254780280

254780280

glucokinase

GeneID in NCBI database:8209262Locus tag:CLIBASIA_00825
Protein GI in NCBI database:254780280Protein Accession:YP_003064693.1
Gene range:-(166467, 167513)Protein Length:348aa
Gene description:glucokinase
COG prediction:none
KEGG prediction:glk; glucokinase (EC:2.7.1.2); K00845 glucokinase [EC:2.7.1.2]
SEED prediction:Glucokinase (EC 2.7.1.2)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Galactose metabolism [PATH:las00052]
Starch and sucrose metabolism [PATH:las00500]
Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Streptomycin biosynthesis [PATH:las00521]
Butirosin and neomycin biosynthesis
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
ccccccccccccccEEEEEcccccEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEEccEEEcccEEEEEccccEEcHHHHHHHcccccEEEEccHHHHHHcccccccccEEEEcccccccccccccEEEEEccccccEEEEEEcccccEEccccccccccccccHHHHHHHHHHHHHccccccHHHEEEHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHcccHHHHHHHcccccccHHHcccEEEEEccccHHHHHHHHHHHHccccEEEccccccccccc
ccccccccccccccEEEEEcccccEEEEEEEcccccccccEEccccccccHHHHHHHHHHHcccccHcHEEEEEccccccccEEEEccccccccHHHHHHHccccEEEEEccHHHHHHHHHcccHHHEEEEcccccccccccccEEEEcccccccEEEEEcccccEEEccccccccccccccHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHcccHHHHHHHcccHHHHHHcccEEEEEccccHHHHHHHHHHHccccEEEEEEccccccccc
mnniskkdfpiAFPVLLADIGGTNVRFAILRSmesepefcctvqtsdyENLEHAIQEVIYRKISIRLRSAFLAiatpigdqksftltnyhwvidpeelisrmqfEDVLLINDFEAQALAICSLSCSNYVSIGQfvednrslfssrvivgpgtglgISSVIrakdswipiscegghmdigpstqrdyeifphlteraegrlsaenllsGKGLVNIYKALCIAdgfesnkvlsskdivsksedPIALKAINLFCEYLGRVAGDLALIFMARGgvyisggipyKIIDLlrnssfresfenksphkelmrqiptyvitnpyIAIAGMVSYIKMTDCFNLFISegikrrwfkd
mnniskkdfpiAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIAtpigdqksftLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESfenksphkelmrqipTYVITNPYIAIAGMVSYIKMTDCFNLFIsegikrrwfkd
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
*************PVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADG**********DIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGI***W***
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRE*********ELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
*****KKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target348 glucokinase [Candidatus Liberibacter asiaticus str. psy
315122840363 glucokinase [Candidatus Liberibacter solanacearum CLso- 1 1e-149
325291625344 Glucokinase [Agrobacterium sp. H13-3] Length = 344 1 2e-88
159184201340 glucokinase [Agrobacterium tumefaciens str. C58] Length 1 2e-86
163757717341 putative glucokinase [Hoeflea phototrophica DFL-43] Len 1 2e-86
153008663346 glucokinase [Ochrobactrum anthropi ATCC 49188] Length = 1 1e-85
110635920342 glucokinase [Mesorhizobium sp. BNC1] Length = 342 1 1e-85
260167799343 glucokinase [Brucella sp. F5/99] Length = 343 1 3e-85
225629498348 glucokinase [Brucella ceti str. Cudo] Length = 348 1 3e-85
86355832341 glucokinase [Rhizobium etli CFN 42] Length = 341 1 5e-85
306840212343 glucokinase [Brucella sp. BO2] Length = 343 1 5e-85
>gi|315122840|ref|YP_004063329.1| glucokinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 363 Back     alignment and organism information
 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/345 (75%), Positives = 297/345 (86%), Gaps = 2/345 (0%)

Query: 3   NISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRK 62
           N+S ++FP AFPVLLADIGGTNVRFAILR MESE E C TV+T+DYE+LEHAIQEVI  K
Sbjct: 20  NMSNRNFPTAFPVLLADIGGTNVRFAILRDMESEIECCGTVKTADYESLEHAIQEVILSK 79

Query: 63  ISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICS 122
           ISIRLRSAFLA+AT IGDQK F LTNY W+IDPE LIS+M FEDVLLINDFEAQALA+C 
Sbjct: 80  ISIRLRSAFLALATSIGDQKKFMLTNYQWIIDPEALISQMNFEDVLLINDFEAQALAVCF 139

Query: 123 LSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPST 182
           LS S+YVS+G  ++ N   FSSRVIVGPGTGLG+S VIR K+SWIPIS EGGHM+IGPS+
Sbjct: 140 LSDSHYVSVGPDIKRNNCSFSSRVIVGPGTGLGVSGVIRLKNSWIPISGEGGHMNIGPSS 199

