254780278

254780278

phosphoglyceromutase

GeneID in NCBI database:8209260Locus tag:CLIBASIA_00815
Protein GI in NCBI database:254780278Protein Accession:YP_003064691.1
Gene range:-(164941, 165579)Protein Length:212aa
Gene description:phosphoglyceromutase
COG prediction:[G] Phosphoglycerate mutase 1
KEGG prediction:phosphoglyceromutase (EC:5.4.2.1); K01834 phosphoglycerate mutase [EC:5.4.2.1]
SEED prediction:Phosphoglycerate mutase (EC 5.4.2.1)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Methane metabolism [PATH:las00680]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK
cccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHcccccccEEEccccccccccccccccHHHHHHHccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHcccHHHHHcccccccEEEEEEEcccccEEEEEEEccHHHHcc
ccEEEEEEEcccEHHHHccEccccccccEcHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHccccccEEEcHHHcccccHHHcccEHHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHccccEEEEEcHHHHHHHHHHHHcccccHHHHccccccccEEEEEccccccccccccccHHHHcc
MNRRLVLVRHgqsewniknlftglrnppltsigmSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQqhitpiyddalnerdyghiagmnkddVCNKWGAEQVHLWRRsysvappggesLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKitvddipkvtigtGEAFVYQLGAdasivsknimrgqspaek
mnrrlvlvrhgqsewniknlftglrnPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSysvappggESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYqlgadasivsknimrgqspaek
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK
*NRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRG******
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK
MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
315122838217 phosphoglyceromutase [Candidatus Liberibacter solanacea 1 6e-91
15963915211 phosphoglyceromutase [Sinorhizobium meliloti 1021] Leng 1 2e-65
222147195211 phosphoglyceromutase [Agrobacterium vitis S4] Length = 1 3e-65
150398561211 phosphoglyceromutase [Sinorhizobium medicae WSM419] Len 1 6e-65
220920488208 phosphoglyceromutase [Methylobacterium nodulans ORS 206 1 8e-65
90421860207 phosphoglyceromutase [Rhodopseudomonas palustris BisB18 1 9e-65
188581686212 phosphoglyceromutase [Methylobacterium populi BJ001] Le 1 1e-64
299133271207 phosphoglycerate mutase 1 family [Afipia sp. 1NLS2] Len 1 1e-64
154244317207 phosphoglyceromutase [Xanthobacter autotrophicus Py2] L 1 1e-64
163851929212 phosphoglyceromutase [Methylobacterium extorquens PA1] 1 3e-64
>gi|315122838|ref|YP_004063327.1| phosphoglyceromutase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 217 Back     alignment and organism information
 Score =  337 bits (864), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 155/204 (75%), Positives = 180/204 (88%)

Query: 1   MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLK 60
           M R LVLVRHGQSEWN+KNLFTGLRNPPL+ +G+ EA  IGK  ++QGMVFD AFSSSL 
Sbjct: 1   MKRTLVLVRHGQSEWNVKNLFTGLRNPPLSPLGIDEAVNIGKKFSEQGMVFDVAFSSSLN 60

Query: 61  RAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSV 120
           RAQ+TC+IILQE+NQ+HI PIY++ALNERDYG+I+GMNKDD C KW AEQVH+WRRSY +
Sbjct: 61  RAQETCRIILQELNQEHIEPIYNNALNERDYGNISGMNKDDACKKWSAEQVHIWRRSYHI 120

Query: 121 APPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKV 180
           APPGGESLRDTVARV+ YYVQ ILP++LQNK +LV AHGNSLRSLIMVL++IT+D I  V
Sbjct: 121 APPGGESLRDTVARVVPYYVQSILPMVLQNKLVLVAAHGNSLRSLIMVLDRITIDSISDV 180

