254780279

254780279

dihydrodipicolinate reductase

GeneID in NCBI database:8209261Locus tag:CLIBASIA_00820
Protein GI in NCBI database:254780279Protein Accession:YP_003064692.1
Gene range:-(165572, 166414)Protein Length:280aa
Gene description:dihydrodipicolinate reductase
COG prediction:[E] Dihydrodipicolinate reductase
KEGG prediction:dihydrodipicolinate reductase (EC:1.3.1.26); K00215 dihydrodipicolinate reductase [EC:1.3.1.26]
SEED prediction:Dihydrodipicolinate reductase (EC 1.3.1.26)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE
cccccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccHHcccHHHHccccccccEEEccHHHHHccccEEEEccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHHHcccccEEcHHHHHcccHHHHHHcc
cccccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEcccHHHHHHHccEEEEcccHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccHHHHHHHHHHHHHccccHHHHEEccccccccccccccEEEEEEEcccccEEEEEEEEEccEEEEEEEEEcccHHHHHHHHHHHHHHccccccEEcHHHHHcHcccHccccc
mhqspmrisvlgggRMGQALIKEIhnnpsitlHSIIVrsgspligqdvgnfvgispmgikfsdNLAMAIQSVDgiidfsspaltlqslnisAQHNIVHIIGTTGFSVKENEVISSFarnapivkssnmslgINFLGFLVETAAEYllpakdwdfEILEMHhrrkldspsgtaLLLGEAIangrkvnltDHMVLNRHIQQCARTEGSIGIASLRagsivgehsvviagegesitlshsaydRRIFARGSLTAALWAKsqipglysmrdvlgigldkekine
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAksqipglysmrdvlgigldkekine
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE
***SPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLD******
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE
**QSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE
MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target280 dihydrodipicolinate reductase [Candidatus Liberibacter
315122839276 dihydrodipicolinate reductase [Candidatus Liberibacter 1 1e-117
150398560272 dihydrodipicolinate reductase [Sinorhizobium medicae WS 1 8e-79
227823992272 dihydrodipicolinate reductase [Sinorhizobium fredii NGR 1 5e-78
15963914272 dihydrodipicolinate reductase [Sinorhizobium meliloti 1 1 1e-77
222084416274 dihydrodipicolinate reductase protein [Agrobacterium ra 1 8e-76
86355830274 dihydrodipicolinate reductase [Rhizobium etli CFN 42] L 1 9e-74
218515892274 dihydrodipicolinate reductase [Rhizobium etli 8C-3] Len 1 2e-72
209551698274 dihydrodipicolinate reductase [Rhizobium leguminosarum 1 4e-72
116249947274 dihydrodipicolinate reductase [Rhizobium leguminosarum 1 4e-72
327192337274 dihydrodipicolinate reductase [Rhizobium etli CNPAF512] 1 6e-72
>gi|315122839|ref|YP_004063328.1| dihydrodipicolinate reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 276 Back     alignment and organism information
 Score =  424 bits (1090), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/277 (74%), Positives = 241/277 (87%), Gaps = 1/277 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M +SPMRI +LGGGRMG++LI EIHNNPS  L S++VR GSPL+GQDVG+ VGIS +G+K
Sbjct: 1   MQKSPMRIVILGGGRMGRSLINEIHNNPSFILTSVVVRQGSPLVGQDVGDVVGISTIGVK 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
           FSD+L  A+QSVDGIIDFSSP LTLQSL+IS+Q N+VH+IGTTGFS+KENE+I+SFA+N 
Sbjct: 61  FSDDLVTAMQSVDGIIDFSSPVLTLQSLDISSQRNLVHVIGTTGFSIKENEMIASFAKNC 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IVKS NMSLGINFL FLV+TA+EY  P+KDWDFEILEMHHRRKLDSPSGTA LLGEAIA
Sbjct: 121 RIVKSGNMSLGINFLRFLVKTASEY-FPSKDWDFEILEMHHRRKLDSPSGTAFLLGEAIA 179

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GRKVN  DH+VLNR+ QQ  R EGSIGI+SLR GSIVGEHSVV+AGEGESITLSHSA+D
Sbjct: 180 EGRKVNFADHVVLNRNKQQRVREEGSIGISSLRGGSIVGEHSVVVAGEGESITLSHSAHD 239

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEK 277
           R +FARG+LTAALWA+ +  GLYSM DVL + L ++K
Sbjct: 240 RCVFARGALTAALWAEFKNFGLYSMYDVLDVELIRKK 276


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398560|ref|YP_001329027.1| dihydrodipicolinate reductase [Sinorhizobium medicae WSM419] Length = 272 Back     alignment and organism information
>gi|227823992|ref|YP_002827965.1| dihydrodipicolinate reductase [Sinorhizobium fredii NGR234] Length = 272 Back     alignment and organism information
>gi|15963914|ref|NP_384267.1| dihydrodipicolinate reductase [Sinorhizobium meliloti 1021] Length = 272 Back     alignment and organism information
>gi|222084416|ref|YP_002542945.1| dihydrodipicolinate reductase protein [Agrobacterium radiobacter K84] Length = 274 Back     alignment and organism information
>gi|86355830|ref|YP_467722.1| dihydrodipicolinate reductase [Rhizobium etli CFN 42] Length = 274 Back     alignment and organism information
>gi|218515892|ref|ZP_03512732.1| dihydrodipicolinate reductase [Rhizobium etli 8C-3] Length = 274 Back     alignment and organism information
>gi|209551698|ref|YP_002283615.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 274 Back     alignment and organism information
>gi|116249947|ref|YP_765785.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 274 Back     alignment and organism information
>gi|327192337|gb|EGE59301.1| dihydrodipicolinate reductase [Rhizobium etli CNPAF512] Length = 274 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target280 dihydrodipicolinate reductase [Candidatus Liberibacter
PRK00048257 PRK00048, PRK00048, dihydrodipicolinate reductase; Prov 9e-83
TIGR00036266 TIGR00036, dapB, dihydrodipicolinate reductase 1e-61
COG0289266 COG0289, DapB, Dihydrodipicolinate reductase [Amino aci 3e-79
pfam05173137 pfam05173, DapB_C, Dihydrodipicolinate reductase, C-ter 4e-43