Query: 183 QRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDP 242
           +RD+EIFP+L E    RLSAE LLSG+GLVNIYKA+C ADGFE+   LS++DIV +   P
Sbjct: 200 KRDFEIFPYLIENE--RLSAEMLLSGRGLVNIYKAICKADGFENETSLSAQDIVCQEAHP 257

Query: 243 IALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHK 302
           IAL+AINLFC+YLGR+AGDLALIFM+RGGVYISGGIP KII LLRNSSFR SFENK+PHK
Sbjct: 258 IALEAINLFCDYLGRIAGDLALIFMSRGGVYISGGIPNKIIHLLRNSSFRASFENKAPHK 317

Query: 303 ELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFK 347
           ELMR+IPTYVITNPYIAI+GM+SYIKMTD FNL   EGI+ RW K
Sbjct: 318 ELMRKIPTYVITNPYIAISGMLSYIKMTDNFNLITDEGIRSRWIK 362


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291625|ref|YP_004277489.1| Glucokinase [Agrobacterium sp. H13-3] Length = 344 Back     alignment and organism information
>gi|159184201|ref|NP_353219.2| glucokinase [Agrobacterium tumefaciens str. C58] Length = 340 Back     alignment and organism information
>gi|163757717|ref|ZP_02164806.1| putative glucokinase [Hoeflea phototrophica DFL-43] Length = 341 Back     alignment and organism information
>gi|153008663|ref|YP_001369878.1| glucokinase [Ochrobactrum anthropi ATCC 49188] Length = 346 Back     alignment and organism information
>gi|110635920|ref|YP_676128.1| glucokinase [Mesorhizobium sp. BNC1] Length = 342 Back     alignment and organism information
>gi|260167799|ref|ZP_05754610.1| glucokinase [Brucella sp. F5/99] Length = 343 Back     alignment and organism information
>gi|225629498|ref|ZP_03787531.1| glucokinase [Brucella ceti str. Cudo] Length = 348 Back     alignment and organism information
>gi|86355832|ref|YP_467724.1| glucokinase [Rhizobium etli CFN 42] Length = 341 Back     alignment and organism information
>gi|306840212|ref|ZP_07472987.1| glucokinase [Brucella sp. BO2] Length = 343 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target348 glucokinase [Candidatus Liberibacter asiaticus str. psy
PRK00292316 PRK00292, glk, glucokinase; Provisional 1e-121
COG0837320 COG0837, Glk, Glucokinase [Carbohydrate transport and m 2e-91
PRK14101 638 PRK14101, PRK14101, bifunctional glucokinase/RpiR famil 6e-54
TIGR00749316 TIGR00749, glk, glucokinase, proteobacterial type 4e-53
PRK12408336 PRK12408, PRK12408, glucokinase; Provisional 3e-43
PTZ00288405 PTZ00288, PTZ00288, glucokinase 1; Provisional 5e-07
pfam02685316 pfam02685, Glucokinase, Glucokinase 8e-94
COG1940314 COG1940, NagC, Transcriptional regulator/sugar kinase [ 2e-06
>gnl|CDD|178964 PRK00292, glk, glucokinase; Provisional Back     alignment and domain information
>gnl|CDD|31179 COG0837, Glk, Glucokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184507 PRK14101, PRK14101, bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|129832 TIGR00749, glk, glucokinase, proteobacterial type Back     alignment and domain information
>gnl|CDD|183508 PRK12408, PRK12408, glucokinase; Provisional Back     alignment and domain information
>gnl|CDD|185540 PTZ00288, PTZ00288, glucokinase 1; Provisional Back     alignment and domain information
>gnl|CDD|145702 pfam02685, Glucokinase, Glucokinase Back     alignment and domain information
>gnl|CDD|32123 COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 348 glucokinase [Candidatus Liberibacter asiaticus str. psy
PRK00292315 glk glucokinase; Provisional 100.0
PRK12408336 glucokinase; Provisional 100.0
pfam02685316 Glucokinase Glucokinase. This is a family of glucokinas 100.0
COG0837320 Glk Glucokinase [Carbohydrate transport and metabolism] 100.0
TIGR00749342 glk glucokinase; InterPro: IPR003836 Glucokinases 2.7.1 100.0
PRK05082291 N-acetylmannosamine kinase; Provisional 100.0
TIGR00744326 ROK_glcA_fam ROK family protein (putative glucokinase); 100.0
PRK09557301 fructokinase; Reviewed 100.0