Query: 181 TIGTGEAFVYQLGADASIVSKNIM 204
           TI TGEA VYQLGADA+IVSKNI+
Sbjct: 181 TIDTGEAIVYQLGADATIVSKNII 204


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15963915|ref|NP_384268.1| phosphoglyceromutase [Sinorhizobium meliloti 1021] Length = 211 Back     alignment and organism information
>gi|222147195|ref|YP_002548152.1| phosphoglyceromutase [Agrobacterium vitis S4] Length = 211 Back     alignment and organism information
>gi|150398561|ref|YP_001329028.1| phosphoglyceromutase [Sinorhizobium medicae WSM419] Length = 211 Back     alignment and organism information
>gi|220920488|ref|YP_002495789.1| phosphoglyceromutase [Methylobacterium nodulans ORS 2060] Length = 208 Back     alignment and organism information
>gi|90421860|ref|YP_530230.1| phosphoglyceromutase [Rhodopseudomonas palustris BisB18] Length = 207 Back     alignment and organism information
>gi|188581686|ref|YP_001925131.1| phosphoglyceromutase [Methylobacterium populi BJ001] Length = 212 Back     alignment and organism information
>gi|299133271|ref|ZP_07026466.1| phosphoglycerate mutase 1 family [Afipia sp. 1NLS2] Length = 207 Back     alignment and organism information
>gi|154244317|ref|YP_001415275.1| phosphoglyceromutase [Xanthobacter autotrophicus Py2] Length = 207 Back     alignment and organism information
>gi|163851929|ref|YP_001639972.1| phosphoglyceromutase [Methylobacterium extorquens PA1] Length = 212 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
PRK01295206 PRK01295, PRK01295, phosphoglyceromutase; Provisional 1e-85
PRK14115247 PRK14115, gpmA, phosphoglyceromutase; Provisional 1e-57
TIGR01258245 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependen 3e-55
PRK01112228 PRK01112, PRK01112, phosphoglyceromutase; Provisional 2e-52
PTZ00123236 PTZ00123, PTZ00123, phosphoglycerate mutase like-protei 7e-50
PRK14119228 PRK14119, gpmA, phosphoglyceromutase; Provisional 4e-48
KOG0235214 KOG0235, KOG0235, KOG0235, Phosphoglycerate mutase [Car 1e-47
PRK14116228 PRK14116, gpmA, phosphoglyceromutase; Provisional 4e-46
PRK14118227 PRK14118, gpmA, phosphoglyceromutase; Provisional 8e-46
PRK14120249 PRK14120, gpmA, phosphoglyceromutase; Provisional 8e-44
PRK14117230 PRK14117, gpmA, phosphoglyceromutase; Provisional 3e-37
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain foun 2e-32
COG0406208 COG0406, GpmB, Fructose-2,6-bisphosphatase [Carbohydrat 2e-30
cd07040153 cd07040, HP, Histidine phosphatase domain found in a fu 5e-28
TIGR03162177 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase 9e-23
PRK13463203 PRK13463, PRK13463, phosphatase PhoE; Provisional 4e-09
KOG0234438 KOG0234, KOG0234, KOG0234, Fructose-6-phosphate 2-kinas 5e-09
COG0588230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate 2e-62
smart00855155 smart00855, PGAM, Phosphoglycerate mutase family 1e-37
pfam00300155 pfam00300, PGAM, Phosphoglycerate mutase family 2e-35
PRK07238372 PRK07238, PRK07238, bifunctional RNase H/acid phosphata 6e-20
PRK15004199 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisi 1e-19
TIGR03848204 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_41 2e-08
PRK03482215 PRK03482, PRK03482, phosphoglycerate mutase; Provisiona 3e-08
PRK13462203 PRK13462, PRK13462, acid phosphatase; Provisional 4e-08
PTZ00122299 PTZ00122, PTZ00122, phosphoglycerate mutase; Provisiona 4e-05
COG2062163 COG2062, SixA, Phosphohistidine phosphatase SixA [Signa 6e-08
KOG4609284 KOG4609, KOG4609, KOG4609, Predicted phosphoglycerate m 3e-05
TIGR00249152 TIGR00249, sixA, phosphohistidine phosphatase SixA 0.003
>gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|130325 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>gnl|CDD|179225 PRK01112, PRK01112, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|185460 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|35456 KOG0235, KOG0235, KOG0235, Phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|30755 COG0406, GpmB, Fructose-2,6-bisphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|163167 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase Back     alignment and domain information
>gnl|CDD|172065 PRK13463, PRK13463, phosphatase PhoE; Provisional Back     alignment and domain information
>gnl|CDD|35455 KOG0234, KOG0234, KOG0234, Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|30933 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|129088 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|144039 pfam00300, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184966 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>gnl|CDD|179583 PRK03482, PRK03482, phosphoglycerate mutase; Provisional Back     alignment and domain information
>gnl|CDD|139587 PRK13462, PRK13462, acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|185459 PTZ00122, PTZ00122, phosphoglycerate mutase; Provisional Back     alignment and domain information
>gnl|CDD|32245 COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|39809 KOG4609, KOG4609, KOG4609, Predicted phosphoglycerate mutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129351 TIGR00249, sixA, phosphohistidine phosphatase SixA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
PRK01295206 phosphoglyceromutase; Provisional 100.0
TIGR01258248 pgm_1 phosphoglycerate mutase 1 family; InterPro: IPR00 100.0
PRK01112228 phosphoglyceromutase; Provisional 100.0
PRK07238375 bifunctional RNase H/acid phosphatase; Provisional 100.0
PRK13463203 phosphatase PhoE; Provisional 100.0
PRK03482215 phosphoglycerate mutase; Provisional 100.0
PTZ00123235 phosphoglycerate mutase I; Provisional 100.0
PRK13462203 acid phosphatase; Provisional 100.0
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport 100.0
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members of th 100.0
COG0406208 phoE Broad specificity phosphatase PhoE and related pho 100.0
KOG0235214 consensus 100.0
cd07067153 HP_PGM_like Histidine phosphatase domain found in phosp 100.0
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Pr 100.0
KOG0234438 consensus 99.97
cd07040153 HP Histidine phosphatase domain found in a functionally 99.97
PTZ00122296 phosphoglycerate mutase; Provisional 99.94
KOG4609284 consensus 99.87
KOG4754248 consensus 99.79