pfam01113122 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-ter 1e-28
>gnl|CDD|178822 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>gnl|CDD|129147 TIGR00036, dapB, dihydrodipicolinate reductase Back     alignment and domain information
>gnl|CDD|30637 COG0289, DapB, Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|147385 pfam05173, DapB_C, Dihydrodipicolinate reductase, C-terminus Back     alignment and domain information
>gnl|CDD|144632 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 280 dihydrodipicolinate reductase [Candidatus Liberibacter
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 100.0
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 100.0
PRK00048265 dihydrodipicolinate reductase; Provisional 100.0
TIGR02130275 dapB_plant dihydrodipicolinate reductase; InterPro: IPR 99.96
PRK13303265 L-aspartate dehydrogenase; Provisional 99.08
PRK13304265 L-aspartate dehydrogenase; Reviewed 99.06
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 98.75
COG1748 389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.66
TIGR03450351 mycothiol_INO1 inositol 1-phosphate synthase, Actinobac 96.97
COG1260362 INO1 Myo-inositol-1-phosphate synthase [Lipid metabolis 94.88
pfam05173137 DapB_C Dihydrodipicolinate reductase, C-terminus. Dihyd 100.0
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 99.97
PRK13302271 putative L-aspartate dehydrogenase; Provisional 99.11
PRK11579346 putative oxidoreductase; Provisional 99.05
COG4091 438 Predicted homoserine dehydrogenase [Amino acid transpor 99.03
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 98.79
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 98.79
PRK08374316 homoserine dehydrogenase; Provisional 98.79
PRK06349 432 homoserine dehydrogenase; Provisional 98.71
PRK06270342 homoserine dehydrogenase; Provisional 98.62
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 98.61
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 98.59
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.58
PRK10206345 putative dehydrogenase; Provisional 98.54
COG3804350 Uncharacterized conserved protein related to dihydrodip 98.49
PRK06813341 homoserine dehydrogenase; Validated 98.48
PRK06392326 homoserine dehydrogenase; Provisional 98.43
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 98.42
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.35
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 98.33
KOG2741351 consensus 98.29
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 98.28
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 98.25
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 98.25
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 98.24
PRK07680273 late competence protein ComER; Validated 98.2
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 98.2
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 98.18
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 98.18
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 98.16
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 98.14
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 98.07
PRK05678289 succinyl-CoA synthetase subunit alpha; Validated 98.0
PRK08955333 glyceraldehyde-3-phosphate dehydrogenase; Validated 97.96
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.93
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validated 97.9
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 97.86
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 97.85
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 97.84
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 97.72
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 97.71
PRK09436817 thrA bifunctional aspartokinase I/homeserine dehydrogen 97.67
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 97.64
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 97.57
PRK09466810 metL bifunctional aspartate kinase II/homoserine dehydr 97.54
PRK08040337 putative semialdehyde dehydrogenase; Provisional 97.54
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energy pro 97.53
pfam00899134 ThiF ThiF family. This family contains a repeated domai 97.51
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 97.5
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.45
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 97.43
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 97.42
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 97.39
PRK08507275 prephenate dehydrogenase; Validated 97.39
COG2344211 AT-rich DNA-binding protein [General function predictio 97.39
PTZ00187309 succinyl-CoA synthetase alpha subunit; Provisional 97.38
PTZ00142 474 6-phosphogluconate dehydrogenase; Provisional 97.37
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.34
CHL00194319 ycf39 Ycf39; Provisional 97.31
TIGR02717 457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 97.28
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 97.24
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 97.24
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.21
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 97.19
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 97.19
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.19
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 97.14
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 97.11
