Length = 96 Back     alignment and structure
>2wwb_L 60S ribosomal protein L26-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_L 2ww9_L 1s1i_U Length = 127 Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Length = 120 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial ribo 100.0
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosomal su 100.0
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, spinach 100.0
2j01_Y110 50S ribosomal protein L24; ribosome, tRNA, paromomycin, 100.0
3ofq_U102 50S ribosomal protein L24; protein biosynthesis, riboso 100.0
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein-prote 99.9
2wwb_L127 60S ribosomal protein L26-A; ribosome, protein EXIT tun 99.85
2zkr_t145 60S ribosomal protein L26; protein-RNA complex, 60S rib 99.27
1nz9_A58 Transcription antitermination protein NUSG; transcripti 96.68
2ckk_A127 KIN17; beta barrel, ribosomal protein, ribonucleoprotei 96.28
2jvv_A181 Transcription antitermination protein NUSG; transcripti 95.99
2do3_A69 Transcription elongation factor SPT5; KOW motif, struct 95.94
2joy_A96 50S ribosomal protein L14E; protein solution structure, 94.01
1m1h_A248 Transcription antitermination protein NUSG; transcripti 93.94
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_N Back     alignment and structure
Probab=100.00  E-value=1.1e-40  Score=240.06  Aligned_cols=94  Identities=34%  Similarity=0.563  Sum_probs=91.3

Q ss_pred             CCEEEEEECCCCCCEEEEEEEECCCCEEEEECEEEEEEEECCCCCCCCEEEEEEECCCHHHEEEECC-CCCEEEEEEEE-
Q ss_conf             8699998437888646999997469989990605974320577765651799970468665788978-99622889999-
Q gi|254780250|r    7 GDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDK-DGKQVRVGFSF-   84 (102)
Q Consensus         7 GD~V~VisGkdKGk~G~V~~V~~k~~~ViVeGiN~~kkh~k~~~~~~gGii~~E~pIh~SNV~lvd~-~~k~trv~~~~-   84 (102)
                      ||+|+||||+||||+|+|++|++++|+|+|||+||++||++|+++++|||+++|+|||+|||||+|| +++|||++|++ 
T Consensus         1 GD~V~VisGkdKGk~G~Vl~V~~~~~~ViVeGvN~~kkh~k~~~~~~Ggii~~E~pIh~SNV~lvd~~~~k~trv~~~~~   80 (96)
T 2ftc_N            1 GDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFT   80 (96)
T ss_pred             CCEEEEEECCCCCCCEEEEEEECCCCEEEEECEEEEEEECCCCCCCCCCEEEEECCEEHHHEEEEECCCCCCEEEEEEEC
T ss_conf             99999906898997079999998689999946599988258777678878998847873537798088999589999998


Q ss_pred             ECCEEEEEECCCCCEE
Q ss_conf             9997999981568771
Q gi|254780250|r   85 VDGKKIRIAKRSGEPI  100 (102)
Q Consensus        85 ~dG~kvRv~kksg~~i  100 (102)
                      +||+|+|+|++||++|
T Consensus        81 edG~KvRv~kksG~~I   96 (96)
T 2ftc_N           81 EAGERVRVSTRSGRII   96 (96)
T ss_pred             CCCCEEEEEECCCCCC
T ss_conf             7996999990468789



>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Back     alignment and structure
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2j01_Y 50S ribosomal protein L24; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.34.5.1 PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Back     alignment and structure
>3ofq_U 50S ribosomal protein L24; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 2j28_U* 3fik_U 2wwq_U 3ofr_U* 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3kcr_U 3orb_U* 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S ... Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Back     alignment and structure
>2wwb_L 60S ribosomal protein L26-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_L 2ww9_L 1s1i_U Back     alignment and structure
>2zkr_t 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Back     alignment and structure
>2ckk_A KIN17; beta barrel, ribosomal protein, ribonucleoprotein, nuclear protein; 1.45A {Homo sapiens} Back     alignment and structure
>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A 2kvq_G Back     alignment and structure
>2do3_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.5.5 Back     alignment and structure
>2joy_A 50S ribosomal protein L14E; protein solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Sulfolobus solfataricus} SCOP: b.34.5.7 PDB: 2kds_A Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 102 50S ribosomal protein L24 [Candidatus Liberibacter asia
d2gycs199 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Esche 1e-21
d2zjrr1110 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deino 7e-21
d2j01y1101 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Therm 3e-19
d1vqot1119 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archa 5e-12
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: Ribosomal proteins L24p and L21e
domain: Ribosomal proteins L24 (L24p)
species: Escherichia coli [TaxId: 562]
 Score = 95.1 bits (237), Expect = 1e-21
 Identities = 48/99 (48%), Positives = 67/99 (67%), Gaps = 4/99 (4%)

Query: 3  KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP--NKEAGIISKE 60
          KIR  D V+VL GKDKGK G+V  V+   G+  V+G+N+VK+HQ+  P  N+  GI+ KE
Sbjct: 1  KIRRDDEVIVLTGKDKGKRGKVKNVLSS-GKVIVEGINLVKKHQKPVPALNQPGGIVEKE 59