PRK10848159 phosphohistidine phosphatase; Provisional 99.77
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal transduc 99.73
TIGR00249169 sixA phosphohistidine phosphatase SixA; InterPro: IPR00 99.57
PRK06193211 hypothetical protein; Provisional 99.49
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycerate m 100.0
pfam00300155 PGAM Phosphoglycerate mutase family. Y019_MYCTU and YK2 100.0
KOG3734272 consensus 99.8
cd07061242 HP_HAP_like Histidine phosphatase domain found in histi 97.17
pfam00328330 Acid_phosphat_A Histidine acid phosphatase. 96.98
KOG3720 411 consensus 96.49
PRK10173 413 glucose-1-phosphatase/inositol phosphatase; Provisional 96.27
PRK10172 432 phosphoanhydride phosphorylase; Provisional 95.44
KOG1057 1018 consensus 93.73
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase 1 family; InterPro: IPR005952 Most members of this family are phosphoglycerate mutase (5 Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase I; Provisional Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>KOG0235 consensus Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0234 consensus Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>KOG4609 consensus Back     alignment and domain information
>KOG4754 consensus Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA; InterPro: IPR004449 Phosphohistidine phosphatase SixA (3 Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>pfam00300 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>KOG3734 consensus Back     alignment and domain information
>cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>pfam00328 Acid_phosphat_A Histidine acid phosphatase Back     alignment and domain information
>KOG3720 consensus Back     alignment and domain information
>PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional Back     alignment and domain information
>PRK10172 phosphoanhydride phosphorylase; Provisional Back     alignment and domain information
>KOG1057 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
3kkk_A258 Y92c Catalytic Residue Mutant Of Phosphoglycerate M 5e-34
1xq9_A258 Structure Of Phosphoglycerate Mutase From Plasmodiu 5e-34
1e59_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase C 2e-32
3lnt_A250 Crystal Structure Of Phosphoglyceromutase From Burk 4e-31
3ezn_A257 Crystal Structure Of Phosphoglyceromutase From Burk 6e-31
1e58_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase L 4e-30
3d8h_A267 Crystal Structure Of Phosphoglycerate Mutase From C 5e-30
3fdz_B257 Crystal Structure Of Phosphoglyceromutase From Burk 1e-28
5pgm_E237 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 3e-28
1fzt_A211 Solution Structure And Dynamics Of An Open B-Sheet, 7e-28
4pgm_A246 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 8e-28
1qhf_A240 Yeast Phosphoglycerate Mutase-3pg Complex Structure 8e-28
3pgm_A244 The Structure Of Yeast Phosphoglycerate Mutase At 0 1e-26
1yfk_A262 Crystal Structure Of Human B Type Phosphoglycerate 4e-26
1rii_A265 Crystal Structure Of Phosphoglycerate Mutase From M 2e-22
1t8p_A267 Crystal Structure Of Human Erythrocyte 2,3- Bisphos 4e-20
2hhj_A267 Human Bisphosphoglycerate Mutase Complexed With 2,3 7e-18
1h2e_A207 Bacillus Stearothermophilus Phoe (Previously Known 3e-15
1ebb_A202 Bacillus Stearothermophilus Yhfr Length = 202 4e-15
2a6p_A208 Structure Solution To 2.2 Angstrom And Functional C 8e-13
1c7z_A191 Regulatory Complex Of Fructose-2,6-Bisphosphatase L 3e-12
1fbt_A190 The Bisphosphatase Domain Of The Bifunctional Rat L 5e-12
3bif_A468 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 5e-12
1bif_A469 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 6e-12
2axn_A520 Crystal Structure Of The Human Inducible Form 6- Ph 9e-12
1k6m_A432 Crystal Structure Of Human Liver 6-Phosphofructo-2- 3e-11
3mxo_A202 Crystal Structure Oh Human Phosphoglycerate Mutase 4e-10
1tip_A191 The Bisphosphatase Domain Of The Bifunctional Rat L 5e-10
3eoz_A214 Crystal Structure Of Phosphoglycerate Mutase From P 5e-10
2bif_A469 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 1e-09
3dcy_A275 Crystal Structure A Tp53-Induced Glycolysis And Apo 4e-08
3hjg_A213 Crystal Structure Of Putative Alpha-Ribazole-5'-Pho 0.001
2p6o_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 2e-11
2ekb_A177 Structural Study Of Project Id Tthb049 From Thermus 2e-11
2owe_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2owd_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p9z_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p9y_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p9f_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p79_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p78_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p77_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p30_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2p2z_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-11
2eoa_A177 Structural Study Of Project Id Tthb049 From Thermus 3e-11
2enw_A177 Mutant Y92h Structure Of Tthb049 From Thermus Therm 3e-11
2enu_A177 Mutant L121m Structure Of Tthb049 From Thermus Ther 3e-11
2ekz_A177 Structural Study Of Project Id Tthb049 From Thermus 3e-11
1v37_A177 Crystal Structure Of Phosphoglycerate Mutase From T 3e-11
2p6m_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-11
2p75_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-11
2p2y_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 1e-10
2pa0_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 6e-10
3e9c_A265 Structure Of A Tryptic Core Fragment Of Tigar From 2e-09
3e9e_A265 Structure Of Full-Length H11a Mutant Form Of Tigar 4e-07
3r7a_A237 Crystal Structure Of Phosphoglycerate Mutase From B 2e-06
3f3k_A265 The Structure Of Uncharacterized Protein Ykr043c Fr 6e-06
3lg2_A292 A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex 6e-06
3ll4_A292 Structure Of The H13a Mutant Of Ykr043c In Complex 4e-04
3oi7_A292 Structure Of The Structure Of The H13a Mutant Of Yk 0.001
>gi|268612503|pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 Back     alignment and structure
 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 76/238 (31%), Positives = 114/238 (47%), Gaps = 26/238 (10%)