PRK13310302 N-acetyl-D-glucosamine kinase; Provisional 100.0
PRK09698302 D-allose kinase; Provisional 100.0
COG1940314 NagC Transcriptional regulator/sugar kinase [Transcript 100.0
pfam01869288 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family. This fam 99.54
COG2971301 Predicted N-acetylglucosamine kinase [Carbohydrate tran 99.17
COG5026466 Hexokinase [Carbohydrate transport and metabolism] 98.89
PTZ00107485 hexokinase; Provisional 98.88
KOG1794336 consensus 98.83
KOG1369474 consensus 98.77
PRK03011356 butyrate kinase; Provisional 98.62
PRK13317273 pantothenate kinase; Provisional 98.46
PRK13322252 pantothenate kinase; Reviewed 98.15
TIGR02707353 butyr_kinase butyrate kinase; InterPro: IPR011245 This 98.0
pfam03630329 Fumble Fumble. Fumble is required for cell division in 97.84
PRK13334262 consensus 97.7
PRK13311256 N-acetyl-D-glucosamine kinase; Provisional 100.0
PTZ00288411 glucokinase 1; Provisional 99.92
COG1521251 Pantothenate kinase type III (Bvg accessory factor fami 97.65
pfam00480181 ROK ROK family. 99.96
PRK07157398 acetate kinase; Provisional 98.22
PRK12397404 propionate kinase; Reviewed 98.2
pfam00871387 Acetate_kinase Acetokinase family. This family includes 98.15
PRK00180399 acetate kinase; Reviewed 98.02
PRK12379400 propionate/acetate kinase; Provisional 97.92
PRK12440397 acetate kinase; Reviewed 95.45
PRK07058393 acetate kinase; Provisional 93.9
KOG2201371 consensus 93.56
PRK13329246 pantothenate kinase; Reviewed 98.17
PRK13332251 consensus 97.88
PRK13318258 pantothenate kinase; Reviewed 97.81
PRK13321256 pantothenate kinase; Reviewed 97.66
PRK13326262 pantothenate kinase; Reviewed 97.61
PRK13319258 consensus 97.58
PRK13320245 pantothenate kinase; Reviewed 97.43
PRK13324258 pantothenate kinase; Reviewed 97.2
PRK13328255 pantothenate kinase; Reviewed 96.84
PRK13327242 pantothenate kinase; Reviewed 96.55
PRK13323258 consensus 96.35
PRK13330257 consensus 95.81
pfam03309206 Bvg_acc_factor Bordetella pertussis Bvg accessory facto 95.76
COG3426358 Butyrate kinase [Energy production and conversion] 97.46
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbohydra 97.25
PRK00047498 glpK glycerol kinase; Provisional 97.09
PRK10331470 L-fuculokinase; Provisional 96.91
PRK00290 631 dnaK molecular chaperone DnaK; Provisional 96.72
PRK04123542 ribulokinase; Provisional 96.47
PTZ00294510 glycerol kinase; Provisional 96.34
PRK10939521 autoinducer-2 (AI-2) kinase; Provisional 96.19
PRK09604335 putative DNA-binding/iron metalloprotein/AP endonucleas 95.72
TIGR02628473 fuculo_kin_coli L-fuculokinase; InterPro: IPR013450 Pro 95.0
PRK00976324 hypothetical protein; Provisional 94.25
pfam03727238 Hexokinase_2 Hexokinase. Hexokinase (EC:2.7.1.1) contai 91.99
TIGR01312494 XylB xylulokinase; InterPro: IPR006000 The ability to m 91.83
TIGR03281326 methan_mark_12 putative methanogenesis marker protein 1 90.03
pfam00349205 Hexokinase_1 Hexokinase. Hexokinase (EC:2.7.1.1) contai 97.39
PRK13331251 pantothenate kinase; Reviewed 96.74
COG5146342 PanK Pantothenate kinase, acetyl-CoA regulated [Coenzym 96.56
pfam05378175 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region. 96.55
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-c 96.55
COG1548330 Predicted transcriptional regulator/sugar kinase [Trans 96.42
TIGR03123318 one_C_unchar_1 probable H4MPT-linked C1 transfer pathwa 95.5
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subuni 93.7
PRK09472420 ftsA cell division protein FtsA; Reviewed 93.27
smart00842187 FtsA Cell division protein FtsA. FtsA is essential for 93.26
COG0443 579 DnaK Molecular chaperone [Posttranslational modificatio 97.29
CHL00094 622 dnaK heat shock protein 70 97.25
pfam00012 598 HSP70 Hsp70 protein. Hsp70 chaperones help to fold many 97.14
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 97.07