Query: 61 ASIHLSNLSLID-KDGKQVRVGFSFVDGKKIRIAKRSGE 98
          A+I +SN+++ +   GK  RVGF F DGKK+R  K + E
Sbjct: 60 AAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSE 98


>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Length = 110 Back     information, alignment and structure
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Length = 101 Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
d2zjrr1110 Ribosomal proteins L24 (L24p) {Deinococcus radiodurans 100.0
d2gycs199 Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 100.0
d2j01y1101 Ribosomal proteins L24 (L24p) {Thermus thermophilus [Ta 100.0
d1vqot1119 Ribosomal proteins L24 (L24p) {Archaeon Haloarcula mari 99.89
d1nppa258 N-utilization substance G protein NusG, C-terminal doma 96.72
d1nz9a_58 N-utilization substance G protein NusG, C-terminal doma 96.7
d2do3a162 Transcription elongation factor SPT5 {Human (Homo sapie 96.06
d2joya196 Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 93.61
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: Ribosomal proteins L24p and L21e
domain: Ribosomal proteins L24 (L24p)
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=4.4e-42  Score=246.41  Aligned_cols=98  Identities=36%  Similarity=0.647  Sum_probs=93.8

Q ss_pred             CCCCCCCEEEEEECCCCCCEEEEEEEECCCCEEEEECEEEEEEEECCCC-CCCCEEEEEEECCCHHHEEEECC-CCCEEE
Q ss_conf             7226586999984378886469999974699899906059743205777-65651799970468665788978-996228
Q gi|254780250|r    2 EKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP-NKEAGIISKEASIHLSNLSLIDK-DGKQVR   79 (102)
Q Consensus         2 ~kikkGD~V~VisGkdKGk~G~V~~V~~k~~~ViVeGiN~~kkh~k~~~-~~~gGii~~E~pIh~SNV~lvd~-~~k~tr   79 (102)
                      |+|++||+|+||||+|||++|+|++|++++++|+|||+||++||++|++ +++|||+++|+|||+|||||+|| +++|||
T Consensus        11 ~kikkGD~V~VisGkdKGk~G~Vl~V~~~~~~ViVeGvN~~kkh~Kp~~~~~~Ggiv~~E~PIhiSNV~lvdp~~~k~tr   90 (110)
T d2zjrr1          11 LHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATR   90 (110)
T ss_dssp             CSSCTTSEEECCSSSSTTCEEEEEEEETTTTEEEESSSCBCCCCCCTTSSSCCCCCCCBCCCBCSSSEECBSSSSBCCCC
T ss_pred             EEEECCCEEEEEECCCCCCCEEEEEEECCCCEEEEECCEEEEEEECCCCCCCCCCEEEEEEEEEHHHEEEECCCCCCCEE
T ss_conf             24327999999045889961479999888999999585999987525344788874745320991127888587898548


Q ss_pred             EEEEEECCEEEEEECCCCCE
Q ss_conf             89999999799998156877
Q gi|254780250|r   80 VGFSFVDGKKIRIAKRSGEP   99 (102)
Q Consensus        80 v~~~~~dG~kvRv~kksg~~   99 (102)
                      |+|+++||+|+|||++||+.
T Consensus        91 v~~~~~dGkKvRv~kksGes  110 (110)
T d2zjrr1          91 VRKQIVDGKKVRVAVASGKT  110 (110)
T ss_dssp             CCCCCSCTTSCCCCSSSCCC
T ss_pred             EEEEEECCEEEEEEECCCCC
T ss_conf             99999199699999547899



>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2joya1 b.34.5.7 (A:1-96) Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 102 50S ribosomal protein L24 [Candidatus Liberibacter
2j01_Y_1-7878 (Y:1-78) 50S ribosomal protein L24; ribosome, tRNA 1e-15
2zjr_R_1-8787 (R:1-87) 50S ribosomal protein L24; ribosome, larg 1e-15
3bbo_W_1-140140 (W:1-140) Ribosomal protein L24; large ribosomal s 5e-14
1vq8_T_20-120101 (T:20-120) 50S ribosomal protein L24P; ribosome 50 2e-13
3i1n_U_1-25_67-10463 (U:1-25,U:67-104) 50S ribosomal protein L24; ribos 3e-08
3i1n_U_26-6641 (U:26-66) 50S ribosomal protein L24; ribosome stru 3e-07
>2j01_Y (Y:1-78) 50S ribosomal protein L24; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 78 Back     alignment and structure
 Score = 76.6 bits (189), Expect = 1e-15
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 3  KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP-NKEAGIISKEA 61
           ++ GD VLV +GK KG+ G+V  V+ K     V+GVNIVK+  R +P   + G I KEA
Sbjct: 6  HVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEA 65