Query: 1   MNR-RLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSL 59
           M    LVL+RHG+S WN +N FTG  + PL+  G  EA   GK L ++   FD  ++S L
Sbjct: 9   MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVL 68

Query: 60  KRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYS 119
           KRA  T   +L+  +  H+  +    LNER  G + G+NK +   K+G EQV +WRRSY 
Sbjct: 69  KRAICTAWNVLKTADLLHVPVVKTWRLNERHCGSLQGLNKSETAKKYGEEQVKIWRRSYD 128

Query: 120 VAPPGGESLRDTVARVL-------------------------AYYVQFILPLILQNKSIL 154
           + PP  +   +                                ++   I P IL NK ++
Sbjct: 129 IPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVM 188

Query: 155 VVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK 212
           V AHGNSLR L+  L+ ++  D+ ++ I TG   VY+L  +   +    +      +K
Sbjct: 189 VAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKK 246


>gi|58177556|pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 Back     alignment and structure
>gi|20149796|pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 Back     alignment and structure
>gi|288563216|pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 Back     alignment and structure
>gi|212375081|pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 Back     alignment and structure
>gi|157874482|pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 Back     alignment and structure
>gi|194320081|pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 Back     alignment and structure
>gi|220702515|pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3-Phosphoglyceric Acid Length = 257 Back     alignment and structure
>gi|157884466|pdb|5PGM|E Chain E, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 237 Back     alignment and structure
gi|13787076|pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 Back     alignment and structure
>gi|2624630|pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 Back     alignment and structure
>gi|5542362|pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 Back     alignment and structure
>gi|157836868|pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 Back     alignment and structure
>gi|67464262|pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 Back     alignment and structure
>gi|55669657|pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 Back     alignment and structure
>gi|52695673|pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 Back     alignment and structure
>gi|157883808|pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 Back     alignment and structure
>gi|23200124|pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 Back     alignment and structure
>gi|20149799|pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 Back     alignment and structure
>gi|109157117|pdb|2A6P|A Chain A, Structure Solution To 2.2 Angstrom And Functional Characterisation Of The Open Reading Frame Rv3214 From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>gi|33356831|pdb|1C7Z|A Chain A, Regulatory Complex Of Fructose-2,6-Bisphosphatase Length = 191 Back     alignment and structure
>gi|2392330|pdb|1FBT|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 190 Back     alignment and structure
>gi|6137441|pdb|3BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Empty 6-Pf-2k Active Site Length = 468 Back     alignment and structure
>gi|157830329|pdb|1BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Bifunctional Enzyme Complexed With Atp-G-S And Phosphate Length = 469 Back     alignment and structure
gi|83754166|pdb|2AXN|A Chain A, Crystal Structure Of The Human Inducible Form 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 520 Back     alignment and structure
>gi|27573692|pdb|1K6M|A Chain A, Crystal Structure Of Human Liver 6-Phosphofructo-2- KinaseFRUCTOSE-2,6-Bisphosphatase Length = 432 Back     alignment and structure
>gi|306991754|pdb|3MXO|A Chain A, Crystal Structure Oh Human Phosphoglycerate Mutase Family Member 5 (Pgam5) Length = 202 Back     alignment and structure
>gi|2914269|pdb|1TIP|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 191 Back     alignment and structure
>gi|215261304|pdb|3EOZ|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum, Pfd0660w Length = 214 Back     alignment and structure
>gi|6729954|pdb|2BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase H256a Mutant With F6p In Phosphatase Active Site Length = 469 Back     alignment and structure
>gi|194320090|pdb|3DCY|A Chain A, Crystal Structure A Tp53-Induced Glycolysis And Apoptosis Regulator Protein From Homo Sapiens Length = 275 Back     alignment and structure
>gi|238828326|pdb|3HJG|A Chain A, Crystal Structure Of Putative Alpha-Ribazole-5'-Phosphate Phosphatase Cobc From Vibrio Parahaemolyticus Length = 213 Back     alignment and structure
>gi|158429339|pdb|2P6O|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158428452|pdb|2EKB|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (L19m) Length = 177 Back     alignment and structure