PRK13411 655 molecular chaperone DnaK; Provisional 96.89
PRK13410 719 molecular chaperone DnaK; Provisional 96.86
PRK05183 621 hscA chaperone protein HscA; Provisional 95.79
PRK01433 595 hscA chaperone protein HscA; Provisional 95.66
PTZ00009 657 heat shock 70 kDa protein; Provisional 90.99
pfam00370245 FGGY_N FGGY family of carbohydrate kinases, N-terminal 96.91
COG0145 674 HyuA N-methylhydantoinase A/acetone carboxylase, beta s 95.27
COG0554 499 GlpK Glycerol kinase [Energy production and conversion] 90.39
PRK00109141 Holliday junction resolvase-like protein; Reviewed 96.32
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF prote 96.21
pfam03652134 UPF0081 Uncharacterized protein family (UPF0081). 96.06
PRK13928325 rod shape-determining protein Mbl; Provisional 92.71
PRK13930336 rod shape-determining protein MreB; Provisional 92.52
TIGR02529240 EutJ ethanolamine utilization protein EutJ family prote 91.54
COG0816141 Predicted endonuclease involved in recombination (possi 90.48
PRK13929335 rod-share determining protein MreBH; Provisional 90.15
COG0282396 ackA Acetate kinase [Energy production and conversion] 94.07
KOG2517516 consensus 92.31
>PRK00292 glk glucokinase; Provisional Back     alignment and domain information
>PRK12408 glucokinase; Provisional Back     alignment and domain information
>pfam02685 Glucokinase Glucokinase Back     alignment and domain information
>COG0837 Glk Glucokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00749 glk glucokinase; InterPro: IPR003836 Glucokinases 2 Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase); InterPro: IPR004654 This family describes one branch of the ROK superfamily of proteins that may have activity as glucokinase although many proteins are as yet uncharacterised Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family Back     alignment and domain information
>COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5026 Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00107 hexokinase; Provisional Back     alignment and domain information
>KOG1794 consensus Back     alignment and domain information
>KOG1369 consensus Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PRK13322 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR02707 butyr_kinase butyrate kinase; InterPro: IPR011245 This group represents bacterial butyrate kinase, an enzyme that facilitates the formation of butyryl-CoA by phosphorylating butyrate in the presence of ATP to form butyryl phosphate Back     alignment and domain information
>pfam03630 Fumble Fumble Back     alignment and domain information
>PRK13334 consensus Back     alignment and domain information
>PRK13311 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PTZ00288 glucokinase 1; Provisional Back     alignment and domain information
>COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription] Back     alignment and domain information
>pfam00480 ROK ROK family Back     alignment and domain information
>PRK07157 acetate kinase; Provisional Back     alignment and domain information
>PRK12397 propionate kinase; Reviewed Back     alignment and domain information
>pfam00871 Acetate_kinase Acetokinase family Back     alignment and domain information
>PRK00180 acetate kinase; Reviewed Back     alignment and domain information
>PRK12379 propionate/acetate kinase; Provisional Back     alignment and domain information
>PRK12440 acetate kinase; Reviewed Back     alignment and domain information
>PRK07058 acetate kinase; Provisional Back     alignment and domain information
>KOG2201 consensus Back     alignment and domain information
>PRK13329 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13332 consensus Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13326 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13319 consensus Back     alignment and domain information