PRK07411390 hypothetical protein; Validated 97.1
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 97.08
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 97.07
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 97.06
PRK08328230 hypothetical protein; Provisional 97.05
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.05
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 97.03
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 97.02
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 97.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 97.0
PRK07660283 consensus 96.94
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.93
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.93
PRK09117282 consensus 96.92
PRK09496 455 trkA potassium transporter peripheral membrane componen 96.9
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 96.89
KOG2711372 consensus 96.85
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.84
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 96.81
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 96.78
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.77
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.64
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.59
KOG1255329 consensus 96.58
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.53
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 96.51
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.45
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 96.38
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 96.38
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.37
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 96.37
PRK05086312 malate dehydrogenase; Provisional 96.35
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 96.32
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.32
PTZ00082322 L-lactate dehydrogenase; Provisional 96.31
PRK06545357 prephenate dehydrogenase; Validated 96.3
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 96.27
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 96.26
KOG0172 445 consensus 96.24
PRK08223287 hypothetical protein; Validated 96.18
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 96.11
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 96.07
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 96.04
PRK10083339 putative dehydrogenase; Provisional 95.98
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.97
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.94
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 95.9
TIGR01534366 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type 95.78
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.77
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 95.69
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.69
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 95.69
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.67
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 95.58
COG5495289 Uncharacterized conserved protein [Function unknown] 95.53
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.48
COG2085211 Predicted dinucleotide-binding enzymes [General functio 95.46
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 95.45
PRK06407302 ornithine cyclodeaminase; Provisional 95.45
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.39
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 95.36
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.36
PRK12921306 2-dehydropantoate 2-reductase; Provisional 95.34
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.32
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 95.3
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 95.29
PRK13771332 putative alcohol dehydrogenase; Provisional 95.02
KOG1198347 consensus 94.95
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 94.94
PRK10669558 putative cation:proton antiport protein; Provisional 94.89
PRK08605332 D-lactate dehydrogenase; Validated 94.69
PRK03815 401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.65
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 94.57
PRK05562222 precorrin-2 dehydrogenase; Provisional 94.55
PRK13243333 glyoxylate reductase; Reviewed 94.44
PRK06901323 aspartate-semialdehyde dehydrogenase; Provisional 94.43
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.4
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 94.11
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 94.09
PRK08229341 2-dehydropantoate 2-reductase; Provisional 94.05
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.88
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 93.79
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 93.72
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 93.63
PRK12480330 D-lactate dehydrogenase; Provisional 93.63
KOG4354340 consensus 93.59
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 93.5
TIGR01087 476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 93.47
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 93.19
KOG2018430 consensus 93.19
PRK06046326 alanine dehydrogenase; Validated 93.16
PRK07340304 ornithine cyclodeaminase; Validated 93.08
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 93.07
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 93.03
pfam1008796 DUF2325 Uncharacterized protein conserved in bacteria ( 92.9