>gi|159794993|pdb|2OWE|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|159794991|pdb|2OWD|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429364|pdb|2P9Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429362|pdb|2P9Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429356|pdb|2P9F|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429349|pdb|2P79|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429347|pdb|2P78|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429345|pdb|2P77|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429291|pdb|2P30|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429289|pdb|2P2Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158428576|pdb|2EOA|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (W85h) Length = 177 Back     alignment and structure
>gi|158428561|pdb|2ENW|A Chain A, Mutant Y92h Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158428559|pdb|2ENU|A Chain A, Mutant L121m Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158428477|pdb|2EKZ|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (L52m) Length = 177 Back     alignment and structure
gi|58176977|pdb|1V37|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429337|pdb|2P6M|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429343|pdb|2P75|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429288|pdb|2P2Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|158429366|pdb|2PA0|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>gi|218681814|pdb|3E9C|A Chain A, Structure Of A Tryptic Core Fragment Of Tigar From Danio Rerio Length = 265 Back     alignment and structure
>gi|218681818|pdb|3E9E|A Chain A, Structure Of Full-Length H11a Mutant Form Of Tigar From Danio Rerio Length = 265 Back     alignment and structure
>gi|329666274|pdb|3R7A|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Bacillus Anthracis Str. Sterne Length = 237 Back     alignment and structure
>gi|217035464|pdb|3F3K|A Chain A, The Structure Of Uncharacterized Protein Ykr043c From Saccharomyces Cerevisiae. Length = 265 Back     alignment and structure
>gi|290790216|pdb|3LG2|A Chain A, A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex Following Ligand Soaking Length = 292 Back     alignment and structure
>gi|290790232|pdb|3LL4|A Chain A, Structure Of The H13a Mutant Of Ykr043c In Complex With Fructose-1,6- Bisphosphate Length = 292 Back     alignment and structure
>gi|312208022|pdb|3OI7|A Chain A, Structure Of The Structure Of The H13a Mutant Of Ykr043c In Complex With Sedoheptulose-1,7-Bisphosphate Length = 292 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycolysis a 2e-46
3d8h_A267 Glycolytic phosphoglycerate mutase; structural genomics 6e-46
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, isomeras 1e-43
1qhf_A240 Protein (phosphoglycerate mutase); transferase (phospho 1e-39
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerate muta 2e-39
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria, str 4e-39
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6- bisphosphatase; 2e-38
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG 5e-38
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, hydro 1e-37
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 2e-37
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerate muta 1e-35
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-in 5e-33
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity phospha 5e-30
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, in S 5e-26
3f3k_A265 Uncharacterized protein YKR043C; structural genomics,, 8e-26
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; phos 6e-25
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, struct 6e-23
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted phosph 4e-16
1v37_A177 Phosphoglycerate mutase; riken structural genomics/prot 9e-15
3fjy_A364 Probable MUTT1 protein; dimer, protein structure initia 2e-13
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Dan 9e-33
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; PGM, 1e-29
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phospha 2e-29
2h0q_A261 Suppressor of T-cell receptor signaling 1; PGM, STS-1, 1e-27
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hy 8e-26
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase COBC; 2e-11
3f2i_A172 ALR0221 protein; alpha-beta protein, structural genomic 2e-12
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold, hyd 6e-11
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha-beta- 7e-11
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 Back     alignment and structure
 Score =  180 bits (458), Expect = 2e-46
 Identities = 81/234 (34%), Positives = 125/234 (53%), Gaps = 25/234 (10%)

Query: 4   RLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQ 63
           +LVLVRHG+S+WN +N FTG  +  L+  G+SEA   GKLL ++G  FD A++S LKRA 
Sbjct: 4   KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAI 63

Query: 64  DTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAPP 123
            T   +L E++Q  +       LNER YG + G+NK +   K+G EQV  WRR ++V PP
Sbjct: 64  HTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPP 123

Query: 124 G-------------------------GESLRDTVARVLAYYVQFILPLILQNKSILVVAH 158
                                      ESL  T+ RV+ Y+ + ILP +   + +++ AH
Sbjct: 124 ELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAH 183