>PRK13320 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13324 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13328 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13327 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13323 consensus Back     alignment and domain information
>PRK13330 consensus Back     alignment and domain information
>pfam03309 Bvg_acc_factor Bordetella pertussis Bvg accessory factor family Back     alignment and domain information
>COG3426 Butyrate kinase [Energy production and conversion] Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK09604 putative DNA-binding/iron metalloprotein/AP endonuclease; Reviewed Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase; InterPro: IPR013450 Proteins in this entry are L-fuculokinases from the clade that includes the Escherichia coli enzyme P11553 from SWISSPROT Back     alignment and domain information
>PRK00976 hypothetical protein; Provisional Back     alignment and domain information
>pfam03727 Hexokinase_2 Hexokinase Back     alignment and domain information
>TIGR01312 XylB xylulokinase; InterPro: IPR006000 The ability to metabolise xylose, one of the most abundant sugars in nature, is dependent on its conversion to xylulose-5-phosphate, which then enters the non-oxidative pentose phosphate pathway Back     alignment and domain information
>TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 Back     alignment and domain information
>pfam00349 Hexokinase_1 Hexokinase Back     alignment and domain information
>PRK13331 pantothenate kinase; Reviewed Back     alignment and domain information
>COG5146 PanK Pantothenate kinase, acetyl-CoA regulated [Coenzyme metabolism] Back     alignment and domain information
>pfam05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>pfam00012 HSP70 Hsp70 protein Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>pfam00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>pfam03652 UPF0081 Uncharacterized protein family (UPF0081) Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein; InterPro: IPR013366 Salmonella typhimurium is capable of growth on ethanolamine as a sole source of carbon nitrogen and energy Back     alignment and domain information
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>COG0282 ackA Acetate kinase [Energy production and conversion] Back     alignment and domain information
>KOG2517 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target348 glucokinase [Candidatus Liberibacter asiaticus str. psy
1q18_A332 Crystal Structure Of E.Coli Glucokinase (Glk) Lengt 2e-58
2qm1_A326 Crystal Structure Of Glucokinase From Enterococcus 3e-27
1xc3_A302 Structure Of A Putative Fructokinase From Bacillus 2e-11
2gup_A292 Structural Genomics, The Crystal Structure Of A Rok 9e-11
3htv_A310 Crystal Structure Of D-Allose Kinase (Np_418508.1) 3e-10
3lm9_A302 Crystal Structure Of Fructokinase With Adp And Fruc 7e-06
3mcp_A366 Crystal Structure Of Glucokinase (Bdi_1628) From Pa 5e-05
2ap1_A327 Crystal Structure Of The Putative Regulatory Protei 1e-19
2aa4_A289 Crystal Structure Of Escherichia Coli Putative N- A 7e-15
3eo3_A333 Crystal Structure Of The N-Acetylmannosamine Kinase 2e-14
2q2r_A373 Trypanosoma Cruzi Glucokinase In Complex With Beta- 4e-10
1z05_A429 Crystal Structure Of The Rok Family Transcriptional 4e-11
3epq_A302 Crystal Structure Of Fructokinase From Bacillus Sub 0.004
3ohr_A303 Crystal Structure Of Fructokinase From Bacillus Sub 0.004
>gi|51247222|pdb|1Q18|A Chain A, Crystal Structure Of E.Coli Glucokinase (Glk) Length = 332 Back     alignment and structure
 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 98/318 (30%), Positives = 155/318 (48%), Gaps = 10/318 (3%)