TIGR01761378 thiaz-red thiazolinyl imide reductase; InterPro: IPR010 92.73
pfam06408 471 consensus 92.6
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 92.56
TIGR01296350 asd_B aspartate-semialdehyde dehydrogenase; InterPro: I 92.34
COG1832140 Predicted CoA-binding protein [General function predict 92.29
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 91.92
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 91.87
PRK09496455 trkA potassium transporter peripheral membrane componen 91.59
TIGR02992326 ectoine_eutC ectoine utilization protein EutC; InterPro 91.58
TIGR01759329 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 91.44
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 91.35
PRK09414446 glutamate dehydrogenase; Provisional 91.35
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 91.14
KOG1014312 consensus 90.85
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.83
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 90.76
TIGR01202325 bchC Chlorophyll synthesis pathway, bchC; InterPro: IPR 90.46
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 90.13
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 90.12
PRK04207338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 99.01
TIGR01546335 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenas 98.3
PRK08300298 acetaldehyde dehydrogenase; Validated 97.87
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 97.84
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 97.69
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 97.28
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.23
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 97.21
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.2
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.13
PRK05442325 malate dehydrogenase; Provisional 97.11
PRK08655 441 prephenate dehydrogenase; Provisional 97.1
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.06
PTZ00325313 malate dehydrogenase; Provisional 97.02
PRK06223312 malate dehydrogenase; Reviewed 96.91
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 96.83
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 96.81
PRK07417280 arogenate dehydrogenase; Reviewed 96.75
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 96.75
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.66
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.64
TIGR00715260 precor6x_red precorrin-6x reductase; InterPro: IPR00372 96.64
COG2910211 Putative NADH-flavin reductase [General function predic 96.51
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 96.46
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.43
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.42
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 96.3
KOG1502327 consensus 96.22
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.21
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 96.2
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 96.16
PRK13940414 glutamyl-tRNA reductase; Provisional 96.14
PRK06199379 ornithine cyclodeaminase; Validated 95.87
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 95.86
KOG2380 480 consensus 95.85
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 95.81
PTZ00117313 malate dehydrogenase; Provisional 95.72
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 95.64
PRK06823315 ornithine cyclodeaminase; Validated 95.37
PRK08291330 ornithine cyclodeaminase; Validated 95.35
PRK08618325 ornithine cyclodeaminase; Validated 95.08
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 94.95
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 94.88
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondar 94.86
PRK06141313 ornithine cyclodeaminase; Validated 94.78
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 94.68
cd04510334 consensus 94.68
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.54
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 94.34
PRK10124464 putative UDP-glucose lipid carrier transferase; Provisi 94.22
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 94.16
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 94.01
KOG0069336 consensus 94.0
PRK08605332 D-lactate dehydrogenase; Validated 93.92
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 93.9
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.78
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 93.74
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotra 93.68
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.66
KOG1494345 consensus 93.61
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl 93.6
PRK06436303 glycerate dehydrogenase; Provisional 93.39
PRK07589346 ornithine cyclodeaminase; Validated 93.35
COG4693361 PchG Oxidoreductase (NAD-binding), involved in sideroph 93.22
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.52
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 92.35
PRK12480330 D-lactate dehydrogenase; Provisional 92.27
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 92.26
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin homol 91.83
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 91.45
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.32
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 91.13
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 90.86