Query: 159 GNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK 212
           GNSLR+L+  L+ ++ ++I ++ I TG   VY+   +   + +  +        
Sbjct: 184 GNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAA 237


>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, isomerase, structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum iowa II} Length = 267 Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis, isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* Length = 257 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical structural genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6- bisphosphatase; transferase (phospho), hydrolase (phospho), glycolysis, bifunctional enzyme; HET: ATG; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* Length = 267 Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* Length = 520 Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; phosphoglyerate mutase, SH3 domain binding, structural genomics, TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI-2, protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Saccharomyces cerevisiae} Length = 265 Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} Length = 202 Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural genomics consortium, SGC; 2.40A {Plasmodium falciparum 3D7} Length = 214 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI; 2.20A {Mycobacterium tuberculosis H37RV} Length = 208 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structural genomics/proteomics initiative, RSGI, structural genomics, isomerase; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II(PSI II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis ATCC15703} Length = 364 Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>2h0q_A Suppressor of T-cell receptor signaling 1; PGM, STS-1, signaling protein; 1.82A {Mus musculus} PDB: 2ikq_A Length = 261 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Nostoc SP} Length = 172 Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Length = 161 Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.35A {Agrobacterium tumefaciens str} Length = 173 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria, str 100.0
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerate muta 100.0
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG 100.0
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycolysis a 100.0
3d8h_A267 Glycolytic phosphoglycerate mutase; structural genomics 100.0
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, hydro 100.0
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerate muta 100.0
1qhf_A240 Protein (phosphoglycerate mutase); transferase (phospho 100.0
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, isomeras 100.0
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity phospha 100.0
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted phosph 100.0
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 100.0
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6- bisphosphatase; 100.0
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-in 100.0
3f3k_A265 Uncharacterized protein YKR043C; structural genomics,, 100.0
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Dan 100.0
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase COBC; 100.0
1v37_A177 Phosphoglycerate mutase; riken structural genomics/prot 100.0
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hy 100.0
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; PGM, 100.0
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phospha 100.0
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; phos 100.0
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, struct 100.0
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, in S 100.0
3f2i_A172 ALR0221 protein; alpha-beta protein, structural genomic 99.92
3fjy_A364 Probable MUTT1 protein; dimer, protein structure initia 99.91
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha-beta- 99.91
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold, hyd 99.9
1nd6_A 354 Prostatic acid phosphatase; PAP, prostate, phosphate, i 97.45
3it3_A 342 Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Fran 97.28
2wnh_A 418 3-phytase; histidine acid phosphatase, hydrolase; 1.68A 96.91
1dkq_A 410 Phytase; histidine acid phosphatase fold, hydrolase; HE 96.83
1qwo_A 442 Phytase; alpha barrel, beta sandwich, orthogonal bundle 96.81
3k4q_A 444 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis 96.58
1nt4_A 391 G1PASE, glucose-1-phosphatase; alpha domain, alpha-beta 96.37
2gfi_A 458 Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces caste 96.28
1qfx_A 460 Protein (PH 2.5 acid phosphatase); phosphomonoesterase, 92.13
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical structural genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
Probab=100.00  E-value=0  Score=348.18  Aligned_cols=211  Identities=39%  Similarity=0.623  Sum_probs=190.4

Q ss_pred             CCC-EEEEEECCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHCCCCCCC
Q ss_conf             985-8999956761110268420475755598989999999999875188842774233224310001122100133212
Q gi|254780278|r    1 MNR-RLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHIT   79 (212)
Q Consensus         1 M~~-~i~liRHGet~~n~~~~~~G~~D~~Lt~~G~~QA~~~~~~l~~~~~~~~~i~sSpl~Ra~qTa~~i~~~~~~~~~~   79 (212)
                      |++ ||||||||||+||..++|+||+|+|||+.|++||+.+|++|++.++.|+.||||||.||+|||+++++.++....+
T Consensus         9 m~t~kLyLvRHGeT~~N~~~~~~G~~D~pLTe~G~~QA~~lg~~L~~~~i~~~~i~sS~l~R~~~Ta~~i~~~~~~~~~~   88 (258)
T 3kkk_A            9 MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVLKRAICTAWNVLKTADLLHVP   88 (258)
T ss_dssp             -CCEEEEEEECCCBHHHHTTBCCTTCCCCBCHHHHHHHHHHHHHHHHTTCCCSEEEECSSHHHHHHHHHHHHHHTCTTSC
T ss_pred             CCCCEEEEECCCCCHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             67887999808889588668630899898499999999999999996799977898622558888887455543245552