Query: 16  LLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIA 75
           L+ D+GGTN R A+      E     T    DY +LE  I+  +     + ++   +AIA
Sbjct: 17  LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEH-KVEVKDGCIAIA 75

Query: 76  TPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFV 135
            PI        TN+ W     E    + F  + +INDF A + AI  L   + +  G   
Sbjct: 76  CPIT-GDWVAXTNHTWAFSIAEXKKNLGFSHLEIINDFTAVSXAIPXLKKEHLIQFGGAE 134

Query: 136 EDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTER 195
                  +     G GTGLG++ ++     W+ +  EGGH+D  P+++ +  I   L   
Sbjct: 135 PVEGKPIAVY---GAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE 191

Query: 196 AEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKS---EDPIALKAINLFC 252
               +SAE +LSG GLVN+Y+A+  AD     + L  KDI  ++         +A++LFC
Sbjct: 192 IG-HVSAERVLSGPGLVNLYRAIVKADN-RLPENLKPKDITERALADSCTDCRRALSLFC 249

Query: 253 EYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYV 312
              GR  G+LAL     GGV+I+GGI  + ++  + S FR +FE+K   KE +  IP Y+
Sbjct: 250 VIXGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYL 309

Query: 313 ITNPYIAIAGMVSYIKMT 330
           I +    + G  ++++ T
Sbjct: 310 IVHDNPGLLGSGAHLRQT 327


>gi|157835993|pdb|2QM1|A Chain A, Crystal Structure Of Glucokinase From Enterococcus Faecalis Length = 326 Back     alignment and structure
>gi|56554463|pdb|1XC3|A Chain A, Structure Of A Putative Fructokinase From Bacillus Subtilis Length = 302 Back     alignment and structure
>gi|109158083|pdb|2GUP|A Chain A, Structural Genomics, The Crystal Structure Of A Rok Family Protein From Streptococcus Pneumoniae Tigr4 In Complex With Sucrose Length = 292 Back     alignment and structure
>gi|241913533|pdb|3HTV|A Chain A, Crystal Structure Of D-Allose Kinase (Np_418508.1) From Escherichia Coli K12 At 1.95 A Resolution Length = 310 Back     alignment and structure
>gi|290790234|pdb|3LM9|A Chain A, Crystal Structure Of Fructokinase With Adp And Fructose Bound In The Active Site Length = 302 Back     alignment and structure
>gi|295982537|pdb|3MCP|A Chain A, Crystal Structure Of Glucokinase (Bdi_1628) From Parabactero Distasonis Atcc 8503 At 3.00 A Resolution Length = 366 Back     alignment and structure
>gi|78101419|pdb|2AP1|A Chain A, Crystal Structure Of The Putative Regulatory Protein Length = 327 Back     alignment and structure
>gi|73536195|pdb|2AA4|A Chain A, Crystal Structure Of Escherichia Coli Putative N- Acetylmannosamine Kinase, New York Structural Genomics Consortium Length = 289 Back     alignment and structure
>gi|209156783|pdb|3EO3|A Chain A, Crystal Structure Of The N-Acetylmannosamine Kinase Domain Of Human Gne Protein Length = 333 Back     alignment and structure
>gi|158429624|pdb|2Q2R|A Chain A, Trypanosoma Cruzi Glucokinase In Complex With Beta-D- Glucose And Adp Length = 373 Back     alignment and structure
>gi|62738865|pdb|1Z05|A Chain A, Crystal Structure Of The Rok Family Transcriptional Regulator, Homolog Of E.Coli Mlc Protein Length = 429 Back     alignment and structure
>gi|306992066|pdb|3OHR|A Chain A, Crystal Structure Of Fructokinase From Bacillus Subtilis Complexed With Adp Length = 303 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target348 glucokinase [Candidatus Liberibacter asiaticus str. psy
1sz2_A332 Glucokinase, glucose kinase; ATP-dependent, glucose bin 3e-35
2q2r_A373 Glucokinase 1, putative; ATPase hexose kinase family, t 1e-30
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, glcnac, 2e-04
3epq_A302 Putative fructokinase; SCRK, ADP binding, PSI2, MCSG, s 0.001
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structural ge 0.002
3mcp_A366 Glucokinase; structural genomics, joint center for stru 2e-14
3eo3_A333 Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-ace 8e-07
2qm1_A326 Glucokinase; alpha-beta structure, putative helix-turn- 2e-05
1z05_A429 Transcriptional regulator, ROK family; structural genom 3e-05
1zc6_A305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo 6e-04
3lm2_A226 Putative kinase; structural genomics, joint center for 4e-04
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Length = 332 Back     alignment and structure
 Score =  144 bits (362), Expect = 3e-35
 Identities = 93/318 (29%), Positives = 150/318 (47%), Gaps = 8/318 (2%)

Query: 15  VLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAI 74
            L+ D+GGTN R A+      E     T    DY +LE  I+  +  +  + ++   +AI
Sbjct: 16  ALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYL-EEHKVEVKDGCIAI 74

Query: 75  ATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQF 134
           A PI       +TN+ W     E+   + F  + +INDF A ++AI  L   + +  G  
Sbjct: 75  ACPI-TGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGA 133

Query: 135 VEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGPSTQRDYEIFPHLTE 194
                       + G GTGLG++ ++     W+ +  EGGH+D  P+++ +  I   L  
Sbjct: 134 EPVEGKPI---AVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEIL-R 189

Query: 195 RAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSEDPIALKAINLFC-- 252
              G +SAE +LSG GLVN+Y+A+  AD      +           D        L    
Sbjct: 190 AEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFC 249

Query: 253 EYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYV 312
             +GR  G+LAL     GGV+I+GGI  + ++  + S FR +FE+K   KE +  IP Y+
Sbjct: 250 VIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYL 309