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases [Cell 90.63
KOG0409327 consensus 90.08
pfam03435 384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.73
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 98.17
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 98.15
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 98.14
PRK11559295 garR tartronate semialdehyde reductase; Provisional 97.83
COG1810224 Uncharacterized protein conserved in archaea [Function 96.06
pfam02593215 DUF166 Uncharacterized ArCR, COG1810. 95.94
PRK03562615 glutathione-regulated potassium-efflux system protein K 95.83
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 95.28
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.23
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolase 95.03
PRK03659602 glutathione-regulated potassium-efflux system protein K 94.87
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 94.74
KOG0455364 consensus 94.68
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 94.62
PRK11154706 fadJ multifunctional fatty acid oxidation complex subun 94.34
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 93.18
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 92.72
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose 98.22
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 97.99
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisional 97.98
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 97.93
TIGR01532334 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; In 95.67
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid transport 90.91
pfam00044150 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 98.05
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 98.05
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 96.86
PRK10675338 UDP-galactose-4-epimerase; Provisional 95.33
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 95.21
PRK07574385 formate dehydrogenase; Provisional 95.08
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2; Val 94.31
PRK12367250 short chain dehydrogenase; Provisional 93.42
PRK08289479 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 92.8
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 92.0
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 92.0
PRK02318 381 mannitol-1-phosphate 5-dehydrogenase; Provisional 90.78
KOG2304298 consensus 90.54
PRK12549284 shikimate 5-dehydrogenase; Reviewed 90.46
KOG2653 487 consensus 90.36
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 90.18
PRK06932314 glycerate dehydrogenase; Provisional 93.47
PRK06487317 glycerate dehydrogenase; Provisional 93.36
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 92.68
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase; InterPro: IPR011859 This narrow family includes genes from Arabidopsis and Fibrobacter succinogenes (which probably recieved the gene from a plant via lateral gene transfer) Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190 This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>COG1260 INO1 Myo-inositol-1-phosphate synthase [Lipid metabolism] Back     alignment and domain information
>pfam05173 DapB_C Dihydrodipicolinate reductase, C-terminus Back     alignment and domain information
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homeserine dehydrogenase I; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>pfam00899 ThiF ThiF family Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK07660 consensus Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>KOG2711 consensus Back     alignment and domain information
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1255 consensus Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731 Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>pfam02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>KOG0172 consensus Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I; InterPro: IPR006424 This group of sequences represent glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam10727 Rossmann-like Rossmann-like domain Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG1198 consensus Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849 This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam00107 ADH_zinc_N Zinc-binding dehydrogenase Back     alignment and domain information
>pfam02254 TrkA_N TrkA-N domain Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG4354 consensus Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>KOG2018 consensus Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam10087 DUF2325 Uncharacterized protein conserved in bacteria (DUF2325) Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase; InterPro: IPR010091 This reductase is found associated with gene clusters for the biosynthesis of various non-ribosomal peptide derived natural products in which cysteine is cyclised to a thiazoline ring containing an imide double bond Back     alignment and domain information
>pfam06408 consensus Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase; InterPro: IPR005986 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC; InterPro: IPR014334 Members of this entry are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, Pseudomonas putida and Sinorhizobium meliloti 1021, where it is known to be induced by ectoine) Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information