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHCCCC-------------------------CCCCCCCCHHHHHHHHH
Q ss_conf             22221014443431011123568862110120010233-------------------------33211231123565531
Q gi|254780278|r   80 PIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRS-------------------------YSVAPPGGESLRDTVAR  134 (212)
Q Consensus        80 ~~~~~~L~E~~~G~~eG~~~~e~~~~~~~~~~~~~~~~-------------------------~~~~~p~GES~~~~~~R  134 (212)
                      ...+++|+|++||.|||++.+|+.++|++....++..+                         +...+|+|||+.|+++|
T Consensus        89 ~~~~~~l~E~~~G~~eg~~~~ei~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~p~GES~~d~~~R  168 (258)
T 3kkk_A           89 VVKTWRLNERHCGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVER  168 (258)
T ss_dssp             EEECGGGCCCCCGGGTTSBHHHHHHHTCHHHHHHHHHCSSCCCCCCCTTSTTCGGGCGGGTTSCGGGSCSCCCHHHHHHH
T ss_pred             EEECCCCCCCEECHHCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCHHHHHHH
T ss_conf             36652201341020103689999988459999887534456987555567547111455514874579898799999999


Q ss_pred             HCCHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHCCCHHHHHCCCCCCCEEEEEEECCCCCEEEEEECCCCCCCC
Q ss_conf             01001210000023324115646806999999998589977863231799619999988999688997137822015
Q gi|254780278|r  135 VLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAE  211 (212)
Q Consensus       135 v~~~~~~~i~~~~~~~~~vliVsHg~~ir~l~~~l~~~~~~~~~~~~i~~g~~~i~~~~~~~~~~~~~~~~~~~p~~  211 (212)
                      +.+++.+.+.+....+++|||||||++||+|++++++++.+++.++.+|||++++++++.++.+++..++.+.+...
T Consensus       169 v~~~~~~~~~~~~~~~~~vLIVsHg~~ir~ll~~l~~~~~~~~~~l~i~n~~~~v~~~~~~~~~i~~~~~~d~~~~~  245 (258)
T 3kkk_A          169 VLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELK  245 (258)
T ss_dssp             HHHHHHHTHHHHHHTTCCEEEEECHHHHHHHHHHHTTCCHHHHHHCCCCTTCCEEEEECTTCCEEEEEECC------
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHCCCHHHHHHCCCCCCCEEEEEECCCCCEEECEECCCHHHHH
T ss_conf             98878999756541588389990659999999998098989982011799817999988998676164368999999



>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis, isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, isomerase, structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; phosphoglyerate mutase, SH3 domain binding, structural genomics, TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI; 2.20A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6- bisphosphatase; transferase (phospho), hydrolase (phospho), glycolysis, bifunctional enzyme; HET: ATG; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3ll4_A* Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structural genomics/proteomics initiative, RSGI, structural genomics, isomerase; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural genomics consortium, SGC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI-2, protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Nostoc SP} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II(PSI II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibitor, hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* Back     alignment and structure
>3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* Back     alignment and structure
>2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A Back     alignment and structure
>1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A Back     alignment and structure
>1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein, phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* Back     alignment and structure
>3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} PDB: 3k4p_A* 1ihp_A Back     alignment and structure
>1nt4_A G1PASE, glucose-1-phosphatase; alpha domain, alpha-beta domain, occluded active site, enzyme-substrate complex; HET: G1P; 2.40A {Escherichia coli} SCOP: c.60.1.2 Back     alignment and structure
>2gfi_A Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces castellii} Back     alignment and structure
>1qfx_A Protein (PH 2.5 acid phosphatase); phosphomonoesterase, hydrolase; HET: NAG BMA MAN; 2.40A {Aspergillus niger} SCOP: c.60.1.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (S 2e-42
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli 8e-41
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falci 6e-37
d2hhja1248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo 7e-35
d1qhfa_240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (S 2e-34
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tu 5e-34
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose- 5e-23
d1h2ea_207 c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) 1e-18
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase { 2e-14
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
 Score =  165 bits (419), Expect = 2e-42
 Identities = 107/201 (53%), Positives = 137/201 (68%)

Query: 3   RRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRA 62
             LVL RHG+SEWN  NLFTG ++P L+  G+ EA   G+ L  +G  FD AF+S+L+RA
Sbjct: 8   NLLVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRA 67

Query: 63  QDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSVAP 122
           Q TCQIIL+E+ + ++  I  + LNER YG + G+NKDD   KWGAEQV +WRRSY +AP
Sbjct: 68  QKTCQIILEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAP 127

Query: 123 PGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTI 182
           P GESL+DT  RVL YY   I+P IL+ + +L+ AHGNSLR+LIM LE +T D I K  +
Sbjct: 128 PNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEGLTGDQIVKREL 187