Query: 62 SIHLSNLSLID 72
           +H S +  I 
Sbjct: 66 PLHASKVRPIC 76


>2zjr_R (R:1-87) 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 87 Back     alignment and structure
>3bbo_W (W:1-140) Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 140 Back     alignment and structure
>1vq8_T (T:20-120) 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 101 Back     alignment and structure
>3i1n_U (U:1-25,U:67-104) 50S ribosomal protein L24; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_U 1vs6_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S 2awb_U 2aw4_U 2i2v_U 2i2t_U* 2qao_U* 2qba_U* 2qbc_U* 2qbe_U ...Length = 63 Back     alignment and structure
>3i1n_U (U:26-66) 50S ribosomal protein L24; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_U 1vs6_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S 2awb_U 2aw4_U 2i2v_U 2i2t_U* 2qao_U* 2qba_U* 2qbc_U* 2qbe_U ...Length = 41 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target102 50S ribosomal protein L24 [Candidatus Liberibacter asia
2zjr_R_1-8787 50S ribosomal protein L24; ribosome, large ribosom 99.93
2j01_Y_1-7878 50S ribosomal protein L24; ribosome, tRNA, paromom 99.93
1vq8_T_20-120101 50S ribosomal protein L24P; ribosome 50S, protein- 99.92
3bbo_W_1-140140 Ribosomal protein L24; large ribosomal subunit, sp 99.91
3i1n_U_26-6641 50S ribosomal protein L24; ribosome structure, pro 99.36
3i1n_U_1-25_67-10463 50S ribosomal protein L24; ribosome structure, pro 99.83
2ftc_N_1-3131 Mitochondrial ribosomal protein L24; mitochondrial 98.46
1nz9_A_58 Transcription antitermination protein NUSG; transc 96.94
2wwb_L_26-70_100-11258 60S ribosomal protein L26-A; ribosome, protein EXI 96.77
2do3_A_69 Transcription elongation factor SPT5; KOW motif, s 96.03
2jvv_A_181 Transcription antitermination protein NUSG; transc 95.53
2zkr_t_37-68_101-11042 60S ribosomal protein L26; protein-RNA complex, 60 95.13
2joy_A_1-6363 50S ribosomal protein L14E; protein solution struc 92.77
>2zjr_R (R:1-87) 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
Probab=99.93  E-value=2.5e-27  Score=168.38  Aligned_cols=73  Identities=30%  Similarity=0.621  Sum_probs=69.9

Q ss_pred             CCCCCCCEEEEEECCCCCCEEEEEEEECCCCEEEEECEEEEEEEECCCC-CCCCEEEEEEECCCHHHEEEECCC
Q ss_conf             7226586999984378886469999974699899906059743205777-656517999704686657889789
Q gi|254780250|r    2 EKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP-NKEAGIISKEASIHLSNLSLIDKD   74 (102)
Q Consensus         2 ~kikkGD~V~VisGkdKGk~G~V~~V~~k~~~ViVeGiN~~kkh~k~~~-~~~gGii~~E~pIh~SNV~lvd~~   74 (102)
                      .+|++||+|+||+|+|||++|+|++|++++|+|+|||+|+.++|++|++ +++||++++|+|||+|||+|+||+
T Consensus        14 ~~i~kGD~V~Vi~G~dkGk~G~V~~V~~~~~~ViVegvN~~~~~~k~~~~~~~g~~~~~e~Pi~~SnV~lvdpk   87 (87)
T 2zjr_R           14 LHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPE   87 (87)
T ss_dssp             CSSCTTSEEECCSSSSTTCEEEEEEEETTTTEEEESSSCBCCCCCCTTSSSCCCCCCCBCCCBCSSSEECBSSS
T ss_pred             CEEECCCEEEEEECCCCCCEEEEEEEECCCCEEEEECCEEEEEEECCCCCCCCCCEEEEEEEEEHHHEEEECCC
T ss_conf             01208999999255899961689999888999999574899986056444788873777640886777888386



>2j01_Y (Y:1-78) 50S ribosomal protein L24; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>1vq8_T (T:20-120) 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>3bbo_W (W:1-140) Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3i1n_U (U:26-66) 50S ribosomal protein L24; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_U 1vs6_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S 2awb_U 2aw4_U 2i2v_U 2i2t_U* 2qao_U* 2qba_U* 2qbc_U* 2qbe_U ... Back     alignment and structure
>3i1n_U (U:1-25,U:67-104) 50S ribosomal protein L24; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_U 1vs6_U 3i1p_U 3i1r_U 3i1t_U 3i20_U 3i22_U 3e1b_O 3e1d_O 2qam_U* 1p85_S 1p86_S 2awb_U 2aw4_U 2i2v_U 2i2t_U* 2qao_U* 2qba_U* 2qbc_U* 2qbe_U ... Back     alignment and structure
>2ftc_N (N:1-31) Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_N Back     alignment and structure
>1nz9_A (A:) Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} Back     alignment and structure
>2wwb_L (L:26-70,L:100-112) 60S ribosomal protein L26-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_L 2ww9_L 1s1i_U Back     alignment and structure
>2do3_A (A:) Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvv_A (A:) Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A Back     alignment and structure
>2zkr_t (t:37-68,t:101-110) 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2joy_A (A:1-63) 50S ribosomal protein L14E; protein solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Sulfolobus solfataricus} Back     alignment and structure