Query: 313 ITNPYIAIAGMVSYIKMT 330
           I +    + G  ++++ T
Sbjct: 310 IVHDNPGLLGSGAHLRQT 327


>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Length = 373 Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, ribonuclease H fold, sugar kinase/HSP70/actin superfamily, domain rotation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Length = 347 Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Length = 310 Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Length = 366 Back     alignment and structure
>3eo3_A Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Length = 333 Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Length = 326 Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Length = 429 Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, structural genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum atcc 12472} SCOP: c.55.1.5 c.55.1.5 Length = 305 Back     alignment and structure
>3lm2_A Putative kinase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, transferase; HET: MSE; 1.70A {Agrobacterium tumefaciens} Length = 226 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target348 glucokinase [Candidatus Liberibacter asiaticus str. psy
1sz2_A332 Glucokinase, glucose kinase; ATP-dependent, glucose bin 100.0
2q2r_A373 Glucokinase 1, putative; ATPase hexose kinase family, t 100.0
1z05_A429 Transcriptional regulator, ROK family; structural genom 100.0
3eo3_A333 Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-ace 100.0
2gup_A292 ROK family protein; sugar kinase, APC80695, sucrose, st 100.0
2qm1_A326 Glucokinase; alpha-beta structure, putative helix-turn- 100.0
3epq_A302 Putative fructokinase; SCRK, ADP binding, PSI2, MCSG, s 100.0
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase; sug 100.0
3mcp_A366 Glucokinase; structural genomics, joint center for stru 100.0
1z6r_A406 MLC protein; transcriptional repressor, ROK family prot 100.0
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural genomics 100.0
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structural ge 100.0
2ap1_A327 Putative regulator protein; zinc binding protein, struc 100.0
3lm2_A226 Putative kinase; structural genomics, joint center for 100.0
1woq_A267 Inorganic polyphosphate/ATP-glucomannokinase; transfera 100.0
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, glcnac, 99.96
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, actin sup 99.95
1zc6_A305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo 99.88
2ews_A287 Pantothenate kinase; PANK, structural genomics, structu 99.79
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-protein 99.5
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose repre 99.44
3f9m_A470 Glucokinase; hexokinase IV, alternative splicing, ATP- 99.43
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schist 99.41
1zbs_A291 Hypothetical protein PG1100; alpha-beta protein., struc 99.36
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol acceptr); 99.36
1cza_N 917 Hexokinase type I; structurally homologous domains, tra 99.35
1zxo_A291 Conserved hypothetical protein Q8A1P1; NESG, BTR25, str 99.21
1saz_A381 Probable butyrate kinase 2; askha (acetate and sugar ki 98.56
3bex_A249 Type III pantothenate kinase; actin-like fold, ATP-bind 98.01
2h3g_X268 Biosynthetic protein; pantothenate kinase, anthrax, typ 97.62
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops complex, F 95.93
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/protei 92.76
1cza_N917 Hexokinase type I; structurally homologous domains, tra 99.41
1g99_A408 Acetate kinase; alpha/beta, askha (acetate and sugar ki 98.46
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.9 98.17
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xyl 97.76
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol metabo 97.57
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromaticivor 97.41
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, structural 97.27
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, struct 97.25
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, nucl 97.14
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric regula 97.07
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-bindin 97.03
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonuclease H 96.96
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, ATPa 96.89
2w40_A503 Glycerol kinase, putative; closed conformation, malaria 96.73
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structural g 96.72
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bo 96.38
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase; act 98.98
3h1q_A272 Ethanolamine utilization protein EUTJ; structural genom 97.63
1vhx_A150 Putative holliday junction resolvase; structural genomi 96.58
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structural gen 96.27
1nu0_A138 Hypothetical protein YQGF; structural genomics, structu 96.02
3p4i_A392 Acetate kinase; structural genomics, seattle structural 98.75
2iir_A403 Acetate kinase; transferase; 3.30A {Thermotoga maritima 98.48
3khy_A384 Propionate kinase; csgid, IDP01739, ATP-binding, nucleo 98.38
3cet_A334 Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, 90.79
2e1z_A415 Propionate kinase; TDCD, native, acetate kinase, nucleo 98.09
3i8b_A 515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J, 97.56
2itm_A 484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase, tra 97.31
2uyt_A 489 Rhamnulokinase; rhamnose degradation, IN-LINE phosphory 96.97
1e4f_T419 Cell division protein FTSA; bacterial cell division, ac 92.8
2f9w_A271 Pantothenate kinase; COAA, transferase; HET: PAU; 1.90A 97.51
3djc_A266 Type III pantothenate kinase; structural genomics, puta 96.05
3hz6_A 511 Xylulokinase; xylulose, structural genomic, manolate, t 97.49
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, sugar k 97.46
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP comple 97.42
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchange fa 96.1
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HSP-70, 91.61
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=337.12  Aligned_cols=315  Identities=30%  Similarity=0.511  Sum_probs=267.6

Q ss_pred             CCCEEEEEECCCCEEEEEEECCCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCEEEECCCCC
Q ss_conf             77379998575118999987799808899974388735889999999972234565546999730441685564213566
Q gi|254780280|r   12 AFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHW   91 (348)
Q Consensus        12 ~~~vL~iDIGGT~ir~glv~~~~~~i~~~~~~~t~~~~~~~~~i~~~l~~~~~~~~~~igi~v~Gpv~~~~~~~~~~~~~   91 (348)
                      ..=.|++||||||||+|++|+++.++...++++++++++++++|++++++. ..++.++||++||||+.+... ..+..+
T Consensus        13 ~~y~L~~DIGGT~ir~alvd~~~~~i~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~igI~~pGpv~~~~~~-~~~~~~   90 (332)
T 1sz2_A           13 TKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEH-KVEVKDGCIAIACPITGDWVA-MTNHTW   90 (332)
T ss_dssp             -CEEEEEEEETTEEEEEEEETTTCCEEEEEEEEGGGCSCHHHHHHHHHHHS-CCCCCEEEEEESSCCCSSEEC-CSSSCC
T ss_pred             CCEEEEEEECHHHHHHEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHHC-CCCCCEEEEEECCCCCCCEEE-EECCCC
T ss_conf             328999998815432556989999897889878987647999999999865-998775999902564287346-631433