Query: 183 GTGEAFVYQLGADASIVSKNI 203
            TG   VY L  D   VSK +
Sbjct: 188 ATGVPIVYHLDKDGKYVSKEL 208


>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target212 phosphoglyceromutase [Candidatus Liberibacter asiaticus
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} 100.0
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 100.0
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosaccharom 100.0
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosis [Ta 100.0
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9 100.0
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomyces c 100.0
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillus ste 100.0
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, p 100.0
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus thermo 100.0
d1nd6a_ 342 Prostatic acid phosphatase {Human (Homo sapiens) [TaxId 97.08
d1qwoa_ 435 Phytase (myo-inositol-hexakisphosphate-3-phosphohydrola 96.97
d1ihpa_ 438 Phytase (myo-inositol-hexakisphosphate-3-phosphohydrola 96.96
d1nt4a_ 391 Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} 96.68
d1dkla_ 409 Phytase (myo-inositol-hexakisphosphate-3-phosphohydrola 96.67
d1qfxa_ 447 Phytase (myo-inositol-hexakisphosphate-3-phosphohydrola 96.17
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=359.09  Aligned_cols=210  Identities=38%  Similarity=0.644  Sum_probs=190.7

Q ss_pred             CCCEEEEEECCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             98589999567611102684204757555989899999999998751888427742332243100011221001332122
Q gi|254780278|r    1 MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLAKQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITP   80 (212)
Q Consensus         1 M~~~i~liRHGet~~n~~~~~~G~~D~~Lt~~G~~QA~~~~~~l~~~~~~~~~i~sSpl~Ra~qTa~~i~~~~~~~~~~~   80 (212)
                      || ||||||||||+||..|+|+|++|+|||+.|++||+.+|+.|++.++.||.||||||+||+|||++++...+...+++
T Consensus         2 mt-rl~LvRHGeT~~N~~~~~~G~~D~pLTe~G~~QA~~~~~~L~~~~~~~d~i~sS~L~Ra~~Ta~~i~~~~~~~~~~i   80 (247)
T d1e58a_           2 VT-KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPV   80 (247)
T ss_dssp             CE-EEEEEECCCBHHHHTTBCCTTCCCCBCHHHHHHHHHHHHHHHHTTCCCSEEEECSSHHHHHHHHHHHHHHTCTTSCE
T ss_pred             CE-EEEEEECCCCHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCH
T ss_conf             33-99999799883663696618898980999999999999999965999662020677888989998986404556752


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHCCCCCCC-------------------------CCCCCHHHHHHHHHH
Q ss_conf             2221014443431011123568862110120010233332-------------------------112311235655310
Q gi|254780278|r   81 IYDDALNERDYGHIAGMNKDDVCNKWGAEQVHLWRRSYSV-------------------------APPGGESLRDTVARV  135 (212)
Q Consensus        81 ~~~~~L~E~~~G~~eG~~~~e~~~~~~~~~~~~~~~~~~~-------------------------~~p~GES~~~~~~Rv  135 (212)
                      ..+++|+|++||.|||++.+|+.++||++...+|+..+..                         ..|+|||+.++++|+
T Consensus        81 ~~~~~L~E~~~G~~eG~~~~ei~~~~~~e~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~p~gEs~~~~~~Rv  160 (247)
T d1e58a_          81 EKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRV  160 (247)
T ss_dssp             EECGGGCCCCCGGGTTCBHHHHHHHHCHHHHHHHHHCTTCCCCCCCTTSTTCGGGSGGGTTCCTTTSCSCCCHHHHHHHH
T ss_pred             HEECCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             10034201456666798599999985799998874334579854556660101111343133300177631699999997


Q ss_pred             CCHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHCCCHHHHHCCCCCCCEEEEEEECCCCCEEEEEECCCCCCCC
Q ss_conf             1001210000023324115646806999999998589977863231799619999988999688997137822015
Q gi|254780278|r  136 LAYYVQFILPLILQNKSILVVAHGNSLRSLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAE  211 (212)
Q Consensus       136 ~~~~~~~i~~~~~~~~~vliVsHg~~ir~l~~~l~~~~~~~~~~~~i~~g~~~i~~~~~~~~~~~~~~~~~~~p~~  211 (212)
                      .+++.+++......+++|||||||++||++++++++++.+.++++.++||++++++++.++.++++.++.+.+...
T Consensus       161 ~~~~~~~i~~~~~~~~~ilvVtHg~~ir~ll~~~l~~~~~~~~~l~i~n~s~~i~~~~~~~~~~~~~yL~d~~~~~  236 (247)
T d1e58a_         161 IPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIA  236 (247)
T ss_dssp             HHHHHHTHHHHHHTTCCEEEEECHHHHHHHHHHHTTCCHHHHHHCCCCTTCCEEEEECTTCCEEEEEECSCHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHCCCCHHHHHHCCCCCCEEEEEEECCCCCEEEEEECCCHHHHH
T ss_conf             7655422227660799889979579999999998199989995243789848999987999787537679999999