Q ss_pred             CCCHHHHHHHHCCCCEEEECHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCEEEECCCCEEEEEEEECCCCCCEECCC
Q ss_conf             66988999982898558821265432000015865535302434557666752799317620224543105886301135
Q gi|254780280|r   92 VIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISC  171 (348)
Q Consensus        92 ~~~~~~l~~~~~~~~v~i~ND~~a~a~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~ig~GtG~g~~~~~~~~~g~~~~ag  171 (348)
                      .++..++...+...++.+.||+++.++++....+.....++.   +....+..++++++|||.|.+...+...|.+..++
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~g~---~~~~~~~~~~~lgtG~G~g~~~~~~~~~g~~~~ag  167 (332)
T 1sz2_A           91 AFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGG---AEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPG  167 (332)
T ss_dssp             CEEHHHHHHHHTCSEEEEEEHHHHHHHHGGGCCGGGEEECSS---CCCCTTCCEEEEEESSSEEEEEEEEETTEEEEEEC
T ss_pred             CCCHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHCC---CCCCCCCEEEEECCCCCCEEEEEECCCCCCCCCCC
T ss_conf             578689987642563566237332122444455646777376---77888626999837665656786034566543455


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHH--HHHHHCCCHHHHHHHH
Q ss_conf             67866667661023478999985318986487752222389999999874088864369888--9988368957999999
Q gi|254780280|r  172 EGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSK--DIVSKSEDPIALKAIN  249 (348)
Q Consensus       172 E~Gh~~~~~~~~~~~~~~~~l~~~~g~~~~~E~~~SG~gl~~~y~~l~~~~~~~~~~~~~~~--~~~~~~~D~~A~~~~~  249 (348)
                      |.||+.+.+....+....++ .|.|++.+|+|+++||++|.++|+++...............  +......|+.+.++++
T Consensus       168 e~G~~~~~~~~~~~~~~~~~-~~~~~~~g~~E~~~Sg~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  246 (332)
T 1sz2_A          168 EGGHVDFAPNSEEEAIILEI-LRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALS  246 (332)
T ss_dssp             CGGGSBCCCCSHHHHHHHHH-HHHHSSSCBGGGTSSHHHHHHHHHHHHHHTTCCCCCCCHHHHHHHHHHTCCHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHH-HHHCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHHH
T ss_conf             55665667765033211112-22036743001013121389999999742688831146278999987301267899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHCCEEEEECCCCHHHHHHHHHHC
Q ss_conf             99999999999999974899738996567765567727648999988379837889738879995787227759998738
Q gi|254780280|r  250 LFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKM  329 (348)
Q Consensus       250 ~~~~~lg~~i~~l~~~~~p~~~IvlgGGi~~~~~~~l~~~~f~~~f~~~~~~~~~l~~ipv~~~~~~~agl~GAa~~~r~  329 (348)
                      .+.++++..+.++++.+.|.+.|||||||+.++.+++.++.|+++|.+++++.++++++||++++++|+||+|||+|+||
T Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~IviGGGv~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ipv~~~~~~dagliGAa~~ar~  326 (332)
T 1sz2_A          247 LFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQ  326 (332)
T ss_dssp             HHHHHHHHHHHHHHHHHTCTTEEEEECSSSGGGHHHHHHSSHHHHHHCCGGGHHHHTTCCEEEECCSCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHCCHHHHHHHHHCCCHHHHHCCCCEEEEECCCHHHHHHHHHHHH
T ss_conf             99999999999999985899789996417750476628099999998446356686068889998985749999999998


Q ss_pred             CCC
Q ss_conf             001
Q gi|254780280|r  330 TDC  332 (348)
Q Consensus       330 ~~~  332 (348)
                      +-.
T Consensus       327 ~l~  329 (332)
T 1sz2_A          327 TLG  329 (332)
T ss_dssp             HTT
T ss_pred             HHC
T ss_conf             611



>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3eo3_A Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, APC80695, sucrose, structural genomics, PSI, protein structure initiative; HET: SUC; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3lm2_A Putative kinase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, transferase; HET: MSE; 1.70A {Agrobacterium tumefaciens} Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, ribonuclease H fold, sugar kinase/HSP70/actin superfamily, domain rotation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuclease-H fold, sugar kinase, glucose, conformational change; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, structural genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum atcc 12472} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, SGC, transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics, structural genomics consortium, SGC, allosteric enzyme; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, alternative splicing, ATP- binding, diabetes mellitus, disease mutation, glycolysis, nucleotide-binding, polymorphism; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.30A {Porphyromonas gingivalis W83} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure